NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059376

Metagenome / Metatranscriptome Family F059376

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059376
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 37 residues
Representative Sequence MSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIA
Number of Associated Samples 121
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 99.25 %
% of genes from short scaffolds (< 2000 bps) 89.55 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.254 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.403 % of family members)
Environment Ontology (ENVO) Unclassified
(29.851 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.463 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 6.15%    β-sheet: 0.00%    Coil/Unstructured: 93.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF14332DUF4388 77.61
PF01584CheW 7.46
PF01339CheB_methylest 2.24
PF01425Amidase 1.49
PF00072Response_reg 0.75
PF03648Glyco_hydro_67N 0.75
PF02518HATPase_c 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 4.48
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.49
COG3661Alpha-glucuronidaseCarbohydrate transport and metabolism [G] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.25 %
UnclassifiedrootN/A0.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16546398All Organisms → cellular organisms → Bacteria1232Open in IMG/M
2228664022|INPgaii200_c0611681All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium528Open in IMG/M
3300001159|JGI12650J13346_1005373All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium605Open in IMG/M
3300001593|JGI12635J15846_10050886All Organisms → cellular organisms → Bacteria3160Open in IMG/M
3300002909|JGI25388J43891_1076632All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300002917|JGI25616J43925_10346008All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300004479|Ga0062595_100866418All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300004635|Ga0062388_102206787All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium573Open in IMG/M
3300005181|Ga0066678_10207073All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300005332|Ga0066388_102172993All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005332|Ga0066388_108111879All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005366|Ga0070659_100396005All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300005468|Ga0070707_101273389All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005526|Ga0073909_10378898All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300005540|Ga0066697_10001060All Organisms → cellular organisms → Bacteria → Acidobacteria10972Open in IMG/M
3300005541|Ga0070733_10264443All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300005542|Ga0070732_10244360All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300005542|Ga0070732_11025900All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005555|Ga0066692_10937808All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005586|Ga0066691_10112861All Organisms → cellular organisms → Bacteria1536Open in IMG/M
3300005587|Ga0066654_10926263All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005591|Ga0070761_10036791All Organisms → cellular organisms → Bacteria2740Open in IMG/M
3300005610|Ga0070763_10472942All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300005921|Ga0070766_11044487All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium563Open in IMG/M
3300006028|Ga0070717_11438260All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300006041|Ga0075023_100217546All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300006052|Ga0075029_100374628All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300006102|Ga0075015_100648834All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300006163|Ga0070715_11000842All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006175|Ga0070712_101930798All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006237|Ga0097621_101659592All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006806|Ga0079220_10192786All Organisms → cellular organisms → Bacteria1168Open in IMG/M
