| Basic Information | |
|---|---|
| Family ID | F059392 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 45 residues |
| Representative Sequence | YRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.52 % |
| % of genes near scaffold ends (potentially truncated) | 94.78 % |
| % of genes from short scaffolds (< 2000 bps) | 90.30 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.776 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.955 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.55% β-sheet: 16.44% Coil/Unstructured: 63.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF01594 | AI-2E_transport | 41.04 |
| PF13640 | 2OG-FeII_Oxy_3 | 17.16 |
| PF07793 | DUF1631 | 14.18 |
| PF01738 | DLH | 6.72 |
| PF04392 | ABC_sub_bind | 2.24 |
| PF03401 | TctC | 1.49 |
| PF00072 | Response_reg | 0.75 |
| PF02012 | BNR | 0.75 |
| PF07995 | GSDH | 0.75 |
| PF13247 | Fer4_11 | 0.75 |
| PF04338 | DUF481 | 0.75 |
| PF02148 | zf-UBP | 0.75 |
| PF05548 | Peptidase_M11 | 0.75 |
| PF06808 | DctM | 0.75 |
| PF00082 | Peptidase_S8 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 41.04 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.24 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.49 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.75 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.78 % |
| Unclassified | root | N/A | 5.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig79416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3253 | Open in IMG/M |
| 3300004048|Ga0055494_10000738 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300004092|Ga0062389_101395993 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300004092|Ga0062389_104313906 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300004635|Ga0062388_100816435 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300004778|Ga0062383_10065571 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300005293|Ga0065715_10307751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300005328|Ga0070676_10011964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4730 | Open in IMG/M |
| 3300005332|Ga0066388_105287801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300005332|Ga0066388_106405794 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005338|Ga0068868_100210665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1624 | Open in IMG/M |
| 3300005339|Ga0070660_100996209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300005354|Ga0070675_101762869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300005366|Ga0070659_101787047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300005434|Ga0070709_11300875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300005434|Ga0070709_11601616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300005459|Ga0068867_101192303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300005467|Ga0070706_101274438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300005518|Ga0070699_100443568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300005559|Ga0066700_10286738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1158 | Open in IMG/M |
| 3300005563|Ga0068855_100646605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1136 | Open in IMG/M |
| 3300005564|Ga0070664_100003055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13534 | Open in IMG/M |
| 3300005577|Ga0068857_100639864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1007 | Open in IMG/M |
| 3300005616|Ga0068852_100210542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1844 | Open in IMG/M |
| 3300005764|Ga0066903_105487981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300005994|Ga0066789_10115851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1147 | Open in IMG/M |
| 3300005994|Ga0066789_10409314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300005995|Ga0066790_10243363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300006163|Ga0070715_10566856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300006175|Ga0070712_100353853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1203 | Open in IMG/M |
