| Basic Information | |
|---|---|
| Family ID | F059407 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 37 residues |
| Representative Sequence | LLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.21 % |
| % of genes near scaffold ends (potentially truncated) | 91.79 % |
| % of genes from short scaffolds (< 2000 bps) | 92.54 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.627 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.298 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (40.299 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF01921 | tRNA-synt_1f | 6.72 |
| PF00383 | dCMP_cyt_deam_1 | 5.97 |
| PF13460 | NAD_binding_10 | 5.22 |
| PF13302 | Acetyltransf_3 | 4.48 |
| PF02687 | FtsX | 4.48 |
| PF00583 | Acetyltransf_1 | 2.99 |
| PF00271 | Helicase_C | 2.24 |
| PF00248 | Aldo_ket_red | 2.24 |
| PF13540 | RCC1_2 | 1.49 |
| PF01791 | DeoC | 1.49 |
| PF13649 | Methyltransf_25 | 1.49 |
| PF16859 | TetR_C_11 | 1.49 |
| PF00440 | TetR_N | 1.49 |
| PF00486 | Trans_reg_C | 1.49 |
| PF01168 | Ala_racemase_N | 1.49 |
| PF13191 | AAA_16 | 1.49 |
| PF00455 | DeoRC | 0.75 |
| PF13463 | HTH_27 | 0.75 |
| PF00296 | Bac_luciferase | 0.75 |
| PF13384 | HTH_23 | 0.75 |
| PF07676 | PD40 | 0.75 |
| PF11774 | Lsr2 | 0.75 |
| PF03704 | BTAD | 0.75 |
| PF07883 | Cupin_2 | 0.75 |
| PF08240 | ADH_N | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF13193 | AMP-binding_C | 0.75 |
| PF13411 | MerR_1 | 0.75 |
| PF00274 | Glycolytic | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF03992 | ABM | 0.75 |
| PF03176 | MMPL | 0.75 |
| PF05163 | DinB | 0.75 |
| PF00561 | Abhydrolase_1 | 0.75 |
| PF01494 | FAD_binding_3 | 0.75 |
| PF04434 | SWIM | 0.75 |
| PF01243 | Putative_PNPOx | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF01734 | Patatin | 0.75 |
| PF03551 | PadR | 0.75 |
| PF05368 | NmrA | 0.75 |
| PF00294 | PfkB | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1384 | Lysyl-tRNA synthetase, class I | Translation, ribosomal structure and biogenesis [J] | 6.72 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.49 |
| COG1349 | DNA-binding transcriptional regulator of sugar metabolism, DeoR/GlpR family | Transcription [K] | 1.49 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.75 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.75 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.75 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.75 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.75 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.75 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.75 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.75 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.75 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.75 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.75 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.75 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.75 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.75 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.75 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.63 % |
| Unclassified | root | N/A | 25.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101996016 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300005439|Ga0070711_101013857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300005537|Ga0070730_10619381 | Not Available | 689 | Open in IMG/M |
| 3300005541|Ga0070733_10581617 | Not Available | 751 | Open in IMG/M |