3300006871|Ga0075434_100077168All Organisms → cellular organisms → Bacteria3326Open in IMG/M
3300006893|Ga0073928_10778295All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006914|Ga0075436_101116180All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300007265|Ga0099794_10154185All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300007819|Ga0104322_122868All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300009088|Ga0099830_11089366All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009090|Ga0099827_10765019All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300009700|Ga0116217_10248009All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300010043|Ga0126380_10288236All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300010046|Ga0126384_10548386All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300010046|Ga0126384_12279369All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300010048|Ga0126373_12892395All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium536Open in IMG/M
3300010048|Ga0126373_13263047All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300010339|Ga0074046_10317545All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300010358|Ga0126370_11438878All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300010360|Ga0126372_10525570All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300010360|Ga0126372_10899560All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300010366|Ga0126379_13064569All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium559Open in IMG/M
3300010371|Ga0134125_11383363All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300010398|Ga0126383_11564269All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300011120|Ga0150983_11288463All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300011271|Ga0137393_10071132All Organisms → cellular organisms → Bacteria2776Open in IMG/M
3300012096|Ga0137389_10425754All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300012189|Ga0137388_11964568All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300012198|Ga0137364_11092523All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012201|Ga0137365_10635530All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300012203|Ga0137399_11006569All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300012209|Ga0137379_11148052All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012362|Ga0137361_11453199All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300012923|Ga0137359_11278726All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300012925|Ga0137419_11222813All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012944|Ga0137410_11053229Not Available694Open in IMG/M
3300014501|Ga0182024_10131380All Organisms → cellular organisms → Bacteria3559Open in IMG/M
3300015053|Ga0137405_1153853All Organisms → cellular organisms → Bacteria4920Open in IMG/M
3300015053|Ga0137405_1257336All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300015241|Ga0137418_11314184All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300015245|Ga0137409_11015202All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300017944|Ga0187786_10100947All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300017944|Ga0187786_10315696All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300017955|Ga0187817_10055992All Organisms → cellular organisms → Bacteria2436Open in IMG/M
3300017955|Ga0187817_10235216All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300018085|Ga0187772_10492086All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300020580|Ga0210403_10072431All Organisms → cellular organisms → Bacteria2768Open in IMG/M
3300020583|Ga0210401_10720472All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300021088|Ga0210404_10070599All Organisms → cellular organisms → Bacteria1697Open in IMG/M
3300021088|Ga0210404_10538700All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300021168|Ga0210406_10805652All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300021178|Ga0210408_10128218All Organisms → cellular organisms → Bacteria2003Open in IMG/M