| 3300006354|Ga0075021_11126535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300006796|Ga0066665_11584780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300006881|Ga0068865_100312566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1261 | Open in IMG/M |
| 3300006953|Ga0074063_12342970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300006954|Ga0079219_10145242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1256 | Open in IMG/M |
| 3300009012|Ga0066710_101763266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300009012|Ga0066710_102244241 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300009037|Ga0105093_10163532 | Not Available | 1124 | Open in IMG/M |
| 3300009094|Ga0111539_10290326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1903 | Open in IMG/M |
| 3300009137|Ga0066709_100068624 | All Organisms → cellular organisms → Bacteria | 4147 | Open in IMG/M |
| 3300009137|Ga0066709_102208932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300009166|Ga0105100_10156596 | Not Available | 1351 | Open in IMG/M |
| 3300009174|Ga0105241_11951988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300010339|Ga0074046_10533975 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010362|Ga0126377_11321110 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300010375|Ga0105239_10810686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300010397|Ga0134124_10911000 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300010398|Ga0126383_12538568 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010937|Ga0137776_1434555 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300011270|Ga0137391_11049214 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012198|Ga0137364_10675555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300012205|Ga0137362_10311121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1364 | Open in IMG/M |
| 3300012209|Ga0137379_10620339 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300012209|Ga0137379_11631705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300012351|Ga0137386_10771422 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012361|Ga0137360_10340734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1253 | Open in IMG/M |
| 3300012361|Ga0137360_11091611 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012363|Ga0137390_10562471 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300012930|Ga0137407_11799876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300012971|Ga0126369_13400452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300014322|Ga0075355_1228215 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300014969|Ga0157376_11251867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300015080|Ga0167639_1045008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300015264|Ga0137403_11349555 | Not Available | 560 | Open in IMG/M |
| 3300015373|Ga0132257_102991772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300015373|Ga0132257_103194334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300015374|Ga0132255_100716071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1487 | Open in IMG/M |
| 3300017792|Ga0163161_11171415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300017792|Ga0163161_11963343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300017930|Ga0187825_10169060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300017974|Ga0187777_10336878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1035 | Open in IMG/M |
| 3300018054|Ga0184621_10142648 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300018058|Ga0187766_10467348 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300018058|Ga0187766_10678055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. L21 | 710 | Open in IMG/M |
| 3300018083|Ga0184628_10556967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
