| Basic Information | |
|---|---|
| Family ID | F059376 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIA |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.25 % |
| % of genes from short scaffolds (< 2000 bps) | 89.55 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.254 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.403 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.851 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.463 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 6.15% β-sheet: 0.00% Coil/Unstructured: 93.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF14332 | DUF4388 | 77.61 |
| PF01584 | CheW | 7.46 |
| PF01339 | CheB_methylest | 2.24 |
| PF01425 | Amidase | 1.49 |
| PF00072 | Response_reg | 0.75 |
| PF03648 | Glyco_hydro_67N | 0.75 |
| PF02518 | HATPase_c | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 4.48 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG3661 | Alpha-glucuronidase | Carbohydrate transport and metabolism [G] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.25 % |
| Unclassified | root | N/A | 0.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16546398 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 2228664022|INPgaii200_c0611681 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 528 | Open in IMG/M |
| 3300001159|JGI12650J13346_1005373 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 605 | Open in IMG/M |
| 3300001593|JGI12635J15846_10050886 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
| 3300002909|JGI25388J43891_1076632 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300002917|JGI25616J43925_10346008 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300004479|Ga0062595_100866418 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300004635|Ga0062388_102206787 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 573 | Open in IMG/M |
| 3300005181|Ga0066678_10207073 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005332|Ga0066388_102172993 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005332|Ga0066388_108111879 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005366|Ga0070659_100396005 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300005468|Ga0070707_101273389 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005526|Ga0073909_10378898 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005540|Ga0066697_10001060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10972 | Open in IMG/M |
| 3300005541|Ga0070733_10264443 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300005542|Ga0070732_10244360 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300005542|Ga0070732_11025900 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005555|Ga0066692_10937808 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005586|Ga0066691_10112861 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300005587|Ga0066654_10926263 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005591|Ga0070761_10036791 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300005610|Ga0070763_10472942 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005921|Ga0070766_11044487 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 563 | Open in IMG/M |
| 3300006028|Ga0070717_11438260 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006041|Ga0075023_100217546 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300006052|Ga0075029_100374628 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300006102|Ga0075015_100648834 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006163|Ga0070715_11000842 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006175|Ga0070712_101930798 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006237|Ga0097621_101659592 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006806|Ga0079220_10192786 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300006871|Ga0075434_100077168 | All Organisms → cellular organisms → Bacteria | 3326 | Open in IMG/M |