3300021401|Ga0210393_10826898All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300021407|Ga0210383_10589687All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300021420|Ga0210394_11071145All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300021433|Ga0210391_10537321All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300021475|Ga0210392_10986180All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300021479|Ga0210410_10317648All Organisms → cellular organisms → Bacteria1397Open in IMG/M
3300021559|Ga0210409_10708893All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300021560|Ga0126371_10288387All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300022726|Ga0242654_10373274All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300025916|Ga0207663_10488909All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300025928|Ga0207700_10736911All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300025928|Ga0207700_10825503All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300026277|Ga0209350_1165876All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300026319|Ga0209647_1187528All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300026529|Ga0209806_1057526All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300026542|Ga0209805_1067193All Organisms → cellular organisms → Bacteria1752Open in IMG/M
3300026555|Ga0179593_1135840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_42299Open in IMG/M
3300026557|Ga0179587_10530736All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300027516|Ga0207761_1070856All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300027537|Ga0209419_1055349All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300027605|Ga0209329_1064189All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300027645|Ga0209117_1004136All Organisms → cellular organisms → Bacteria5023Open in IMG/M
3300027655|Ga0209388_1022573All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300027660|Ga0209736_1202157All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium515Open in IMG/M
3300027671|Ga0209588_1262567All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300027680|Ga0207826_1192994All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300027745|Ga0209908_10173858All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027825|Ga0209039_10179176All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300027842|Ga0209580_10116671All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300027842|Ga0209580_10354578All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300027846|Ga0209180_10152403All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300027853|Ga0209274_10136591All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300027875|Ga0209283_10206197All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300027889|Ga0209380_10746035All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300027903|Ga0209488_10552995All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300028536|Ga0137415_10656748All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300030042|Ga0302300_1046936All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300030659|Ga0316363_10118689All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300030848|Ga0075388_11363888All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300031231|Ga0170824_101004813All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300031573|Ga0310915_10168561All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300031573|Ga0310915_10489051All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300031708|Ga0310686_102701661All Organisms → cellular organisms → Bacteria1922Open in IMG/M
3300031720|Ga0307469_12478637All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031754|Ga0307475_10097708All Organisms → cellular organisms → Bacteria2287Open in IMG/M
3300031763|Ga0318537_10093281All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300031771|Ga0318546_11209542All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium531Open in IMG/M