| 3300005563|Ga0068855_102154306 | Not Available | 560 | Open in IMG/M |
| 3300005719|Ga0068861_100319998 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300005764|Ga0066903_100521829 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300005764|Ga0066903_107630609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300006162|Ga0075030_101133856 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006162|Ga0075030_101243178 | Not Available | 585 | Open in IMG/M |
| 3300006163|Ga0070715_10184234 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300006572|Ga0074051_11540882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 916 | Open in IMG/M |
| 3300006918|Ga0079216_10632584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 745 | Open in IMG/M |
| 3300009011|Ga0105251_10385599 | Not Available | 643 | Open in IMG/M |
| 3300009148|Ga0105243_12695581 | Not Available | 537 | Open in IMG/M |
| 3300009698|Ga0116216_10590974 | Not Available | 669 | Open in IMG/M |
| 3300010043|Ga0126380_11043672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. 846.5 | 692 | Open in IMG/M |
| 3300010048|Ga0126373_10410404 | Not Available | 1381 | Open in IMG/M |
| 3300010048|Ga0126373_12931768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 532 | Open in IMG/M |
| 3300010159|Ga0099796_10370988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300010360|Ga0126372_10115130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2061 | Open in IMG/M |
| 3300010360|Ga0126372_12395350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300010361|Ga0126378_11300285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 822 | Open in IMG/M |
| 3300010376|Ga0126381_100638355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1518 | Open in IMG/M |
| 3300010376|Ga0126381_103595761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300010376|Ga0126381_104183070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300010376|Ga0126381_105070098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 505 | Open in IMG/M |
| 3300010396|Ga0134126_12278306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300010396|Ga0134126_12327128 | Not Available | 584 | Open in IMG/M |
| 3300011270|Ga0137391_11020618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300011271|Ga0137393_10849209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300012354|Ga0137366_10373777 | Not Available | 1041 | Open in IMG/M |
| 3300012354|Ga0137366_10919745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 614 | Open in IMG/M |
| 3300012356|Ga0137371_10397120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
| 3300012361|Ga0137360_11805726 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012363|Ga0137390_10670799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1000 | Open in IMG/M |
| 3300012948|Ga0126375_10461765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300012971|Ga0126369_11293310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 819 | Open in IMG/M |
| 3300012971|Ga0126369_11408416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 787 | Open in IMG/M |
| 3300012987|Ga0164307_11244882 | Not Available | 619 | Open in IMG/M |
| 3300014150|Ga0134081_10095937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 930 | Open in IMG/M |
| 3300014169|Ga0181531_10834873 | Not Available | 575 | Open in IMG/M |
| 3300016341|Ga0182035_11365556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 635 | Open in IMG/M |