| 3300018481|Ga0190271_10796516 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300020081|Ga0206354_10175562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300022694|Ga0222623_10241226 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300022889|Ga0247785_1040225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300025321|Ga0207656_10128490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1185 | Open in IMG/M |
| 3300025321|Ga0207656_10640590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300025878|Ga0209584_10398124 | Not Available | 531 | Open in IMG/M |
| 3300025898|Ga0207692_10278103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300025905|Ga0207685_10300459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300025906|Ga0207699_10083113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1991 | Open in IMG/M |
| 3300025910|Ga0207684_11017107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300025912|Ga0207707_10833624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300025917|Ga0207660_10206833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1535 | Open in IMG/M |
| 3300025924|Ga0207694_10147978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1891 | Open in IMG/M |
| 3300025926|Ga0207659_10452293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300025926|Ga0207659_11242747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300025937|Ga0207669_10407210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300025937|Ga0207669_11031485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300025938|Ga0207704_10009644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4669 | Open in IMG/M |
| 3300025938|Ga0207704_10012080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 4277 | Open in IMG/M |
| 3300025961|Ga0207712_10329683 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300025964|Ga0210127_1021470 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300025986|Ga0207658_10749602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 884 | Open in IMG/M |
| 3300026067|Ga0207678_11925618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300026089|Ga0207648_11687752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300026548|Ga0209161_10049588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2754 | Open in IMG/M |
| 3300027843|Ga0209798_10046057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2283 | Open in IMG/M |
| 3300027877|Ga0209293_10464899 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027894|Ga0209068_10751743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300027899|Ga0209668_10525026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300028380|Ga0268265_10039198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3490 | Open in IMG/M |
| 3300028380|Ga0268265_12008489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300028381|Ga0268264_11494438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300028739|Ga0302205_10070613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 896 | Open in IMG/M |
| 3300028870|Ga0302254_10262954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300029923|Ga0311347_10326257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300029984|Ga0311332_11214094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300029984|Ga0311332_11385875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300030002|Ga0311350_10741065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 881 | Open in IMG/M |
| 3300030003|Ga0302172_10175810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 670 | Open in IMG/M |
| 3300030014|Ga0302175_10027050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1211 | Open in IMG/M |
| 3300030943|Ga0311366_10241309 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300031521|Ga0311364_11861755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031781|Ga0318547_10610573 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031820|Ga0307473_10849418 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031879|Ga0306919_10375500 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300031902|Ga0302322_100178938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2300 | Open in IMG/M |
