| Basic Information | |
|---|---|
| Family ID | F059348 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | SYYNVRVTDYKIDDCECKAREFRRHSPCKHMKRLHEKLTHLSI |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.58 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.299 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (13.433 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.493 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.791 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 12.68% Coil/Unstructured: 74.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 3.73 |
| PF00118 | Cpn60_TCP1 | 3.73 |
| PF04488 | Gly_transf_sug | 2.99 |
| PF03851 | UvdE | 2.99 |
| PF00085 | Thioredoxin | 2.99 |
| PF00149 | Metallophos | 2.24 |
| PF01713 | Smr | 2.24 |
| PF00578 | AhpC-TSA | 2.24 |
| PF00535 | Glycos_transf_2 | 2.24 |
| PF06831 | H2TH | 2.24 |
| PF10688 | Imp-YgjV | 1.49 |
| PF03061 | 4HBT | 1.49 |
| PF03767 | Acid_phosphat_B | 1.49 |
| PF13412 | HTH_24 | 1.49 |
| PF08282 | Hydrolase_3 | 0.75 |
| PF10417 | 1-cysPrx_C | 0.75 |
| PF02739 | 5_3_exonuc_N | 0.75 |
| PF01370 | Epimerase | 0.75 |
| PF02773 | S-AdoMet_synt_C | 0.75 |
| PF09360 | zf-CDGSH | 0.75 |
| PF00166 | Cpn10 | 0.75 |
| PF10985 | DUF2805 | 0.75 |
| PF00722 | Glyco_hydro_16 | 0.75 |
| PF14279 | HNH_5 | 0.75 |
| PF01149 | Fapy_DNA_glyco | 0.75 |
| PF00856 | SET | 0.75 |
| PF04055 | Radical_SAM | 0.75 |
| PF09225 | Endonuc-PvuII | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 3.73 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 2.99 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.99 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 2.99 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 1.49 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 1.49 |
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.75 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.75 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.75 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.75 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.75 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.70 % |
| Unclassified | root | N/A | 40.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000149|LPaug09P1610mDRAFT_c1045997 | Not Available | 510 | Open in IMG/M |
| 3300000947|BBAY92_10207828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Bacillus phage vB_BcoS-136 | 509 | Open in IMG/M |
| 3300001352|JGI20157J14317_10209604 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300001965|GOS2243_1003421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1526 | Open in IMG/M |
| 3300003345|JGI26080J50196_1080880 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300003410|JGI26086J50260_1082485 | Not Available | 667 | Open in IMG/M |
| 3300003427|JGI26084J50262_1032271 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
| 3300004461|Ga0066223_1278021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300004642|Ga0066612_1311207 | Not Available | 942 | Open in IMG/M |
| 3300005433|Ga0066830_10052651 | Not Available | 836 | Open in IMG/M |
| 3300005735|Ga0076923_112956 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 619 | Open in IMG/M |
| 3300005747|Ga0076924_1136136 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 874 | Open in IMG/M |
| 3300005942|Ga0070742_10117275 | Not Available | 737 | Open in IMG/M |
| 3300006164|Ga0075441_10227695 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 690 | Open in IMG/M |
| 3300006616|Ga0101440_124091 | All Organisms → Viruses → Predicted Viral | 2205 | Open in IMG/M |
| 3300006621|Ga0101441_124930 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 3231 | Open in IMG/M |
| 3300006737|Ga0098037_1196554 | Not Available | 661 | Open in IMG/M |