| 3300016341|Ga0182035_11388413 | Not Available | 630 | Open in IMG/M |
| 3300017822|Ga0187802_10297888 | Not Available | 628 | Open in IMG/M |
| 3300017932|Ga0187814_10051977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1509 | Open in IMG/M |
| 3300017970|Ga0187783_10375577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 1034 | Open in IMG/M |
| 3300017972|Ga0187781_11039037 | Not Available | 600 | Open in IMG/M |
| 3300017974|Ga0187777_10208381 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300018006|Ga0187804_10178465 | Not Available | 902 | Open in IMG/M |
| 3300018007|Ga0187805_10557675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300018025|Ga0187885_10377386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
| 3300018062|Ga0187784_10206934 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300020583|Ga0210401_11437752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300021178|Ga0210408_11008416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 644 | Open in IMG/M |
| 3300021374|Ga0213881_10101424 | Not Available | 1246 | Open in IMG/M |
| 3300021402|Ga0210385_10018826 | All Organisms → cellular organisms → Bacteria | 4338 | Open in IMG/M |
| 3300021405|Ga0210387_10372354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
| 3300021433|Ga0210391_11079736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300021476|Ga0187846_10147989 | Not Available | 995 | Open in IMG/M |
| 3300024225|Ga0224572_1011886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1649 | Open in IMG/M |
| 3300025320|Ga0209171_10470256 | Not Available | 629 | Open in IMG/M |
| 3300025908|Ga0207643_10354842 | Not Available | 921 | Open in IMG/M |
| 3300025916|Ga0207663_11582285 | Not Available | 528 | Open in IMG/M |
| 3300025927|Ga0207687_11446114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300025929|Ga0207664_10590461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 997 | Open in IMG/M |
| 3300025961|Ga0207712_10099087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2163 | Open in IMG/M |
| 3300026557|Ga0179587_10491009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300027096|Ga0208099_1003337 | Not Available | 1894 | Open in IMG/M |
| 3300027371|Ga0209418_1009506 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
| 3300027787|Ga0209074_10285002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
| 3300027884|Ga0209275_10242948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
| 3300027905|Ga0209415_10467357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
| 3300027911|Ga0209698_10695238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300028789|Ga0302232_10149476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
| 3300028885|Ga0307304_10336837 | Not Available | 672 | Open in IMG/M |
| 3300030520|Ga0311372_10039778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9374 | Open in IMG/M |
| 3300030969|Ga0075394_11415202 | Not Available | 594 | Open in IMG/M |
| 3300031543|Ga0318516_10052383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2223 | Open in IMG/M |
| 3300031543|Ga0318516_10858969 | Not Available | 511 | Open in IMG/M |
| 3300031545|Ga0318541_10029428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2710 | Open in IMG/M |
| 3300031545|Ga0318541_10443658 | Not Available | 726 | Open in IMG/M |
| 3300031545|Ga0318541_10503162 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031546|Ga0318538_10376063 | Not Available | 768 | Open in IMG/M |