| 3300031902|Ga0302322_100746225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300031913|Ga0310891_10335039 | Not Available | 540 | Open in IMG/M |
| 3300032003|Ga0310897_10334535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300033408|Ga0316605_11664698 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300033418|Ga0316625_100863400 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300033483|Ga0316629_11165312 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300033521|Ga0316616_102539117 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300033557|Ga0316617_100492286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1111 | Open in IMG/M |
| 3300034148|Ga0364927_0175647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300034354|Ga0364943_0149282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 842 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.49% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.49% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.75% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.75% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.75% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030014 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01249490 | 2140918007 | Soil | YRFFDNRSDANHRYTVDLTVRRAMINRQWVPEGSGPNAVAFCSPV |
| Ga0055494_100007381 | 3300004048 | Natural And Restored Wetlands | GTLPVYRFFNNRRDANQRHTVDLSVKRAMINRVWVPDGKGANGAAFCSPY* |
| Ga0062389_1013959932 | 3300004092 | Bog Forest Soil | LPVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFVSWCTPI* |
| Ga0062389_1043139061 | 3300004092 | Bog Forest Soil | GMLPVYKFFDNRIDANQRHTIDLSVRRAMINRAWVPQGVLPNFVAWCTPI* |
| Ga0062388_1008164351 | 3300004635 | Bog Forest Soil | LPVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFISWCTPI* |
| Ga0062383_100655711 | 3300004778 | Wetland Sediment | FFNNRRDANHRYTVDLSVRRGMINRAWVPEGNGPNAAVFCSPV* |
| Ga0065715_103077511 | 3300005293 | Miscanthus Rhizosphere | PVYRFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI* |
| Ga0070676_100119646 | 3300005328 | Miscanthus Rhizosphere | FDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT* |
| Ga0066388_1052878011 | 3300005332 | Tropical Forest Soil | TFWVMPVFADGSCPAGTLPTFRFDNNRRDFNQRHTIDLSIRRAMLNRSWAPTGTGKNGVGFCTPI* |
| Ga0066388_1064057942 | 3300005332 | Tropical Forest Soil | VYRFFDNRQDANQRHTIDLSVRRAMLNRAWVPQGVTPDGVIFCTPI* |
| Ga0068868_1002106651 | 3300005338 | Miscanthus Rhizosphere | LPVYRFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT* |
| Ga0070660_1009962092 | 3300005339 | Corn Rhizosphere | FDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI* |
| Ga0070675_1017628692 | 3300005354 | Miscanthus Rhizosphere | FFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI* |
| Ga0070674_1000539254 | 3300005356 | Miscanthus Rhizosphere | YVQVPDGDGRCPDNTLPVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGARGVAFCSPV* |
| Ga0070659_1017870472 | 3300005366 | Corn Rhizosphere | YRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI* |
| Ga0070709_113008752 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FFNNRNDANMRHSRDLTVRREMLNKQWAPNGFGPNNVAFCTPA* |
| Ga0070709_116016162 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | PVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV* |
| Ga0068867_1011923032 | 3300005459 | Miscanthus Rhizosphere | GNCLDGRIPVYRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI* |
| Ga0070706_1012744382 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GACTGGLVPVFRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI* |
| Ga0070699_1004435681 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI* |
| Ga0070679_1015582172 | 3300005530 | Corn Rhizosphere | QVPDSKGKCPSNTLPVYRFFDNRRDANHRYSVDLSVRRAMNNRSWVPEGSGTGVAFCSPI |
| Ga0066700_102867381 | 3300005559 | Soil | NRSDANHRHTVDLTVRRAMINRKWVPEGSGANAVAFCSPV* |