| 3300006893|Ga0073928_10778295 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006914|Ga0075436_101116180 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300007265|Ga0099794_10154185 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300007819|Ga0104322_122868 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300009088|Ga0099830_11089366 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009090|Ga0099827_10765019 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300009700|Ga0116217_10248009 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300010043|Ga0126380_10288236 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300010046|Ga0126384_10548386 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300010046|Ga0126384_12279369 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010048|Ga0126373_12892395 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
| 3300010048|Ga0126373_13263047 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300010339|Ga0074046_10317545 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010358|Ga0126370_11438878 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010360|Ga0126372_10525570 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300010360|Ga0126372_10899560 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300010366|Ga0126379_13064569 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 559 | Open in IMG/M |
| 3300010371|Ga0134125_11383363 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010398|Ga0126383_11564269 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300011120|Ga0150983_11288463 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300011271|Ga0137393_10071132 | All Organisms → cellular organisms → Bacteria | 2776 | Open in IMG/M |
| 3300012096|Ga0137389_10425754 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300012189|Ga0137388_11964568 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012198|Ga0137364_11092523 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012201|Ga0137365_10635530 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012203|Ga0137399_11006569 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300012209|Ga0137379_11148052 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012362|Ga0137361_11453199 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012923|Ga0137359_11278726 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012925|Ga0137419_11222813 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012944|Ga0137410_11053229 | Not Available | 694 | Open in IMG/M |
| 3300014501|Ga0182024_10131380 | All Organisms → cellular organisms → Bacteria | 3559 | Open in IMG/M |
| 3300015053|Ga0137405_1153853 | All Organisms → cellular organisms → Bacteria | 4920 | Open in IMG/M |
| 3300015053|Ga0137405_1257336 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300015241|Ga0137418_11314184 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300015245|Ga0137409_11015202 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300017944|Ga0187786_10100947 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300017944|Ga0187786_10315696 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300017955|Ga0187817_10055992 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300017955|Ga0187817_10235216 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300018085|Ga0187772_10492086 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300020580|Ga0210403_10072431 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
| 3300020583|Ga0210401_10720472 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300021088|Ga0210404_10070599 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300021088|Ga0210404_10538700 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021168|Ga0210406_10805652 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300021178|Ga0210408_10128218 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300021401|Ga0210393_10826898 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300021407|Ga0210383_10589687 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300021420|Ga0210394_11071145 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300021433|Ga0210391_10537321 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300021475|Ga0210392_10986180 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021479|Ga0210410_10317648 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300021559|Ga0210409_10708893 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300021560|Ga0126371_10288387 