| 3300031564|Ga0318573_10237453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 970 | Open in IMG/M |
| 3300031572|Ga0318515_10152903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1230 | Open in IMG/M |
| 3300031573|Ga0310915_11020427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300031668|Ga0318542_10103568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300031680|Ga0318574_10613786 | Not Available | 638 | Open in IMG/M |
| 3300031680|Ga0318574_10851217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 534 | Open in IMG/M |
| 3300031682|Ga0318560_10349238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 799 | Open in IMG/M |
| 3300031708|Ga0310686_102486067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 893 | Open in IMG/M |
| 3300031713|Ga0318496_10230361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
| 3300031713|Ga0318496_10384919 | Not Available | 775 | Open in IMG/M |
| 3300031713|Ga0318496_10724556 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031723|Ga0318493_10133943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
| 3300031723|Ga0318493_10145086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1224 | Open in IMG/M |
| 3300031724|Ga0318500_10114170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1242 | Open in IMG/M |
| 3300031736|Ga0318501_10872284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300031747|Ga0318502_10062545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1988 | Open in IMG/M |
| 3300031768|Ga0318509_10049914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2128 | Open in IMG/M |
| 3300031781|Ga0318547_10085019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1780 | Open in IMG/M |
| 3300031781|Ga0318547_10357131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 893 | Open in IMG/M |
| 3300031793|Ga0318548_10014698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3176 | Open in IMG/M |
| 3300031796|Ga0318576_10214919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 905 | Open in IMG/M |
| 3300031798|Ga0318523_10428104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300031799|Ga0318565_10156024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1107 | Open in IMG/M |
| 3300031805|Ga0318497_10820635 | Not Available | 521 | Open in IMG/M |
| 3300031819|Ga0318568_10182818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 1290 | Open in IMG/M |
| 3300031819|Ga0318568_10622298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300031821|Ga0318567_10165694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1226 | Open in IMG/M |
| 3300031832|Ga0318499_10368024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300031860|Ga0318495_10034489 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300031860|Ga0318495_10284399 | Not Available | 737 | Open in IMG/M |
| 3300031880|Ga0318544_10272519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha pittospori | 656 | Open in IMG/M |
| 3300031894|Ga0318522_10038324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1655 | Open in IMG/M |
| 3300031896|Ga0318551_10073158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1780 | Open in IMG/M |
| 3300031896|Ga0318551_10141164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 1310 | Open in IMG/M |
| 3300031910|Ga0306923_10565816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
| 3300031954|Ga0306926_11109557 | Not Available | 935 | Open in IMG/M |
| 3300032008|Ga0318562_10086205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1768 | Open in IMG/M |