| Ga0068855_1006466051 | 3300005563 | Corn Rhizosphere | HRYTVDLSIRRAMINRGWTQEGFGPNAVVFCSPV* |
| Ga0070664_10000305515 | 3300005564 | Corn Rhizosphere | AGTLPVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV* |
| Ga0068857_1006398642 | 3300005577 | Corn Rhizosphere | GQCMDGHVPVYRFFDNRRDANQRFTVDRSERRAMQNRAWVADADNGTGAVFCAPI* |
| Ga0068852_1002105421 | 3300005616 | Corn Rhizosphere | PVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI* |
| Ga0066903_1054879811 | 3300005764 | Tropical Forest Soil | GTLPTYRFDNNRRDFNQRHTIDLSIRRAMLNRSWAPTGAGKNGVGFCTPI* |
| Ga0066789_101158511 | 3300005994 | Soil | DANHRHTVDLSVRRQMINRDWVPEGSGPNAVAFCSPV* |
| Ga0066789_104093142 | 3300005994 | Soil | CPAQTAPVYRFFDNRNDANHRHTIDLSVRRAMINREWAAEGTGPNSVAFCTPI* |
| Ga0066790_102433631 | 3300005995 | Soil | RNDANHRYTVDLTVRRAMINRKWAPEGNGPNAVAFCSPV* |
| Ga0070715_105668561 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NHRYSVDLSVRRAMRNRSWVPEGSGSGVAFCSPI* |
| Ga0070712_1003538532 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FFDNRNDANHRHTIDLSVRRAMLNRSWAPEGVGPNAVAFCTPI* |
| Ga0075021_111265352 | 3300006354 | Watersheds | PVYRFFDNRNDANHRYTLDLSVRRAMLNRAWVPEGNGPSAVVMCSVF* |
| Ga0066665_115847802 | 3300006796 | Soil | ATGTVPIFRFSNNRKDFNQRHTLDLSVKRAMINRAWVPDGGGPNGTAFCSPI* |
| Ga0068865_1003125662 | 3300006881 | Miscanthus Rhizosphere | GEGACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI* |
| Ga0074063_123429702 | 3300006953 | Soil | PVYRFFDNRNDANHRYTVDLSVRRAMLNRSWVPEGNGPSAVVMCSVF* |
| Ga0079219_101452422 | 3300006954 | Agricultural Soil | MLPVYRFFNNRQDANQRHTIDLSVRRAMLNRAWVPQGVPPDQVIFCTPI* |
| Ga0066710_1017632661 | 3300009012 | Grasslands Soil | FDNRQDANQRHTIDLSVRRAMINRAWVPEGFGPSHVIFCTPI |
| Ga0066710_1022442412 | 3300009012 | Grasslands Soil | YRFFNNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI |
| Ga0105093_101635322 | 3300009037 | Freshwater Sediment | AGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCSPY* |
| Ga0111539_102903262 | 3300009094 | Populus Rhizosphere | VYRFFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI* |
| Ga0066709_1000686241 | 3300009137 | Grasslands Soil | DANQRHTIDLSVRRAMINRAWVPEGFGPSHVIFCTPI* |
| Ga0066709_1022089322 | 3300009137 | Grasslands Soil | FRFSNNRKDFNQRHTLDLSVKRAMINRAWVPDGGGPNGTAFCSPI* |
| Ga0105100_101565962 | 3300009166 | Freshwater Sediment | FFNNRRDANQRHTVDLSVKRAMVNRAWVPDGKGTNGAAFCSPY* |
| Ga0105241_119519882 | 3300009174 | Corn Rhizosphere | VYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI* |
| Ga0074046_105339752 | 3300010339 | Bog Forest Soil | PVYKFFDNRVDANQRHTIDLSVRRAMINRAWVPQGVLPNFVAWCTPI* |
| Ga0126377_113211102 | 3300010362 | Tropical Forest Soil | GTLPVYKFFDNRQDANQRHTIDLSVRRAMNNRAWVPQGIGPNHVAFCTPI* |
| Ga0105239_108106861 | 3300010375 | Corn Rhizosphere | NRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI* |
| Ga0134124_109110001 | 3300010397 | Terrestrial Soil | EGACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI* |
| Ga0126383_125385682 | 3300010398 | Tropical Forest Soil | DANQRHTIDLSVRRAMLNRAWVPQGVAPDGVIFCTPI* |
| Ga0137776_14345552 | 3300010937 | Sediment | NQRHTIDLSVRRAMINRAWVPQGFGPNFVAFCTPTPS* |
| Ga0137391_110492141 | 3300011270 | Vadose Zone Soil | NRQDANQRHTIDLSVRRAMLNRAWVPQGFGPNQVIFCTPI* |
| Ga0137364_106755552 | 3300012198 | Vadose Zone Soil | RQDANHRYTVNLSVRRAMINRKWVPEGTGPNAVSFCSPF* |
| Ga0137362_103111213 | 3300012205 | Vadose Zone Soil | DNRSDANHRYTVDLTVRRAMINRKWVPEGSGANAVAFCSPV* |
| Ga0137379_106203391 | 3300012209 | Vadose Zone Soil | LPAYRFFNNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNQVIFCTPI* |
| Ga0137379_116317052 | 3300012209 | Vadose Zone Soil | NHRYTIDLTARRAMLNRQWAPEGIGSNAVAFCSPI* |
| Ga0137386_107714221 | 3300012351 | Vadose Zone Soil | RQDASQRHSIDLSVRRAMINRAWVPQGFGPNQVIFCTPI* |
| Ga0137360_103407343 | 3300012361 | Vadose Zone Soil | GTLPVYRFFDNRSDANHRHTVDLTVRRAMINRKWVPEGSGPNAVAFCSPV* |
| Ga0137360_110916111 | 3300012361 | Vadose Zone Soil | QDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI* |