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300022726|Ga0242654_10373274 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300025916|Ga0207663_10488909 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300025928|Ga0207700_10736911 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300025928|Ga0207700_10825503 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300026277|Ga0209350_1165876 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026319|Ga0209647_1187528 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300026529|Ga0209806_1057526 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300026542|Ga0209805_1067193 | All Organisms → cellular organisms → Bacteria | 1752 | Open in IMG/M |
| 3300026555|Ga0179593_1135840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 2299 | Open in IMG/M |
| 3300026557|Ga0179587_10530736 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300027516|Ga0207761_1070856 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027537|Ga0209419_1055349 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300027605|Ga0209329_1064189 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027645|Ga0209117_1004136 | All Organisms → cellular organisms → Bacteria | 5023 | Open in IMG/M |
| 3300027655|Ga0209388_1022573 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300027660|Ga0209736_1202157 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 515 | Open in IMG/M |
| 3300027671|Ga0209588_1262567 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027680|Ga0207826_1192994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300027745|Ga0209908_10173858 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300027825|Ga0209039_10179176 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300027842|Ga0209580_10116671 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300027842|Ga0209580_10354578 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300027846|Ga0209180_10152403 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300027853|Ga0209274_10136591 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300027875|Ga0209283_10206197 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300027889|Ga0209380_10746035 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027903|Ga0209488_10552995 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300028536|Ga0137415_10656748 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300030042|Ga0302300_1046936 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300030659|Ga0316363_10118689 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300030848|Ga0075388_11363888 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300031231|Ga0170824_101004813 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300031573|Ga0310915_10168561 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300031573|Ga0310915_10489051 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300031708|Ga0310686_102701661 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300031720|Ga0307469_12478637 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031754|Ga0307475_10097708 | All Organisms → cellular organisms → Bacteria | 2287 | Open in IMG/M |
| 3300031763|Ga0318537_10093281 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300031771|Ga0318546_11209542 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 531 | Open in IMG/M |
| 3300031780|Ga0318508_1072684 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300031823|Ga0307478_11148227 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300031962|Ga0307479_11219475 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031962|Ga0307479_12151698 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032001|Ga0306922_10216239 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300032180|Ga0307471_100729844 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300032261|Ga0306920_100490334 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01036250 | 2088090014 | Soil | MSETISFPPIVEAGASTKRTPTVYFIDDSATMREVIKIAFR |
| INPgaii200_06116812 | 2228664022 | Soil | VSETVAMPPLSEAEAKHTPNVYFIDDSATMREVIKIAFRR |
| JGI12650J13346_10053731 | 3300001159 | Forest Soil | MSDAIVLPQSGEAEPRRTPTVYFIDDSATMREVIKI |
| JGI12635J15846_100508861 | 3300001593 | Forest Soil | MSEALIMPLAGEVAVKRAPTVYFIDDSATMREVIKI |