| 3300006752|Ga0098048_1094374 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300006752|Ga0098048_1195799 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 597 | Open in IMG/M |
| 3300006793|Ga0098055_1064209 | Not Available | 1461 | Open in IMG/M |
| 3300006870|Ga0075479_10182409 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 848 | Open in IMG/M |
| 3300006925|Ga0098050_1030160 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1475 | Open in IMG/M |
| 3300006990|Ga0098046_1057032 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 904 | Open in IMG/M |
| 3300007539|Ga0099849_1291996 | Not Available | 590 | Open in IMG/M |
| 3300007541|Ga0099848_1262917 | Not Available | 600 | Open in IMG/M |
| 3300007546|Ga0102874_1149994 | Not Available | 725 | Open in IMG/M |
| 3300007637|Ga0102906_1052723 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300007658|Ga0102898_1044252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1002 | Open in IMG/M |
| 3300007661|Ga0102866_1192373 | Not Available | 524 | Open in IMG/M |
| 3300007667|Ga0102910_1145023 | Not Available | 558 | Open in IMG/M |
| 3300007706|Ga0102899_1077937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 800 | Open in IMG/M |
| 3300007778|Ga0102954_1077757 | Not Available | 924 | Open in IMG/M |
| 3300009024|Ga0102811_1223193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Elemovirus | 704 | Open in IMG/M |
| 3300009027|Ga0102957_1063922 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 1265 | Open in IMG/M |
| 3300009027|Ga0102957_1222993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Arcobacteraceae → Arcobacter → unclassified Arcobacter → Arcobacter sp. | 679 | Open in IMG/M |
| 3300009425|Ga0114997_10344288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300009432|Ga0115005_11085203 | Not Available | 649 | Open in IMG/M |
| 3300009497|Ga0115569_10015612 | All Organisms → Viruses → Predicted Viral | 4815 | Open in IMG/M |
| 3300009505|Ga0115564_10168996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1161 | Open in IMG/M |
| 3300009677|Ga0115104_10276784 | Not Available | 771 | Open in IMG/M |
| 3300009703|Ga0114933_10364373 | Not Available | 951 | Open in IMG/M |
| 3300010354|Ga0129333_10256709 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1574 | Open in IMG/M |
| 3300012919|Ga0160422_10289540 | Not Available | 1006 | Open in IMG/M |
| 3300012936|Ga0163109_11227524 | Not Available | 547 | Open in IMG/M |
| 3300012954|Ga0163111_11511363 | Not Available | 665 | Open in IMG/M |
| 3300016797|Ga0182090_1561937 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
| 3300017708|Ga0181369_1048152 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 960 | Open in IMG/M |
| 3300017714|Ga0181412_1011229 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300017714|Ga0181412_1015810 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2177 | Open in IMG/M |
| 3300017721|Ga0181373_1004010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2858 | Open in IMG/M |
| 3300017725|Ga0181398_1031811 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1296 | Open in IMG/M |
| 3300017734|Ga0187222_1108533 | Not Available | 626 | Open in IMG/M |
| 3300017737|Ga0187218_1101562 | Not Available | 690 | Open in IMG/M |
| 3300017740|Ga0181418_1065461 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 894 | Open in IMG/M |
| 3300017741|Ga0181421_1060181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| 3300017745|Ga0181427_1126220 | Not Available | 623 | Open in IMG/M |
| 3300017748|Ga0181393_1031453 | All Organisms → Viruses → Predicted Viral | 1505 | Open in IMG/M |
| 3300017763|Ga0181410_1175354 | Not Available | 595 | Open in IMG/M |