| 3300032008|Ga0318562_10331900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 884 | Open in IMG/M |
| 3300032009|Ga0318563_10171012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1169 | Open in IMG/M |
| 3300032009|Ga0318563_10419305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300032039|Ga0318559_10462971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300032041|Ga0318549_10383490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032043|Ga0318556_10585622 | Not Available | 582 | Open in IMG/M |
| 3300032060|Ga0318505_10191563 | Not Available | 956 | Open in IMG/M |
| 3300032063|Ga0318504_10088311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
| 3300032180|Ga0307471_101216523 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032261|Ga0306920_102974511 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300032782|Ga0335082_10815789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300033158|Ga0335077_11243705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300034065|Ga0334827_158532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.75% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019960161 | 3300000364 | Soil | LALIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR* |
| Ga0070711_1010138571 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL* |
| Ga0070730_106193812 | 3300005537 | Surface Soil | LLYNEQGRRPDEIASKLGLSTYTVTQIILGSRNRGKL* |
| Ga0070733_105816172 | 3300005541 | Surface Soil | NEQGLRPEEIAQKLGLSRYLVTQIILASRNRAKL* |
| Ga0068855_1021543062 | 3300005563 | Corn Rhizosphere | LLYNEQGRRPEEIADKLGLSTYLVTQIILTSRNRGKL* |
| Ga0068861_1003199982 | 3300005719 | Switchgrass Rhizosphere | LYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL* |
| Ga0066903_1005218293 | 3300005764 | Tropical Forest Soil | LYNSQGLRPAEIAAKLRVSSHLVTQIILAAKNRGKA* |
| Ga0066903_1076306092 | 3300005764 | Tropical Forest Soil | YNEQGLRPAEIAEKLGVSPYMASQIILAARNRAKR* |
| Ga0075030_1011338561 | 3300006162 | Watersheds | NEQGLPPQEIADKLGLSTYTVTQIILTSRNRGKL* |
| Ga0075030_1012431781 | 3300006162 | Watersheds | ALLYNEQGLRPAEIAGKLGVSTYTATQIILAARNHPQH* |
| Ga0070715_101842342 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLYNEQGRRPEEIAQKLGLSPYLVTQIILSSRNRGKL* |
| Ga0074051_115408821 | 3300006572 | Soil | LIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR* |
| Ga0079216_106325842 | 3300006918 | Agricultural Soil | QRQENLALIYRDQGLRPDEIAEKLRLSTYTVTQILLAAKPRGRRRLA* |
| Ga0105251_103855991 | 3300009011 | Switchgrass Rhizosphere | KSQEKLALLYIEQGRRPEEIADKLGLGTYLVSQIILTSRNRGKL* |
| Ga0105243_126955812 | 3300009148 | Miscanthus Rhizosphere | LYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL* |
| Ga0116216_105909741 | 3300009698 | Peatlands Soil | LYNEQGKRPDEIAAKLGLSTYIVTQIILGSRNRGKL* |
| Ga0126380_110436721 | 3300010043 | Tropical Forest Soil | RLALIYNEQGLRPAEIAQKLGVTPYMASQIILAARNQAKR* |
| Ga0126373_104104041 | 3300010048 | Tropical Forest Soil | LYNEQGLRPSDIAAKLGISSHLATQIILAARNRGKS* |
| Ga0126373_129317681 | 3300010048 | Tropical Forest Soil | NAQGLRPEEIAAKLGLSVYTVTQIILTSKNRGKL* |
| Ga0099796_103709881 | 3300010159 | Vadose Zone Soil | LLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL* |
| Ga0126372_101151301 | 3300010360 | Tropical Forest Soil | LYNEQGLRPVEIADKLGVSAYLVTQIILAAKNRR* |
| Ga0126372_123953501 | 3300010360 | Tropical Forest Soil | NEQNLRPDEIAAKLGLSTYLVTQIILTSRGRGQP* |
| Ga0126378_113002851 | 3300010361 | Tropical Forest Soil | LLYNEQGRRPDEIAEKLGLSTYLVTQIILSSRNRGKL* |