| JGI25388J43891_10766321 | 3300002909 | Grasslands Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAFRR |
| JGI25616J43925_103460082 | 3300002917 | Grasslands Soil | MSEAMTLPPLGEAPAKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0062595_1008664182 | 3300004479 | Soil | MSETISFPPLAETGALAKRAPTVYFIDDSATMREVIKIAFR |
| Ga0062388_1022067872 | 3300004635 | Bog Forest Soil | MSDAITVPPLGDVAETRRTPTVYFIDDSATMREVIKIAFR |
| Ga0066678_102070731 | 3300005181 | Soil | MNETMPFPPAPAETAASEKRPPTVYFIDDSATMREVIKIAFRRE |
| Ga0066388_1021729931 | 3300005332 | Tropical Forest Soil | MSETMMVPPLNEAPERHVPTVYFIDDSATMREVIKIAFRR |
| Ga0066388_1081118792 | 3300005332 | Tropical Forest Soil | MTETLSFPPAAAENATSTKRAPTVYFIDDSATMREVIKIAFR |
| Ga0070659_1003960051 | 3300005366 | Corn Rhizosphere | MSEAMILPPFTDGQTKRAPTVYFIDDSATMREVIKIAFRR |
| Ga0070707_1012733891 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNETMPFPPAPAETAASEKRTPTVYFIDDSATMREVIKIA |
| Ga0073909_103788981 | 3300005526 | Surface Soil | MSETISFPPIAETNALAKRTPTVYFIDDSATMREVIK |
| Ga0066697_1000106012 | 3300005540 | Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIA |
| Ga0070733_102644431 | 3300005541 | Surface Soil | MSETMTIPPTGETEAKKTPTVYFIDDSATMREVIKI |
| Ga0070732_102443601 | 3300005542 | Surface Soil | MSEAMPLPPLAGAPEKRTPTVYFIDDSATMREVIKIA |
| Ga0070732_110259001 | 3300005542 | Surface Soil | MSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIKIA |
| Ga0066692_109378081 | 3300005555 | Soil | MSETMTIPPLADASAKRTPTVYFIDDSATMREVIK |
| Ga0066691_101128611 | 3300005586 | Soil | MSEAMTIPPLGEASAKRTPTVYFIDDSATMREVIKIAF |
| Ga0066654_109262631 | 3300005587 | Soil | MSEAMMLPPLDEAAERRVPTVYFIDDSATMREVIKIA |
| Ga0070761_100367915 | 3300005591 | Soil | MSEIMAVPPLNDAPAKRTPTVYFIDDSATMREVIKI |
| Ga0070763_104729422 | 3300005610 | Soil | MSELMAVPPLTESSAKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0070766_110444871 | 3300005921 | Soil | MSEVITMPPLGEAEVKKTPTVYFIDDSATMREVIKIAFR |
| Ga0070717_114382602 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0075023_1002175462 | 3300006041 | Watersheds | MSEAMIIPPLDEAPAKRIPTVYFIDDSATMREVIKIAF |
| Ga0075029_1003746282 | 3300006052 | Watersheds | MSEAMIIPPLDEAPAKRVPTVYFIDDSATMREVIKIA |
| Ga0075015_1006488342 | 3300006102 | Watersheds | MSEAMTLPPLADAPAKRTPTVYFIDDSATMREVVKIAFRR |
| Ga0070715_110008422 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEIMPFPPVTAETAAPEKRTPTVYFIDDSATMREVIKI |
| Ga0070712_1019307981 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEALIMPPAGETAVKRAPTVYFIDDSATMREVIKIAF |
| Ga0097621_1016595922 | 3300006237 | Miscanthus Rhizosphere | MSETMLVPPFTDGQTKRTPTVYFIDDSATMREVIKIA |
| Ga0079220_101927861 | 3300006806 | Agricultural Soil | MSEAMIVPPLQEAEAKRIPTVYFIDDSATMREVIKIAFR |
| Ga0075434_1000771681 | 3300006871 | Populus Rhizosphere | MSETISFPPIAGTGASAKRTPTVYFIDDSATMREVIKI |
| Ga0073928_107782952 | 3300006893 | Iron-Sulfur Acid Spring | MSEAMTVPPLNETEAKRTPTVYFIDDSATMREVIK |
| Ga0075436_1011161802 | 3300006914 | Populus Rhizosphere | MSETMPILPLTDAPARQTPTVYFIDDSATMREVIKI |
| Ga0099794_101541851 | 3300007265 | Vadose Zone Soil | MSETMTIPPPGEALAKKTPTVYFIDDSATMREVIKI |
| Ga0104322_1228683 | 3300007819 | Permafrost Soil | MSEALIMPPAGEVAVKRAPTVYFIDDSATMREVIK |
| Ga0099830_110893661 | 3300009088 | Vadose Zone Soil | MSEAMTIPPLGEVPAKRTPTVYFIDDSATMREVIKIA |
| Ga0099827_107650192 | 3300009090 | Vadose Zone Soil | MSEALTLPPLAGAPEKRTPTVYFIDDSATMREVIKI |
| Ga0116217_102480093 | 3300009700 | Peatlands Soil | MSDVIAIPPINETEVKHTPTVYFIDDSATMREVIK |
| Ga0126380_102882361 | 3300010043 | Tropical Forest Soil | MSEAMIIPPLSESQTKRAPTVYFIDDSATMREVIKIA |
| Ga0126384_105483862 | 3300010046 | Tropical Forest Soil | MSEAISFPSAANAPARRTPTVYFIDDSATMREVIKIAF |
| Ga0126384_122793692 | 3300010046 | Tropical Forest Soil | MSETMPLPPQVESPETPVKAAPVVYFIDDSATMREVIKIAFR |
| Ga0126373_128923952 | 3300010048 | Tropical Forest Soil | MSETIAMPPLGSTETKQAPTVYFIDDSATMREVIKI |
| Ga0126373_132630471 | 3300010048 | Tropical Forest Soil | MSETGSFPPIAGTTASTKRVPTVYFIDDSATMREVIKIAF |
| Ga0074046_103175451 | 3300010339 | Bog Forest Soil | MSDVIAIPPINETEVKHTPTVYFIDDSATMREVIKIAF |
| Ga0126370_114388782 | 3300010358 | Tropical Forest Soil | MSEAMIIPPLDEAPAKRLPTVYFIDDSATMREVIK |