3300031780|Ga0318508_1072684All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300031823|Ga0307478_11148227All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300031962|Ga0307479_11219475All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031962|Ga0307479_12151698All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300032001|Ga0306922_10216239All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300032180|Ga0307471_100729844All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300032261|Ga0306920_100490334All Organisms → cellular organisms → Bacteria1824Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil14.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.22%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.24%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.24%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.49%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.49%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Permafrost SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.75%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.75%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.75%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001159Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007819Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_010362502088090014SoilMSETISFPPIVEAGASTKRTPTVYFIDDSATMREVIKIAFR
INPgaii200_061168122228664022SoilVSETVAMPPLSEAEAKHTPNVYFIDDSATMREVIKIAFRR
JGI12650J13346_100537313300001159Forest SoilMSDAIVLPQSGEAEPRRTPTVYFIDDSATMREVIKI
JGI12635J15846_1005088613300001593Forest SoilMSEALIMPLAGEVAVKRAPTVYFIDDSATMREVIKI
JGI25388J43891_107663213300002909Grasslands SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAFRR
JGI25616J43925_1034600823300002917Grasslands SoilMSEAMTLPPLGEAPAKRTPTVYFIDDSATMREVIKIAFRR
Ga0062595_10086641823300004479SoilMSETISFPPLAETGALAKRAPTVYFIDDSATMREVIKIAFR
Ga0062388_10220678723300004635Bog Forest SoilMSDAITVPPLGDVAETRRTPTVYFIDDSATMREVIKIAFR
Ga0066678_1020707313300005181SoilMNETMPFPPAPAETAASEKRPPTVYFIDDSATMREVIKIAFRRE
Ga0066388_10217299313300005332Tropical Forest SoilMSETMMVPPLNEAPERHVPTVYFIDDSATMREVIKIAFRR
Ga0066388_10811187923300005332Tropical Forest SoilMTETLSFPPAAAENATSTKRAPTVYFIDDSATMREVIKIAFR
Ga0070659_10039600513300005366Corn RhizosphereMSEAMILPPFTDGQTKRAPTVYFIDDSATMREVIKIAFRR
Ga0070707_10127338913300005468Corn, Switchgrass And Miscanthus RhizosphereMNETMPFPPAPAETAASEKRTPTVYFIDDSATMREVIKIA
Ga0073909_1037889813300005526Surface SoilMSETISFPPIAETNALAKRTPTVYFIDDSATMREVIK
Ga0066697_10001060123300005540SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIA
Ga0070733_1026444313300005541Surface SoilMSETMTIPPTGETEAKKTPTVYFIDDSATMREVIKI
Ga0070732_1024436013300005542Surface SoilMSEAMPLPPLAGAPEKRTPTVYFIDDSATMREVIKIA
Ga0070732_1102590013300005542Surface SoilMSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIKIA
Ga0066692_1093780813300005555SoilMSETMTIPPLADASAKRTPTVYFIDDSATMREVIK
Ga0066691_1011286113300005586SoilMSEAMTIPPLGEASAKRTPTVYFIDDSATMREVIKIAF
Ga0066654_1092626313300005587SoilMSEAMMLPPLDEAAERRVPTVYFIDDSATMREVIKIA
Ga0070761_1003679153300005591SoilMSEIMAVPPLNDAPAKRTPTVYFIDDSATMREVIKI
Ga0070763_1047294223300005610SoilMSELMAVPPLTESSAKRTPTVYFIDDSATMREVIKIAFRR
Ga0070766_1104448713300005921SoilMSEVITMPPLGEAEVKKTPTVYFIDDSATMREVIKIAFR
Ga0070717_1143826023300006028Corn, Switchgrass And Miscanthus RhizosphereMSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIAFR
Ga0075023_10021754623300006041WatershedsMSEAMIIPPLDEAPAKRIPTVYFIDDSATMREVIKIAF
Ga0075029_10037462823300006052WatershedsMSEAMIIPPLDEAPAKRVPTVYFIDDSATMREVIKIA
Ga0075015_10064883423300006102WatershedsMSEAMTLPPLADAPAKRTPTVYFIDDSATMREVVKIAFRR
Ga0070715_1100084223300006163Corn, Switchgrass And Miscanthus RhizosphereMSEIMPFPPVTAETAAPEKRTPTVYFIDDSATMREVIKI
Ga0070712_10193079813300006175Corn, Switchgrass And Miscanthus RhizosphereMSEALIMPPAGETAVKRAPTVYFIDDSATMREVIKIAF
Ga0097621_10165959223300006237Miscanthus RhizosphereMSETMLVPPFTDGQTKRTPTVYFIDDSATMREVIKIA
Ga0079220_1019278613300006806Agricultural SoilMSEAMIVPPLQEAEAKRIPTVYFIDDSATMREVIKIAFR
Ga0075434_10007716813300006871Populus RhizosphereMSETISFPPIAGTGASAKRTPTVYFIDDSATMREVIKI
Ga0073928_1077829523300006893Iron-Sulfur Acid SpringMSEAMTVPPLNETEAKRTPTVYFIDDSATMREVIK
Ga0075436_10111618023300006914Populus RhizosphereMSETMPILPLTDAPARQTPTVYFIDDSATMREVIKI