| Ga0126381_1006383551 | 3300010376 | Tropical Forest Soil | RLALLYNEQGLRPSDIAHKLGISSHLATQIILAAKNRGKS* |
| Ga0126381_1035957612 | 3300010376 | Tropical Forest Soil | LLYNEQGRRPEEIAQKLGLSTYLVSQIILSSRNRGKL* |
| Ga0126381_1041830701 | 3300010376 | Tropical Forest Soil | ALLYNEQGLRPDEIAAKLGLSPYQVAQIILNSRSRGKL* |
| Ga0126381_1050700982 | 3300010376 | Tropical Forest Soil | LYNSQGLRPAEIAAKLGVSSHLVTQIILAAKNRGKA* |
| Ga0134126_122783061 | 3300010396 | Terrestrial Soil | LLYNEQGRRPDEIAQKLGLSTYLVTQIILTSRNRGKL* |
| Ga0134126_123271281 | 3300010396 | Terrestrial Soil | LLYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL* |
| Ga0137391_110206182 | 3300011270 | Vadose Zone Soil | NQQGLRPDEIAQKLGISRYMVTQIILDARNRRKA* |
| Ga0137393_108492092 | 3300011271 | Vadose Zone Soil | IYNAQGLRPAEIAQKLGVSAHLVTQIILAAKNRGKA* |
| Ga0137366_103737772 | 3300012354 | Vadose Zone Soil | LLYNEQGLRPAEIAQKLGVSSYLVTQIILAAKNRAKT* |
| Ga0137366_109197453 | 3300012354 | Vadose Zone Soil | YNEQGIRPQVIAERLGLSTYIVTQIILSSKNRGKL* |
| Ga0137371_103971202 | 3300012356 | Vadose Zone Soil | ALLYNEQGRRPDEIAQKLGLSTYLVTQIILSSRNRGKL* |
| Ga0137360_118057261 | 3300012361 | Vadose Zone Soil | YNEQGLRPAEIARKLGVSAYTVTQIILAARNRGKG* |
| Ga0137390_106707992 | 3300012363 | Vadose Zone Soil | YNEQRLRPEEIARKLGLSTYMVTQIILAARNQGKL* |
| Ga0126375_104617651 | 3300012948 | Tropical Forest Soil | ALLYNEQGLRPAEIAQKLGLSSYAVIQIILNGRNKGKL* |
| Ga0126369_112933101 | 3300012971 | Tropical Forest Soil | LLYNEQGLRPDEIAKKLGLSTYAVTQIILGSRNRGKL* |
| Ga0126369_114084162 | 3300012971 | Tropical Forest Soil | LLYNEQGLRPEEIAHKLRLSTYTVTQIILGSRNRGKL* |
| Ga0164307_112448821 | 3300012987 | Soil | LIYNEQGLRPAEIAEKLGVTPYVASQIVLAARNRAKR* |
| Ga0134081_100959372 | 3300014150 | Grasslands Soil | LYNEQGQRPDEIAQKLGLSTYLVTQIILSSRNRGKL* |
| Ga0181531_108348732 | 3300014169 | Bog | LALLYNEQGQRPDEIARKLGLSTYNVTQIILGSRNRGKL* |
| Ga0182035_113655562 | 3300016341 | Soil | YNEQGLRPDEIASKLGLSTYNVTQIILNARSRGKL |
| Ga0182035_113884131 | 3300016341 | Soil | LYNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL |
| Ga0187802_102978881 | 3300017822 | Freshwater Sediment | LYNEQGLRPEEIAGKLGLSTYTVTQIILGSRNRGKL |
| Ga0187814_100519772 | 3300017932 | Freshwater Sediment | LALLYNEQGLRPEEIAGKLGLSTYTVTQIILGSRNRGKL |
| Ga0187783_103755771 | 3300017970 | Tropical Peatland | KLALLYNEQGLRPAEIAAKLGISPHLATQIILAAKNRGKG |
| Ga0187781_110390371 | 3300017972 | Tropical Peatland | RSQEKLALLYNEQGRRPAEIAQKLGLSTYTVTQIILASRNRGKL |
| Ga0187777_102083811 | 3300017974 | Tropical Peatland | LLYNEQGLRPDEIAQKLGLSPYLVTQIILNTRSRGKL |
| Ga0187804_101784651 | 3300018006 | Freshwater Sediment | ERLALLYNEQGKRPEEIAQKLGLSTYTVTQIILGPRNRGKL |
| Ga0187805_105576752 | 3300018007 | Freshwater Sediment | YNEQGLRPSDIASKLGISSHLVTQIILAARNRGKS |
| Ga0187885_103773862 | 3300018025 | Peatland | LLYNQQRLRPEEIAQKLGLSTYMVTQIILAARNQGKL |
| Ga0187784_102069341 | 3300018062 | Tropical Peatland | LLYNSEGLRPAEIAAKLGVSSHLVTQIILAARNRGKS |
| Ga0210401_114377521 | 3300020583 | Soil | LLYNEQGLRPADIAAKLGVSSHLVTQIILAARNRGKS |
| Ga0210408_110084162 | 3300021178 | Soil | LLYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL |
| Ga0213881_101014242 | 3300021374 | Exposed Rock | LLYNEQGLRPDEIAEKIGLSRYLVTQIILNNRTRGKL |
| Ga0210385_100188261 | 3300021402 | Soil | ALLYNEQGKRPEEIAAKLGLSTYIVTQIILGSRNRGKL |
| Ga0210387_103723541 | 3300021405 | Soil | LLYNEQGRRPEEIASKLGLSTYTVTQIILGSRNRGKL |
| Ga0210391_110797362 | 3300021433 | Soil | LALLYNEQGLRPADIAAKLGVSSHLVTQIILAARNRGKS |