| Ga0137390_105624712 | 3300012363 | Vadose Zone Soil | PAYRFFNNRQDANQRHTIDLSVRRAMLNRAWVPQGFGPNQVIFCTPI* |
| Ga0137407_117998761 | 3300012930 | Vadose Zone Soil | LPIYRFFNNRNDANMRHTRDLTVRREMLNKKWAPNGFGPNGVAFCSPV* |
| Ga0126369_134004521 | 3300012971 | Tropical Forest Soil | RFSNNRKDFNQRHTLDLSVKRAMLNRAWVPDGGGPNGTAFCSPI* |
| Ga0075355_12282151 | 3300014322 | Natural And Restored Wetlands | RFFNNRRDANHRYTVDLSVRRAMQNRAWAAEGTGPNSVAFCSPI* |
| Ga0157376_112518672 | 3300014969 | Miscanthus Rhizosphere | FFDNRRDANHRYTVDLSVHRAMQNRSRVAEGTRGVAFCSPV* |
| Ga0167639_10450081 | 3300015080 | Glacier Forefield Soil | NDANHRYTIDLTVRRAMINRGWVPEGAGPNAVAFCTPM* |
| Ga0137403_113495551 | 3300015264 | Vadose Zone Soil | NTLPAYRFFDNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNHVIFCTPI* |
| Ga0132257_1029917722 | 3300015373 | Arabidopsis Rhizosphere | FRFSNQRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI* |
| Ga0132257_1031943341 | 3300015373 | Arabidopsis Rhizosphere | LVPVFRFSNNRQDFNQRMTFDLSIKRAMINRGWVPDGGGPNGTAFCSPI* |
| Ga0132255_1007160711 | 3300015374 | Arabidopsis Rhizosphere | YRFFNNRNDANMRHTRDLTVRREMLNKQWAPYGAGPNGVAFCSPV* |
| Ga0163161_111714152 | 3300017792 | Switchgrass Rhizosphere | RFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT |
| Ga0163161_119633432 | 3300017792 | Switchgrass Rhizosphere | DAAGHCESGTLPIYRFFNNRRDASHRYAVDLSVRRAMINRAWTAEGKGLDSVAFCSPI |
| Ga0187825_101690601 | 3300017930 | Freshwater Sediment | CRAGTLPVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGIGPNAVAFCTPI |
| Ga0187777_103368782 | 3300017974 | Tropical Peatland | FNNRNDANHRHTIDLTARRAMLNRQWASEGFGTNGVALCSPI |
| Ga0184621_101426482 | 3300018054 | Groundwater Sediment | NNRQDANQRHTVNLSVRQAMINRAWVPLGFGPNHVIFCTPI |
| Ga0187766_104673482 | 3300018058 | Tropical Peatland | MLPVYRFFDNRQDANQRHTIDLSVRRAMINRAWVPQGFGPNSVIFCTPAPA |
| Ga0187766_106780552 | 3300018058 | Tropical Peatland | FNNRNDANQRHTIDLTARRAMLNRGWTPNGSGPNGVAFCSPV |
| Ga0184628_105569673 | 3300018083 | Groundwater Sediment | FNNRQAANHRHTPDLSVVRAMINRGWVPEGPGGVAFCSPI |
| Ga0190271_107965161 | 3300018481 | Soil | PESTLPVYRFFDNRRDANHRYTADLSVHRAMQNRQWVSEGAGGVAFCSAI |
| Ga0206354_101755622 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | ANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI |
| Ga0222623_102412262 | 3300022694 | Groundwater Sediment | YRFFNNRQDANQRHTVNLSVRQAMINRAWVPLGFGPNHVIFCTPI |
| Ga0247785_10402251 | 3300022889 | Soil | FDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI |
| Ga0207656_101284902 | 3300025321 | Corn Rhizosphere | NCRAGLLPVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGLGPNAVAFCTPI |
| Ga0207656_106405902 | 3300025321 | Corn Rhizosphere | FDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV |
| Ga0209584_103981241 | 3300025878 | Arctic Peat Soil | IPVYRFDNNRQDFNQRHTINLSVKRSMLNRGWAPDGAGPRGVAFCSPI |
| Ga0207692_102781032 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV |
| Ga0207685_103004592 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VYRFFDNRNDANHRYTINLSVRRAMLNRGWAPEGLGPNAVAFCTPI |
| Ga0207699_100831132 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NDANHRHTIDLSVRRAMLNRSWAPEGVGPNAVAFCTPI |
| Ga0207684_110171071 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GACTGGLVPVFRFSNNRQDFNQRMTFDLSVKRAMINRAWVPDGGGPNGTAFCSPI |
| Ga0207707_108336242 | 3300025912 | Corn Rhizosphere | PVYRFFDNRNDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI |
| Ga0207660_102068331 | 3300025917 | Corn Rhizosphere | NDANHRHTIDLSVRRAMLNRGWAPEGVGPNAVAFCTPI |
| Ga0207694_101479781 | 3300025924 | Corn Rhizosphere | TLPVYRFFDNRRDANHRYTVDLSLRRAMINRQWIPEGPGGVVFCSPV |
| Ga0207659_104522932 | 3300025926 | Miscanthus Rhizosphere | FFDNRRDANHRYTVDLSVRRAMQNRQWVSEGAGGVAFCSAI |
| Ga0207659_112427472 | 3300025926 | Miscanthus Rhizosphere | NRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT |
| Ga0207669_104072101 | 3300025937 | Miscanthus Rhizosphere | DGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI |
| Ga0207669_110314852 | 3300025937 | Miscanthus Rhizosphere | ANHRYTVDRSVRRAMLNRGWVPEGNGKEAVAFCSVF |