| Ga0126372_105255703 | 3300010360 | Tropical Forest Soil | MSESIAMPPPGTPETKHTPTVYFIDDSATMREVIKI |
| Ga0126372_108995601 | 3300010360 | Tropical Forest Soil | MSETMTVPPLTDRPAKRTSTVYFIDDSATMREVIKIAF |
| Ga0126379_130645692 | 3300010366 | Tropical Forest Soil | MSDAIVLTQPREAEAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0134125_113833631 | 3300010371 | Terrestrial Soil | MSETMALPPFTDASAKKTPTVYFIDDSATMREVIK |
| Ga0126383_115642692 | 3300010398 | Tropical Forest Soil | MSEAMTIPPLEKAPAKRAPTVYFIDDSATMREVIKIAFR |
| Ga0150983_112884631 | 3300011120 | Forest Soil | MSEAMTVPPLKETEAKRTPTVYFIDDSATMREVIKIAF |
| Ga0137393_100711325 | 3300011271 | Vadose Zone Soil | MSEAMTIPPLGETPVKRTPTVYFIDDSATMREVIKIAF |
| Ga0137389_104257541 | 3300012096 | Vadose Zone Soil | MSEAMTMPPLSDAHAKRTPTVYFIDDSATMREVVK |
| Ga0137388_119645681 | 3300012189 | Vadose Zone Soil | MSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIA |
| Ga0137364_110925232 | 3300012198 | Vadose Zone Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0137365_106355301 | 3300012201 | Vadose Zone Soil | MNETMPFPPAPAETAAPEKRAPTVYFIDDSATMREVIKIAFR |
| Ga0137399_110065691 | 3300012203 | Vadose Zone Soil | MSETMTIPPPGGEALAKKTPTVYFIDDSATMREVIKI |
| Ga0137379_111480521 | 3300012209 | Vadose Zone Soil | MSEAMMLPPLDEAPEKRVPTVYFIDDSATMREVIKI |
| Ga0137361_114531992 | 3300012362 | Vadose Zone Soil | MNETMPFQPAPAETAASEKRPPTVYFIDDSATMREVIKIAF |
| Ga0137359_112787261 | 3300012923 | Vadose Zone Soil | MSEAMIIPPLGEATAKRTPTVYFIDDSATMREVIKIAF |
| Ga0137419_112228131 | 3300012925 | Vadose Zone Soil | MSEAMTIPPLGETPVKRTPTVYFIDDSVTMREVIKIA |
| Ga0137410_110532291 | 3300012944 | Vadose Zone Soil | MSETMPFPPAPVETAASAKRAPTVYFIDDSATMRE |
| Ga0182024_101313806 | 3300014501 | Permafrost | MSEIMAVPPLTEAPAKRPPTIYFIDDSATMREVIKI |
| Ga0137405_11538531 | 3300015053 | Vadose Zone Soil | MSETMTIPPPGEALDKKTPTVYFIDDSATMREVIKIAFDARS |
| Ga0137405_12573361 | 3300015053 | Vadose Zone Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVTRSH |
| Ga0137418_113141842 | 3300015241 | Vadose Zone Soil | MSEIMPFAPPPVESAAPEKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0137409_110152021 | 3300015245 | Vadose Zone Soil | MSETMPFPPAPVETAASAKRAPTVYFIDDSATMREVIKIAFR |
| Ga0187786_101009472 | 3300017944 | Tropical Peatland | MSDTVAMPPVGATETKTAPTVYFIDDSATMREVIKIAFRRE |
| Ga0187786_103156962 | 3300017944 | Tropical Peatland | MSDTMPLPPIAETPVKQAPTIYFIDDSATMREVIKI |
| Ga0187817_100559925 | 3300017955 | Freshwater Sediment | MSDTIAMPPIGETEAKHTPTVYFIDDSATMREVIK |
| Ga0187817_102352163 | 3300017955 | Freshwater Sediment | MSETIAMPPLGSTETKQAPTVYFIDDSATMREVIKIA |
| Ga0187772_104920862 | 3300018085 | Tropical Peatland | MSDVIAIPPIGETEVKHNPTVYFIDDSATMREVIK |
| Ga0210403_100724315 | 3300020580 | Soil | MSDAIVLPETGATEARRTPTVYFIDDSATMREVIKIAFRR |
| Ga0210401_107204722 | 3300020583 | Soil | MSDAIVLPETGAAEPRRTPTVYFIDDSATMREVIKIA |
| Ga0210404_100705991 | 3300021088 | Soil | MSETLIMPPAGETAVKRAPTVYFIDDSATMREVIKIAF |
| Ga0210404_105387002 | 3300021088 | Soil | MSEAMIVAPLNETETKRKPTVYFIDDSATMREVIKIAFRRE |
| Ga0210406_108056521 | 3300021168 | Soil | MSEAMTIPPLGETAQKRTPTVYFIDDSATMREVIKIAF |
| Ga0210408_101282185 | 3300021178 | Soil | MSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIK |
| Ga0210393_108268982 | 3300021401 | Soil | MSEAMTLPPLADAPAKRTPTVYFIDDSATMRDVIEIAF |
| Ga0210383_105896871 | 3300021407 | Soil | MSEVITMPPLGEAEVKKTPTVYFIDDSATMREVIKIA |
| Ga0210394_110711452 | 3300021420 | Soil | MSDAIVLPETGQAEARRTPTVYFIDDSATMREVIKIAFR |
| Ga0210391_105373212 | 3300021433 | Soil | MSEIMAVPPLNDAPAKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0210392_109861801 | 3300021475 | Soil | MSESMLLPTPSEPEQKRLPTVYFIDDSATMREVIKIA |
| Ga0210410_103176481 | 3300021479 | Soil | MSETIAMPPLTETETKRTPTVYFIDDSATMREVIK |
| Ga0210409_107088931 | 3300021559 | Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIK |
| Ga0126371_102883871 | 3300021560 | Tropical Forest Soil | MSEAMMLPPLDEAPEKRVPTVYFIDDSATMREVIKIA |
| Ga0242654_103732741 | 3300022726 | Soil | MSEAMTIPPLGEAPAKRIPTVYFIYDSATMREVIKIAFRR |
| Ga0207663_104889092 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETISFPPIAETNASAKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0207700_107369112 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSETMPFPPSPTETAAPEKRTPTVYFIDDSATMREVIKIAFR |