| Ga0187846_101479892 | 3300021476 | Biofilm | LYNEQGRRPEEIAAKLGLSTYTVTQIILTSRNQGKL |
| Ga0224572_10118863 | 3300024225 | Rhizosphere | ALLYNEQGLPPQEIADKLGLSTYTVTQIILTTRNRGKL |
| Ga0209171_104702562 | 3300025320 | Iron-Sulfur Acid Spring | ALLYNEQGKRPDEIAAKLGLSTYIVTQIILGSRNRGKL |
| Ga0207643_103548421 | 3300025908 | Miscanthus Rhizosphere | LLYNEQGRRPEEIADKLGLSTYLVSQIILTSRNRGKL |
| Ga0207663_115822852 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | YNEQGQRPEEIARKLGLSTYLVSQIILASRNRGKV |
| Ga0207687_114461142 | 3300025927 | Miscanthus Rhizosphere | RLALIYNEQGLRPAEIAEKLGVTPYVASQIVLAARNRAKR |
| Ga0207664_105904612 | 3300025929 | Agricultural Soil | EKLALLYNEQGRRPEEIAQKLGLSTYLVTQIILGSRNRGKL |
| Ga0207712_100990873 | 3300025961 | Switchgrass Rhizosphere | LTLLYNEQGRRPEEIADKLGLSTYLVTQIILTSRNRGKL |
| Ga0179587_104910093 | 3300026557 | Vadose Zone Soil | QERLARIYNEQGLRPAEIAQKLGVSPYMASQIILAARNRAKG |
| Ga0208099_10033372 | 3300027096 | Forest Soil | MLYNEQGLRPDEIAQKLGLSTYAVTQIILTSRNRGKL |
| Ga0209418_10095062 | 3300027371 | Forest Soil | LLYNEQGRRPDEIAQKLGLSTYLVTQIILNARTRGKL |
| Ga0209074_102850022 | 3300027787 | Agricultural Soil | TARQERLALIYNEQGLRPAEIAQKLGVSPYLASQIVLAARNRPKG |
| Ga0209275_102429481 | 3300027884 | Soil | ERLALLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL |
| Ga0209415_104673571 | 3300027905 | Peatlands Soil | LTLLYNEQGLRPKEIADKLGLTPYIVAQIILTSRNRGKL |
| Ga0209698_106952381 | 3300027911 | Watersheds | YNEQGLRPAEIAGKLGVSTYTATQIVLTARNHPQH |
| Ga0302232_101494761 | 3300028789 | Palsa | LALLYNEQGRRPEEIAQKLGLSTYTVTQIILTARNQGKL |
| Ga0307304_103368371 | 3300028885 | Soil | YNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL |
| Ga0311372_1003977810 | 3300030520 | Palsa | LLYNEQGQRPEEIARKLGLSTYNVTQIILGSRNRGKL |
| Ga0075394_114152021 | 3300030969 | Soil | LFFFIQGLRPGEIAHKLGVTSHLVTQIILAAKNRGKS |
| Ga0318516_100523834 | 3300031543 | Soil | LALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL |
| Ga0318516_108589691 | 3300031543 | Soil | YNEQGLRPDEIAKKLGLSVYNVTQIILNARSRGKL |
| Ga0318541_100294284 | 3300031545 | Soil | YNEQGLRPDEIADKLGVSVYTATQIILAARSHAKA |
| Ga0318541_104436581 | 3300031545 | Soil | LYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL |
| Ga0318541_105031622 | 3300031545 | Soil | LYNQQGLRPAEIAAKLGVNTYTATQIILAARDRRQP |
| Ga0318538_103760633 | 3300031546 | Soil | LALLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL |
| Ga0318573_102374531 | 3300031564 | Soil | ALLYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA |
| Ga0318515_101529031 | 3300031572 | Soil | RLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR |
| Ga0310915_110204272 | 3300031573 | Soil | QERLALIYNEQGLRPAEIAQKLGVSPYMASQIVLAARNRAKR |
| Ga0318542_101035681 | 3300031668 | Soil | ERLALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL |
| Ga0318574_106137861 | 3300031680 | Soil | YNEQGLRPDEIAEKLGLSVYNVTQIILNARSRGKL |
| Ga0318574_108512172 | 3300031680 | Soil | SQEKLALLYNEQGLRPEEIAQKLRLSTYTVTQIVLGSRNRGKL |
| Ga0318560_103492382 | 3300031682 | Soil | LYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL |
| Ga0310686_1024860672 | 3300031708 | Soil | LLYNEQGLRPAEIADKLGVSSYLVTQIILAAKNRGKL |
| Ga0318496_102303611 | 3300031713 | Soil | LYNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL |
| Ga0318496_103849192 | 3300031713 | Soil | LYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL |
| Ga0318496_107245562 | 3300031713 | Soil | PEPLLYNEQGLRPGEIAQKLGLSTYAVTQIILTSRNRGKL |