Ga0099794_1015418513300007265Vadose Zone SoilMSETMTIPPPGEALAKKTPTVYFIDDSATMREVIKI
Ga0104322_12286833300007819Permafrost SoilMSEALIMPPAGEVAVKRAPTVYFIDDSATMREVIK
Ga0099830_1108936613300009088Vadose Zone SoilMSEAMTIPPLGEVPAKRTPTVYFIDDSATMREVIKIA
Ga0099827_1076501923300009090Vadose Zone SoilMSEALTLPPLAGAPEKRTPTVYFIDDSATMREVIKI
Ga0116217_1024800933300009700Peatlands SoilMSDVIAIPPINETEVKHTPTVYFIDDSATMREVIK
Ga0126380_1028823613300010043Tropical Forest SoilMSEAMIIPPLSESQTKRAPTVYFIDDSATMREVIKIA
Ga0126384_1054838623300010046Tropical Forest SoilMSEAISFPSAANAPARRTPTVYFIDDSATMREVIKIAF
Ga0126384_1227936923300010046Tropical Forest SoilMSETMPLPPQVESPETPVKAAPVVYFIDDSATMREVIKIAFR
Ga0126373_1289239523300010048Tropical Forest SoilMSETIAMPPLGSTETKQAPTVYFIDDSATMREVIKI
Ga0126373_1326304713300010048Tropical Forest SoilMSETGSFPPIAGTTASTKRVPTVYFIDDSATMREVIKIAF
Ga0074046_1031754513300010339Bog Forest SoilMSDVIAIPPINETEVKHTPTVYFIDDSATMREVIKIAF
Ga0126370_1143887823300010358Tropical Forest SoilMSEAMIIPPLDEAPAKRLPTVYFIDDSATMREVIK
Ga0126372_1052557033300010360Tropical Forest SoilMSESIAMPPPGTPETKHTPTVYFIDDSATMREVIKI
Ga0126372_1089956013300010360Tropical Forest SoilMSETMTVPPLTDRPAKRTSTVYFIDDSATMREVIKIAF
Ga0126379_1306456923300010366Tropical Forest SoilMSDAIVLTQPREAEAKRTPTVYFIDDSATMREVIKIAFR
Ga0134125_1138336313300010371Terrestrial SoilMSETMALPPFTDASAKKTPTVYFIDDSATMREVIK
Ga0126383_1156426923300010398Tropical Forest SoilMSEAMTIPPLEKAPAKRAPTVYFIDDSATMREVIKIAFR
Ga0150983_1128846313300011120Forest SoilMSEAMTVPPLKETEAKRTPTVYFIDDSATMREVIKIAF
Ga0137393_1007113253300011271Vadose Zone SoilMSEAMTIPPLGETPVKRTPTVYFIDDSATMREVIKIAF
Ga0137389_1042575413300012096Vadose Zone SoilMSEAMTMPPLSDAHAKRTPTVYFIDDSATMREVVK
Ga0137388_1196456813300012189Vadose Zone SoilMSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIA
Ga0137364_1109252323300012198Vadose Zone SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAFR
Ga0137365_1063553013300012201Vadose Zone SoilMNETMPFPPAPAETAAPEKRAPTVYFIDDSATMREVIKIAFR
Ga0137399_1100656913300012203Vadose Zone SoilMSETMTIPPPGGEALAKKTPTVYFIDDSATMREVIKI
Ga0137379_1114805213300012209Vadose Zone SoilMSEAMMLPPLDEAPEKRVPTVYFIDDSATMREVIKI
Ga0137361_1145319923300012362Vadose Zone SoilMNETMPFQPAPAETAASEKRPPTVYFIDDSATMREVIKIAF
Ga0137359_1127872613300012923Vadose Zone SoilMSEAMIIPPLGEATAKRTPTVYFIDDSATMREVIKIAF
Ga0137419_1122281313300012925Vadose Zone SoilMSEAMTIPPLGETPVKRTPTVYFIDDSVTMREVIKIA
Ga0137410_1105322913300012944Vadose Zone SoilMSETMPFPPAPVETAASAKRAPTVYFIDDSATMRE
Ga0182024_1013138063300014501PermafrostMSEIMAVPPLTEAPAKRPPTIYFIDDSATMREVIKI
Ga0137405_115385313300015053Vadose Zone SoilMSETMTIPPPGEALDKKTPTVYFIDDSATMREVIKIAFDARS
Ga0137405_125733613300015053Vadose Zone SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVTRSH
Ga0137418_1131418423300015241Vadose Zone SoilMSEIMPFAPPPVESAAPEKRTPTVYFIDDSATMREVIKIAFRR
Ga0137409_1101520213300015245Vadose Zone SoilMSETMPFPPAPVETAASAKRAPTVYFIDDSATMREVIKIAFR
Ga0187786_1010094723300017944Tropical PeatlandMSDTVAMPPVGATETKTAPTVYFIDDSATMREVIKIAFRRE
Ga0187786_1031569623300017944Tropical PeatlandMSDTMPLPPIAETPVKQAPTIYFIDDSATMREVIKI
Ga0187817_1005599253300017955Freshwater SedimentMSDTIAMPPIGETEAKHTPTVYFIDDSATMREVIK
Ga0187817_1023521633300017955Freshwater SedimentMSETIAMPPLGSTETKQAPTVYFIDDSATMREVIKIA
Ga0187772_1049208623300018085Tropical PeatlandMSDVIAIPPIGETEVKHNPTVYFIDDSATMREVIK
Ga0210403_1007243153300020580SoilMSDAIVLPETGATEARRTPTVYFIDDSATMREVIKIAFRR
Ga0210401_1072047223300020583SoilMSDAIVLPETGAAEPRRTPTVYFIDDSATMREVIKIA
Ga0210404_1007059913300021088SoilMSETLIMPPAGETAVKRAPTVYFIDDSATMREVIKIAF
Ga0210404_1053870023300021088SoilMSEAMIVAPLNETETKRKPTVYFIDDSATMREVIKIAFRRE
Ga0210406_1080565213300021168SoilMSEAMTIPPLGETAQKRTPTVYFIDDSATMREVIKIAF
Ga0210408_1012821853300021178SoilMSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIK
Ga0210393_1082689823300021401SoilMSEAMTLPPLADAPAKRTPTVYFIDDSATMRDVIEIAF
Ga0210383_1058968713300021407SoilMSEVITMPPLGEAEVKKTPTVYFIDDSATMREVIKIA
Ga0210394_1107114523300021420SoilMSDAIVLPETGQAEARRTPTVYFIDDSATMREVIKIAFR
Ga0210391_1053732123300021433SoilMSEIMAVPPLNDAPAKRTPTVYFIDDSATMREVIKIAFRR