| 3300017765|Ga0181413_1149183 | Not Available | 705 | Open in IMG/M |
| 3300017767|Ga0181406_1132385 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 750 | Open in IMG/M |
| 3300017769|Ga0187221_1006869 | All Organisms → Viruses → Predicted Viral | 4560 | Open in IMG/M |
| 3300017776|Ga0181394_1002110 | All Organisms → cellular organisms → Bacteria | 8411 | Open in IMG/M |
| 3300017776|Ga0181394_1164804 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 684 | Open in IMG/M |
| 3300017779|Ga0181395_1225109 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 578 | Open in IMG/M |
| 3300017782|Ga0181380_1092394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
| 3300017956|Ga0181580_10193647 | Not Available | 1431 | Open in IMG/M |
| 3300017956|Ga0181580_10313118 | Not Available | 1066 | Open in IMG/M |
| 3300017967|Ga0181590_10676306 | Not Available | 698 | Open in IMG/M |
| 3300018039|Ga0181579_10590791 | Not Available | 575 | Open in IMG/M |
| 3300018410|Ga0181561_10082870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1816 | Open in IMG/M |
| 3300018417|Ga0181558_10454745 | Not Available | 672 | Open in IMG/M |
| 3300018421|Ga0181592_10149841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1779 | Open in IMG/M |
| 3300018424|Ga0181591_10234836 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300018424|Ga0181591_10960492 | Not Available | 583 | Open in IMG/M |
| 3300020162|Ga0211735_10402918 | Not Available | 1088 | Open in IMG/M |
| 3300020165|Ga0206125_10388449 | Not Available | 509 | Open in IMG/M |
| 3300020175|Ga0206124_10238913 | Not Available | 707 | Open in IMG/M |
| 3300020185|Ga0206131_10333532 | Not Available | 662 | Open in IMG/M |
| 3300020365|Ga0211506_1143186 | Not Available | 673 | Open in IMG/M |
| 3300020392|Ga0211666_10385722 | Not Available | 513 | Open in IMG/M |
| 3300020394|Ga0211497_10045215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1948 | Open in IMG/M |
| 3300020408|Ga0211651_10088944 | All Organisms → Viruses → Predicted Viral | 1291 | Open in IMG/M |
| 3300020408|Ga0211651_10177873 | Not Available | 837 | Open in IMG/M |
| 3300020437|Ga0211539_10174210 | Not Available | 880 | Open in IMG/M |
| 3300020439|Ga0211558_10200042 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 953 | Open in IMG/M |
| 3300020439|Ga0211558_10400241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300020446|Ga0211574_10238334 | Not Available | 788 | Open in IMG/M |
| 3300020461|Ga0211535_10215224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 846 | Open in IMG/M |
| 3300020465|Ga0211640_10356473 | Not Available | 807 | Open in IMG/M |
| 3300020810|Ga0181598_1317026 | Not Available | 548 | Open in IMG/M |
| 3300021169|Ga0206687_1476212 | Not Available | 569 | Open in IMG/M |
| 3300021364|Ga0213859_10129096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1194 | Open in IMG/M |
| 3300021371|Ga0213863_10025605 | All Organisms → Viruses → Predicted Viral | 3321 | Open in IMG/M |
| 3300021425|Ga0213866_10476657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 598 | Open in IMG/M |
| 3300021957|Ga0222717_10018088 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 4757 | Open in IMG/M |
| 3300021957|Ga0222717_10065631 | All Organisms → Viruses → Predicted Viral | 2324 | Open in IMG/M |
| 3300021957|Ga0222717_10421947 | Not Available | 733 | Open in IMG/M |
| 3300021957|Ga0222717_10433494 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 720 | Open in IMG/M |
| 3300021959|Ga0222716_10031829 | All Organisms → Viruses → Predicted Viral | 3836 | Open in IMG/M |
| 3300021964|Ga0222719_10423206 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300022925|Ga0255773_10205505 | Not Available | 885 | Open in IMG/M |