| Ga0318493_101339433 | 3300031723 | Soil | PRQERLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR |
| Ga0318493_101450863 | 3300031723 | Soil | ALLYNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL |
| Ga0318500_101141701 | 3300031724 | Soil | ERLALLYNEQGLRPDEIASKLRLSTYTVTQIILGSRNRGKL |
| Ga0318501_108722841 | 3300031736 | Soil | ALLYNEQGLRPEEIAQKLRLSTYTVTQIVLGSRNRGKL |
| Ga0318502_100625451 | 3300031747 | Soil | LYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA |
| Ga0318509_100499144 | 3300031768 | Soil | LYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL |
| Ga0318547_100850191 | 3300031781 | Soil | LALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL |
| Ga0318547_103571311 | 3300031781 | Soil | LLYNEQGLRPAEIAVKLGVSTYTATQIILAARNRAKA |
| Ga0318548_100146985 | 3300031793 | Soil | LYNQQGLRPAEIAAKLGVSTYTATQIILAAKNRREH |
| Ga0318576_102149192 | 3300031796 | Soil | YNEQGLRPDEIAQKLGLSTYAVTQIILDTRSRGKL |
| Ga0318523_104281042 | 3300031798 | Soil | LYNEQGLRPDEIADKLGVSSYLVTQIILAAKNRGKI |
| Ga0318565_101560241 | 3300031799 | Soil | YNEQGKRPDEIAQKLGLSTYLVTQIILNSRNRGKL |
| Ga0318497_108206352 | 3300031805 | Soil | YNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL |
| Ga0318568_101828182 | 3300031819 | Soil | QERLAILYNSQGLRPAEIAAKLGVSSHVVTQIILATKNRGKA |
| Ga0318568_106222982 | 3300031819 | Soil | YNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL |
| Ga0318567_101656941 | 3300031821 | Soil | LLYNEQGLRPAEIAEKLGVSSYLVTQIILAARNRGKL |
| Ga0318499_103680242 | 3300031832 | Soil | LLYNEQGLQPGEIAQKLGLSTYLVTQIILGSRNRGKL |
| Ga0318495_100344891 | 3300031860 | Soil | LLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL |
| Ga0318495_102843991 | 3300031860 | Soil | QERLALLYNEQGLRPEEIAQKLRLSTYTVTQIILGSRNRGKL |
| Ga0318544_102725192 | 3300031880 | Soil | LLYNEQGLRPEEIAAKLGLSSYAVTQIILGARNRGKL |
| Ga0318522_100383243 | 3300031894 | Soil | LYNEQGKRPDEIAQKLGLSTYLVTQIILNSRSRGKL |
| Ga0318551_100731583 | 3300031896 | Soil | ALLYNEQGLRPAEIAAKLGVSDYLATQIILAARNRPKA |
| Ga0318551_101411643 | 3300031896 | Soil | YNSQGLRPAEIAAKLGVSSHVVTQIILATKNRGKA |
| Ga0306923_105658163 | 3300031910 | Soil | ERLALIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR |
| Ga0306926_111095572 | 3300031954 | Soil | LLYNEQGLRPAEIAQKLGLSSYAVTQIILSARNQGKL |
| Ga0318562_100862053 | 3300032008 | Soil | LYNEQGLRPAEIAAKLGVSDYLATQIILAARNRPKA |
| Ga0318562_103319001 | 3300032008 | Soil | YNEQGLRPDEIADKLGVSSYLVTQIILAAKNRGKI |
| Ga0318563_101710121 | 3300032009 | Soil | ALLYNEQGLRPDEIAEKLGLSVYTVTQIILNARSRGKL |
| Ga0318563_104193052 | 3300032009 | Soil | LYNEQGLRPAEIADKLGVSSYLVTQIILAAKNRGKL |
| Ga0318559_104629712 | 3300032039 | Soil | LYNEQGLRPEEIAQKLGLSSYAVTQIILTARNRGKL |
| Ga0318549_103834901 | 3300032041 | Soil | LYNEQGLRPEEIAAKLGLSSYAVTQIILGARNRGKL |
| Ga0318556_105856222 | 3300032043 | Soil | LLYNEQGQRPEEIARKLGLSTYTVTQIILGSRNRGKL |
| Ga0318505_101915631 | 3300032060 | Soil | LIYNEQGLRPAEIAEKLGVSPYMASQIVLAARNRAKR |
| Ga0318504_100883111 | 3300032063 | Soil | RLALLYNEQGLRPAEIADKLGVSSYLATQIILAAKNRGKL |
| Ga0307471_1012165232 | 3300032180 | Hardwood Forest Soil | ALLYNEQGRRPEEIAQKLGLSPYLVTQIILSSRNRGKL |
| Ga0306920_1029745111 | 3300032261 | Soil | YNEQGLRPGEIAQKLGLSTYAVTQIILTSRNRGKL |
| Ga0335082_108157891 | 3300032782 | Soil | EKLALLYNEQGRRPAEIAQKLGLSTYLVTQIILNSRNRGKL |
| Ga0335077_112437051 | 3300033158 | Soil | ALLYNEQGRRPEEIAQKLGLSTYLVTQIILSSRNRGKL |
| Ga0334827_158532_3_122 | 3300034065 | Soil | LALLYNEQRMRPDEIARKLGLSAYTVSQIILSARNQGKL |
| ⦗Top⦘ |