Ga0210392_1098618013300021475SoilMSESMLLPTPSEPEQKRLPTVYFIDDSATMREVIKIA
Ga0210410_1031764813300021479SoilMSETIAMPPLTETETKRTPTVYFIDDSATMREVIK
Ga0210409_1070889313300021559SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIK
Ga0126371_1028838713300021560Tropical Forest SoilMSEAMMLPPLDEAPEKRVPTVYFIDDSATMREVIKIA
Ga0242654_1037327413300022726SoilMSEAMTIPPLGEAPAKRIPTVYFIYDSATMREVIKIAFRR
Ga0207663_1048890923300025916Corn, Switchgrass And Miscanthus RhizosphereMSETISFPPIAETNASAKRTPTVYFIDDSATMREVIKIAFRR
Ga0207700_1073691123300025928Corn, Switchgrass And Miscanthus RhizosphereVSETMPFPPSPTETAAPEKRTPTVYFIDDSATMREVIKIAFR
Ga0207700_1082550333300025928Corn, Switchgrass And Miscanthus RhizosphereMSEAMTLPPLADASAKRTPTVYFIDDSATMREVIKIAFR
Ga0209350_116587613300026277Grasslands SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKI
Ga0209647_118752813300026319Grasslands SoilMSETMPIPPLTDAPARQTPTVYFIDDSATMREVIKIAF
Ga0209806_105752643300026529SoilMNETMPFPPAPAETAAPEKRAPTVYFIDDSATMRE
Ga0209805_106719313300026542SoilMSEAMTIPPLGEASAKRTPTVYFIDDSATMREVIKIAFRR
Ga0179593_113584053300026555Vadose Zone SoilMSEAMTIPPLGEAPAKRIPTVYFIDDSATMREVIKIAFAGRIST
Ga0179587_1053073623300026557Vadose Zone SoilMSETLPFPPAPVETAASAKRTPTVYFIDDSATMREVIKIAFR
Ga0207761_107085613300027516Tropical Forest SoilMSETVSMPPLGNPEMKAAPTVYFIDDSATMREVIK
Ga0209419_105534913300027537Forest SoilMSEALIMPPAGEVAVKRAPTVYFIDDSATMREVIKIAF
Ga0209329_106418913300027605Forest SoilMSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKIAF
Ga0209117_100413613300027645Forest SoilMSEAMTLPPLADAPAKRTPTVYFIDDSATMREVIKI
Ga0209388_102257343300027655Vadose Zone SoilMSEAMTIPPLGEATAKRTPTVYFIDDSATMREVIKIAFR
Ga0209736_120215723300027660Forest SoilVSDTIAMPPPGETAEAKRTPTVYFIDDSATMREVIKIAFR
Ga0209588_126256723300027671Vadose Zone SoilMSEAMTIPPLADAPAKRTPTVYFIDDSATMREVIKI
Ga0207826_119299423300027680Tropical Forest SoilMSETIAMPPLDNAETRHVPTVYFIDDSATMREVIKIAFRR
Ga0209908_1017385833300027745Thawing PermafrostMSDTMLIPTPEEPVQKRQPTVYFIDDSATMREVIKIAF
Ga0209039_1017917613300027825Bog Forest SoilMSETIAMPPLGSTESKPIPTVYFIDDSATMREVIKIAFRR
Ga0209580_1011667133300027842Surface SoilMSEAMPLPPLAGAPEKRTPTVYFIDDSATMREVIK
Ga0209580_1035457813300027842Surface SoilMSEAMPLLPLAGAPEKRTPTVYFIDDSATMREVIKIAFRR
Ga0209180_1015240333300027846Vadose Zone SoilMSEAMSIPPLGEAGTRRTPTVYFIDDSATMREVIK
Ga0209274_1013659133300027853SoilMSEAMTVPPLNETETKRTPTVYFIDDSATMREVIKIA
Ga0209283_1020619733300027875Vadose Zone SoilMSEALTLPPLAGAPEKRTPTVYFIDDSATMREVIK
Ga0209380_1074603513300027889SoilMSEAMTLPPLNETEAKRTPTVYFIDDSATMREVIKIAF
Ga0209488_1055299523300027903Vadose Zone SoilMSEAMTIPPLGEAPAKRTPTVYFIDDSATMREVIKIAF
Ga0137415_1065674823300028536Vadose Zone SoilMSETMPIPPLTDAPARQTPTVYFIDDSATMREVIKI
Ga0302300_104693633300030042PalsaMSEVMPIPQLPDDGAKRTPTVYFIDDSATMREVIKI
Ga0316363_1011868933300030659Peatlands SoilMSDTIAMPPIDEAEAKHTPTVYFIDDSATMREVIKIAF
Ga0075388_1136388813300030848SoilVSETIAMPPLSEAETKHTPNVYFIDDSATMREVIK
Ga0170824_10100481333300031231Forest SoilMSEAMIVPPLNETEAKRTPTVYFIDDSATMREVIKIAFR
Ga0310915_1016856133300031573SoilMSETISFPPLAETGALAKRAPTVYFIDDSATMREVIK
Ga0310915_1048905123300031573SoilVSETIAMPPLGTSETKHTPTVYFIDDSATMREVIKIAFR
Ga0310686_10270166143300031708SoilMSETMTVPPLGEATPKRTPTVYFIDDSATMREVIKI
Ga0307469_1247863723300031720Hardwood Forest SoilMSETMPMPPLAETPVKQVPTVYFIDDSATMREVIKIAFRR
Ga0307475_1009770853300031754Hardwood Forest SoilMSETMPFPPAPAETAVPGKRTPTVYFIDDSATMREVIKIAF
Ga0318537_1009328113300031763SoilMSETISFPPLAETGALAKRAPTVYFIDDSATMREVIKI
Ga0318546_1120954213300031771SoilMSETIAMPPPSTSETKHTPTVYFIDDSATMREVIK
Ga0318508_107268413300031780SoilMSESIAMPPLGTPETKHTPTVYFIDDSATMREVIKI
Ga0307478_1114822723300031823Hardwood Forest SoilMSELMAVPPFEESASKRTPTVYFIDDSATMREVIKI
Ga0307479_1121947513300031962Hardwood Forest SoilMSEALTIPPLGEAPAKRVPTVYFIDDSATMREVIKIA
Ga0307479_1215169813300031962Hardwood Forest SoilMSEAMTMPPLGEAPAKRTPTVYFIDDSATMREVIKI
Ga0306922_1021623913300032001SoilMSETMQFPPASSDPTLKRAHTVYFIDDSATMREVIKIAFRR
Ga0307471_10072984413300032180Hardwood Forest SoilMSEIMPFPPAAAETAAPEKRIPTVYFIDDSATMREVIKIAF
Ga0306920_10049033413300032261SoilMSETVATPPLASQEIKTAPTVYFIDDSATMREVIKIA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.