| 3300022927|Ga0255769_10041983 | All Organisms → Viruses → Predicted Viral | 2828 | Open in IMG/M |
| 3300022937|Ga0255770_10350727 | Not Available | 660 | Open in IMG/M |
| 3300023116|Ga0255751_10144716 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
| 3300023116|Ga0255751_10169424 | All Organisms → Viruses | 1258 | Open in IMG/M |
| 3300023170|Ga0255761_10427330 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 648 | Open in IMG/M |
| 3300023178|Ga0255759_10191718 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
| 3300024229|Ga0233402_1103853 | Not Available | 590 | Open in IMG/M |
| 3300024236|Ga0228655_1003138 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4784 | Open in IMG/M |
| 3300024247|Ga0228675_1003372 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 4767 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10074287 | Not Available | 1629 | Open in IMG/M |
| 3300024319|Ga0228670_1001225 | Not Available | 11701 | Open in IMG/M |
| 3300024322|Ga0228656_1048387 | Not Available | 950 | Open in IMG/M |
| 3300024348|Ga0244776_10575770 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 714 | Open in IMG/M |
| 3300025084|Ga0208298_1017599 | Not Available | 1627 | Open in IMG/M |
| 3300025098|Ga0208434_1010785 | All Organisms → Viruses → Predicted Viral | 2523 | Open in IMG/M |
| 3300025695|Ga0209653_1120343 | Not Available | 816 | Open in IMG/M |
| 3300025704|Ga0209602_1107259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 973 | Open in IMG/M |
| 3300025767|Ga0209137_1231223 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 601 | Open in IMG/M |
| 3300025879|Ga0209555_10100006 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
| 3300026483|Ga0228620_1005440 | All Organisms → Viruses → Predicted Viral | 4009 | Open in IMG/M |
| 3300027239|Ga0208807_1041481 | Not Available | 645 | Open in IMG/M |
| 3300027250|Ga0208310_1022117 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300027416|Ga0207994_1067151 | Not Available | 724 | Open in IMG/M |
| 3300027687|Ga0209710_1100067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300027797|Ga0209107_10040031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2671 | Open in IMG/M |
| 3300027976|Ga0209702_10046908 | All Organisms → Viruses → Predicted Viral | 2538 | Open in IMG/M |
| 3300028110|Ga0247584_1050466 | Not Available | 1048 | Open in IMG/M |
| 3300028110|Ga0247584_1161172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 550 | Open in IMG/M |
| 3300028128|Ga0228645_1104321 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 627 | Open in IMG/M |
| 3300028133|Ga0228609_1036137 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300028194|Ga0257106_1055736 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1482 | Open in IMG/M |
| 3300031175|Ga0308020_1070710 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300031702|Ga0307998_1020424 | All Organisms → Viruses → Predicted Viral | 2837 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 12.69% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.19% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.46% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 5.