| Ga0207700_108255033 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEAMTLPPLADASAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0209350_11658761 | 3300026277 | Grasslands Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKI |
| Ga0209647_11875281 | 3300026319 | Grasslands Soil | MSETMPIPPLTDAPARQTPTVYFIDDSATMREVIKIAF |
| Ga0209806_10575264 | 3300026529 | Soil | MNETMPFPPAPAETAAPEKRAPTVYFIDDSATMRE |
| Ga0209805_10671931 | 3300026542 | Soil | MSEAMTIPPLGEASAKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0179593_11358405 | 3300026555 | Vadose Zone Soil | MSEAMTIPPLGEAPAKRIPTVYFIDDSATMREVIKIAFAGRIST |
| Ga0179587_105307362 | 3300026557 | Vadose Zone Soil | MSETLPFPPAPVETAASAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0207761_10708561 | 3300027516 | Tropical Forest Soil | MSETVSMPPLGNPEMKAAPTVYFIDDSATMREVIK |
| Ga0209419_10553491 | 3300027537 | Forest Soil | MSEALIMPPAGEVAVKRAPTVYFIDDSATMREVIKIAF |
| Ga0209329_10641891 | 3300027605 | Forest Soil | MSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIAF |
| Ga0209117_10041361 | 3300027645 | Forest Soil | MSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIKI |
| Ga0209388_10225734 | 3300027655 | Vadose Zone Soil | MSEAMTIPPLGEATAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0209736_12021572 | 3300027660 | Forest Soil | VSDTIAMPPPGETAEAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0209588_12625672 | 3300027671 | Vadose Zone Soil | MSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKI |
| Ga0207826_11929942 | 3300027680 | Tropical Forest Soil | MSETIAMPPLDNAETRHVPTVYFIDDSATMREVIKIAFRR |
| Ga0209908_101738583 | 3300027745 | Thawing Permafrost | MSDTMLIPTPEEPVQKRQPTVYFIDDSATMREVIKIAF |
| Ga0209039_101791761 | 3300027825 | Bog Forest Soil | MSETIAMPPLGSTESKPIPTVYFIDDSATMREVIKIAFRR |
| Ga0209580_101166713 | 3300027842 | Surface Soil | MSEAMPLPPLAGAPEKRTPTVYFIDDSATMREVIK |
| Ga0209580_103545781 | 3300027842 | Surface Soil | MSEAMPLLPLAGAPEKRTPTVYFIDDSATMREVIKIAFRR |
| Ga0209180_101524033 | 3300027846 | Vadose Zone Soil | MSEAMSIPPLGEAGTRRTPTVYFIDDSATMREVIK |
| Ga0209274_101365913 | 3300027853 | Soil | MSEAMTVPPLNETETKRTPTVYFIDDSATMREVIKIA |
| Ga0209283_102061973 | 3300027875 | Vadose Zone Soil | MSEALTLPPLAGAPEKRTPTVYFIDDSATMREVIK |
| Ga0209380_107460351 | 3300027889 | Soil | MSEAMTLPPLNETEAKRTPTVYFIDDSATMREVIKIAF |
| Ga0209488_105529952 | 3300027903 | Vadose Zone Soil | MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAF |
| Ga0137415_106567482 | 3300028536 | Vadose Zone Soil | MSETMPIPPLTDAPARQTPTVYFIDDSATMREVIKI |
| Ga0302300_10469363 | 3300030042 | Palsa | MSEVMPIPQLPDDGAKRTPTVYFIDDSATMREVIKI |
| Ga0316363_101186893 | 3300030659 | Peatlands Soil | MSDTIAMPPIDEAEAKHTPTVYFIDDSATMREVIKIAF |
| Ga0075388_113638881 | 3300030848 | Soil | VSETIAMPPLSEAETKHTPNVYFIDDSATMREVIK |
| Ga0170824_1010048133 | 3300031231 | Forest Soil | MSEAMIVPPLNETEAKRTPTVYFIDDSATMREVIKIAFR |
| Ga0310915_101685613 | 3300031573 | Soil | MSETISFPPLAETGALAKRAPTVYFIDDSATMREVIK |
| Ga0310915_104890512 | 3300031573 | Soil | VSETIAMPPLGTSETKHTPTVYFIDDSATMREVIKIAFR |
| Ga0310686_1027016614 | 3300031708 | Soil | MSETMTVPPLGEATPKRTPTVYFIDDSATMREVIKI |
| Ga0307469_124786372 | 3300031720 | Hardwood Forest Soil | MSETMPMPPLAETPVKQVPTVYFIDDSATMREVIKIAFRR |
| Ga0307475_100977085 | 3300031754 | Hardwood Forest Soil | MSETMPFPPAPAETAVPGKRTPTVYFIDDSATMREVIKIAF |
| Ga0318537_100932811 | 3300031763 | Soil | MSETISFPPLAETGALAKRAPTVYFIDDSATMREVIKI |
| Ga0318546_112095421 | 3300031771 | Soil | MSETIAMPPPSTSETKHTPTVYFIDDSATMREVIK |
| Ga0318508_10726841 | 3300031780 | Soil | MSESIAMPPLGTPETKHTPTVYFIDDSATMREVIKI |
| Ga0307478_111482272 | 3300031823 | Hardwood Forest Soil | MSELMAVPPFEESASKRTPTVYFIDDSATMREVIKI |
| Ga0307479_112194751 | 3300031962 | Hardwood Forest Soil | MSEALTIPPLGEAPAKRVPTVYFIDDSATMREVIKIA |
| Ga0307479_121516981 | 3300031962 | Hardwood Forest Soil | MSEAMTMPPLGEAPAKRTPTVYFIDDSATMREVIKI |
| Ga0306922_102162391 | 3300032001 | Soil | MSETMQFPPASSDPTLKRAHTVYFIDDSATMREVIKIAFRR |
| Ga0307471_1007298441 | 3300032180 | Hardwood Forest Soil | MSEIMPFPPAAAETAAPEKRIPTVYFIDDSATMREVIKIAF |
| Ga0306920_1004903341 | 3300032261 | Soil | MSETVATPPLASQEIKTAPTVYFIDDSATMREVIKIA |
| ⦗Top⦘ |