| Ga0207704_100096446 | 3300025938 | Miscanthus Rhizosphere | ACRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGVNGVAFCSPI |
| Ga0207704_100120805 | 3300025938 | Miscanthus Rhizosphere | DNRNDANHRYTINLSVRRAMLNRGWAPEGLGPNAVAFCTPI |
| Ga0207712_103296834 | 3300025961 | Switchgrass Rhizosphere | GTIPIYRFFDNRQDANHRHTPDLSVKRAMINRGWIPEGVNGVAFCSPI |
| Ga0210127_10214701 | 3300025964 | Natural And Restored Wetlands | RFFNNRRDANQRHTVDLSVKRAMINRAWVPDGRGANGAAFCSPY |
| Ga0207658_107496022 | 3300025986 | Switchgrass Rhizosphere | DNTLPVYRFFDNRRDANHRYTVDLSVHRAMQNRSWVAEGTRGVAFCSAI |
| Ga0207678_119256181 | 3300026067 | Corn Rhizosphere | GRRDANHRYTVDLSIRRAMINRGWTQEGFGPNAVVFCSPV |
| Ga0207648_116877522 | 3300026089 | Miscanthus Rhizosphere | FFNNRNDANHRYTVDRSVRRAMLNRGWVPEGNGKEAVAFCSVF |
| Ga0209161_100495883 | 3300026548 | Soil | NTLPVYRFFDNRQDANQRHTIDLSVRRAMINRAWVPEGFGPNHVIFCTPI |
| Ga0209798_100460573 | 3300027843 | Wetland Sediment | YRFFNNRRDANHRYTVDLSVRRGMINRAWVPEGNGPNAAVFCSPV |
| Ga0209293_104648991 | 3300027877 | Wetland | GTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY |
| Ga0209068_107517431 | 3300027894 | Watersheds | TLPVYRFFDNRNDANHRYTLDLSVRRAMLNRAWVPEGNGPSAVVMCSVF |
| Ga0209668_105250261 | 3300027899 | Freshwater Lake Sediment | VYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCAPY |
| Ga0268265_100391981 | 3300028380 | Switchgrass Rhizosphere | VYRFFDNRRDANHRYTVDLSVRRAMLNRAWAPEGAGPNSVAFCSPTT |
| Ga0268265_120084893 | 3300028380 | Switchgrass Rhizosphere | CRDGTIPVYRFFDNRQDANHRHTPDLSVKRAMINRGWVPEGINGVAFCSPI |
| Ga0268264_114944381 | 3300028381 | Switchgrass Rhizosphere | RFFDNRRDANHRYSVDLSVRRAMNNRAWVPEGSGSGVAFCSPI |
| Ga0302205_100706132 | 3300028739 | Fen | NRNDANHRYTVDLSVRRAMLNRSWVPEGNGPNAVAFCSVF |
| Ga0302254_102629542 | 3300028870 | Fen | NDANHRYTVDLSVRRAMLNRSWVPEGSGPNAVAFCSAF |
| Ga0311347_103262571 | 3300029923 | Fen | NHRYTVDLSVRRAMLNRAWAPEGEGPNSIAFCSPI |
| Ga0311332_112140942 | 3300029984 | Fen | SNNRNDFNQRMTLDLSVKRAMLNRAWVPDGGGPNGSAFCSPI |
| Ga0311332_113858752 | 3300029984 | Fen | RNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCTVY |
| Ga0311350_107410652 | 3300030002 | Fen | NDANMRHTRDLTVRREMLNKQWAPNGFGPNGVAFCSPA |
| Ga0302172_101758102 | 3300030003 | Fen | NNRNDANHRYTIDLSVRRAMLNRSWVPEGNGPNAVAFCSVF |
| Ga0302175_100270501 | 3300030014 | Fen | FNNRNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCSVY |
| Ga0311366_102413092 | 3300030943 | Fen | LPVYRFFNYRNDANHRYTVDRSVRRAMLNRSWVPEGNGPNAVAFCSVY |
| Ga0311364_118617552 | 3300031521 | Fen | RFFNNRNDANHRYTVDLSVRRAMLNRSWVPEGNGPNSVAFCSAY |
| Ga0318547_106105732 | 3300031781 | Soil | VYKFFDNREDANQRHTIDLSVRRAMLNRAWVPQGFGPNHVAFCTPISS |
| Ga0307473_108494182 | 3300031820 | Hardwood Forest Soil | DNRIDANQRYTIDLSVRRAMINRAWVPQGFGPNHVAFCTPI |
| Ga0306919_103755002 | 3300031879 | Soil | TLPVYKFFDNREDANQRHTIDLSVRRAMLNRAWVPQGFGPNHVAFCTPISS |
| Ga0302322_1001789382 | 3300031902 | Fen | FFNNRNDANMRHTIDLTVRREMANKQWARNGTGPEGVAFCSPFAF |
| Ga0302322_1007462252 | 3300031902 | Fen | VYRFFNNRRDANHRYTVDLSVRRAMLNRAWAPEGEGPNSIAFCSPI |
| Ga0310891_103350392 | 3300031913 | Soil | NDGNCLDGRIPVYRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI |
| Ga0310897_103345351 | 3300032003 | Soil | YRFFNNRNDANHRLTIDLSERRAMINRAWVPEGTGPRAAVFCSPI |
| Ga0316605_116646981 | 3300033408 | Soil | CRAGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGANGAAFCAPY |
| Ga0316625_1008634001 | 3300033418 | Soil | PVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY |
| Ga0316629_111653122 | 3300033483 | Soil | NRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY |
| Ga0316616_1025391171 | 3300033521 | Soil | RAGTLPVYRFFNNRRDANQRHTVDLSVKRAMINRAWVPDGKGSNGAAFCAPY |
| Ga0316617_1004922862 | 3300033557 | Soil | DANHRYTLDLSVKRAMVNRGWVPEGAGPNNVAFCSPI |
| Ga0364927_0175647_3_170 | 3300034148 | Sediment | FTGTCREGTIPVHRFFNNRQDANHRHTPDLSVGRAMVNRGWVPEGNGGVAFCSPT |
| Ga0364943_0149282_712_840 | 3300034354 | Sediment | FNNRNDANHRYTVDLSVRRAMLNRSWVPEGNGKEAVAFCSVF |
| ⦗Top⦘ |