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.48% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.99% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.24% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.24% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.24% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.49% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.49% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.49% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.49% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.75% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.75% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.75% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.75% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.75% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004642 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_10m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006616 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ06 time point | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007661 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 | Environmental | Open in IMG/M |
| 3300007667 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016797 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041408BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024247 | Seawater microbial communities from Monterey Bay, California, United States - 36D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024319 | Seawater microbial communities from Monterey Bay, California, United States - 85D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
| 3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027250 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028133 | Seawater microbial communities from Monterey Bay, California, United States - 10D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031175 | Marine microbial communities from water near the shore, Antarctic Ocean - #349 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPaug09P1610mDRAFT_10459971 | 3300000149 | Marine | KTNKLSYYDVTVIDYKISECECKAREFNRYAPCKHMKRLKEKLSHLKI* |
| BBAY92_102078281 | 3300000947 | Macroalgal Surface | SYYNVRVTDYEIVDWECKAREFRRYTPCKHMKRLQQKCSHLTLN* |
| JGI20157J14317_102096041 | 3300001352 | Pelagic Marine | DWKIVDCECKAREFRKFTPCKHMKRLNQKLGHSL* |
| GOS2243_10034211 | 3300001965 | Marine | VTVTDYRITDCECKAREFRPYSPCKHMKRLHEKLGHLEI* |
| JGI26080J50196_10808803 | 3300003345 | Marine | TGKLAYYKVTVTDYKISDCECPARSFRKYSPCKHMKNLHTKLGPHITI* |
| JGI26086J50260_10824852 | 3300003410 | Marine | TGKLSHYDVTVTDYKISDCECKAREFRKFTPCKHMKRLHEKLNHLSI* |
| JGI26084J50262_10322715 | 3300003427 | Marine | YYRVRVTDYKIDDCECPARQFRSHSPCKHMKRLNEKLTHLAI* |
| Ga0066223_12780211 | 3300004461 | Marine | VKVTDYKIVDCECKAREFRPYSPCKHMKRLYEKTGHKLV* |
| Ga0066612_13112071 | 3300004642 | Marine | GKLSYYEVTVTDYKISDCECPARSFRSYSPCKHMKRLHEKLTHLSI* |
| Ga0066830_100526511 | 3300005433 | Marine | SYYNVKVTDYKISDCECKAREFRPHSACKHMKRLHEKLNHLSI* |
| Ga0076923_1129562 | 3300005735 | Marine | KYYNVSVENWKIVDCECPAREFRRYSPCKHMKRLSEKMSNLTLN* |
| Ga0076924_11361362 | 3300005747 | Marine | NWKIVDCECPAREFRRYSPCKHMKRLSEKMSNLTLN* |
| Ga0070742_101172751 | 3300005942 | Estuarine | SYYNVTVTDWKISDCECKAREFRAHTPCKHMKRLHEKLTHLSI* |
| Ga0075441_102276951 | 3300006164 | Marine | VTVTDFKITDCECPAREFRSYTPCKHMKRLNEKLTHFTI* |
| Ga0101440_1240917 | 3300006616 | Marine Surface Water | KLSYYNVRVTDYKIDDCECPARSFRSYQPCKHMKRLNEKLTHLSI* |
| Ga0101441_1249301 | 3300006621 | Marine Surface Water | KTGKLSYYQVRVTDYRIDDCECKAREFRPHSPCKHMKRLHEKLSHLAI* |
| Ga0098037_11965541 | 3300006737 | Marine | DFRISDCECKARQFKPYAPCKHMKRLNEKVSTYDI* |
| Ga0098048_10943744 | 3300006752 | Marine | KYYNVSVENWKIVDCECPAREFRRYTPCKHMKRLSEKMSNLTIN* |
| Ga0098048_11957993 | 3300006752 | Marine | LSYYQVRVTDYKIDDCECPARSFRSYTPCKHMKRLQQKLTHLSI* |
| Ga0098055_10642092 | 3300006793 | Marine | DYKIDDCECPARSFRSYTPCKHMKRLQQKLTHLSI* |
| Ga0075479_101824093 | 3300006870 | Aqueous | DYKIDDCECPARQFRSYSPCKHMKRLNEKLTHLSI* |
| Ga0098050_10301601 | 3300006925 | Marine | GKLSYYNVKVTDHKIVDCECKAREFSRYTPCKHMKRLHEKIGHSL* |
| Ga0098046_10570321 | 3300006990 | Marine | TGKLSYYQVRVTDYKIDDCECPARSFRSYTPCKHMKRLQQKLTHLSI* |
| Ga0099849_12919962 | 3300007539 | Aqueous | GKLSYYRVRVTDYKIDDCECPARQFRSYSPCKHMKRLNEKLTHLTI* |
| Ga0099848_12629173 | 3300007541 | Aqueous | GKLSYYRVTVEDWKIVDCECKAREFRRHSPCKHMKRLNEKLTHLAI* |
| Ga0102874_11499942 | 3300007546 | Estuarine | KLKYYKVKVTDYKIVDCTCPAREFNRYSPCKHMKRLHEKIGNEL* |
| Ga0102906_10527232 | 3300007637 | Estuarine | SYYNVRVTDYKIDDCECKAREFRRHSPCKHMKRLHEKLTHLSI* |
| Ga0102898_10442523 | 3300007658 | Estuarine | GKLKYYKVKVTDYKIVDCTCPAREFNRYSPCKHMKRLHEKIGNEL* |
| Ga0102866_11923732 | 3300007661 | Estuarine | LSHYNVKVTDYKISDCECKAREFRAHTPCKHMKRLHEKLTHLSI* |
| Ga0102910_11450231 | 3300007667 | Estuarine | NKKTGKLSYYNVKVTDYHISDCECKAREFRAHTPCKHMKRLHEKLTHLSI* |
| Ga0102899_10779371 | 3300007706 | Estuarine | YKVKVTDYKIVDCTCPAREFNRYSPCKHMKRLHEKIGNEL* |
| Ga0102954_10777574 | 3300007778 | Water | DWKIVDCECKAREFRRYTPCKHMKRLSEKMVNLTIN* |
| Ga0102811_12231933 | 3300009024 | Estuarine | YYNVKVTDYKIDDCECPARSFRSYQPCKHMKRLHEKLTHLSI* |
| Ga0102957_10639223 | 3300009027 | Pond Water | DCECPAREFRRYTPCKHMKRLNEKLTHLAI*VGIN* |
| Ga0102957_12229931 | 3300009027 | Pond Water | TGKLNYYQVTVIDYKISDCECPARGFRKFTPCKHMKRLHEKLGHLSI* |
| Ga0114997_103442881 | 3300009425 | Marine | KKTKELSYYTVTVTDYKIVDCECPARSFRSFSPCKHMKRLHEKLGHLSI* |
| Ga0115005_110852033 | 3300009432 | Marine | GNLSYYNVTVTDYKISDCECKAREFRKHSPCKHMKRLHEKLGHMAI* |
| Ga0115569_100156129 | 3300009497 | Pelagic Marine | TDYKIDDCECPARQFRSYSPCKHMKRLHEKLTHLSI* |
| Ga0115564_101689964 | 3300009505 | Pelagic Marine | YRIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI* |
| Ga0115104_102767845 | 3300009677 | Marine | SYYQVRVTDYKIDDCECPARSFRSYSPCKHMKRLKEKLNHLSI* |
| Ga0114933_103643733 | 3300009703 | Deep Subsurface | YYNVRVTDYVIDDCECMARQFRPHSPCKHMKRLQEKLSHLSI* |
| Ga0129333_102567095 | 3300010354 | Freshwater To Marine Saline Gradient | VEDWKIVDCQCPAREFRRHTPCKHMKRLNEKLTHLTI* |
| Ga0160422_102895404 | 3300012919 | Seawater | YYQVKVTDYKIDDCECMARQFRPYSPCKHMKRLKEKLDHLAI* |
| Ga0163109_112275242 | 3300012936 | Surface Seawater | VRVTDYVIDDCECMARQFRPHSPCKHMKRLNEKLSHLKV* |
| Ga0163111_115113631 | 3300012954 | Surface Seawater | LNYYQVKVTDYKIDDCECMARQFRPYSPCKHMKRLKEKLDHLAI* |
| Ga0182090_15619378 | 3300016797 | Salt Marsh | NKKTGKLSYYNVRVTDYQIVDCECKAREFRRYTPCKHMKRLQEKCGHLTIS |
| Ga0181369_10481521 | 3300017708 | Marine | QVRVTDYRIDDCNCKAREFRSYSPCKHMKRLHEKLTHLSI |
| Ga0181412_10112295 | 3300017714 | Seawater | YQVRVTDYKIDDCECPARSFRSYSPCKHMKRLQEKLTHLAI |
| Ga0181412_10158103 | 3300017714 | Seawater | RVADYKIDDCECPARSFRSHSPCKHMKRLQQKLTHLSI |
| Ga0181373_10040101 | 3300017721 | Marine | TDYKIVDCECKAREFRPYSPCKHMKRLHEKTGHKLV |
| Ga0181398_10318114 | 3300017725 | Seawater | YYQVRVTDYKIDDCECPARQFRSYSPCKHMKRLQQKLTHLSI |
| Ga0187222_11085331 | 3300017734 | Seawater | YYQVRVTDYKIDDCECPARSFRSYQPCKHMKRLHEKLNHLSI |
| Ga0187218_11015621 | 3300017737 | Seawater | TDYKIDDCECPARSFRSHSPCKHMKRLQQKLTHLSI |
| Ga0181418_10654613 | 3300017740 | Seawater | VRVTDYTIDDCECMARQFRPHSPCKHMKRLKEKLDHLSI |
| Ga0181421_10601811 | 3300017741 | Seawater | TGKLAHYTVKVTDYKIVDCECKAREFRPYSPCKHMKRLHEKTGHKLV |
| Ga0181427_11262201 | 3300017745 | Seawater | GKLSYYNVRVTDYKIDECECKAREFNRYTPCKHMKRLKEKLSHYNI |
| Ga0181393_10314531 | 3300017748 | Seawater | GKLSYYNVRVTDYKIDECECKAREFNRYTPCKHMKRLKEKLSHLKI |
| Ga0181410_11753542 | 3300017763 | Seawater | KLSYYQVRVTDYKIDDCECPARSFRSYSPCKHMKRLQEKLTHLAI |
| Ga0181413_11491833 | 3300017765 | Seawater | SYYQVRVTDYRIDDCNCKAREFRSYSPCKHMKRLKEKLNHLSI |
| Ga0181406_11323852 | 3300017767 | Seawater | VRVTDYKIDDCECPARQFRSYSPCKHMKRLHEKLSHLEL |
| Ga0187221_10068691 | 3300017769 | Seawater | GKVSYYNVTVTDYRITDCECPARSFRSYSPCKHMKRLQEKLTHLSI |
| Ga0181394_100211016 | 3300017776 | Seawater | SYYQVRVTDYKIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0181394_11648042 | 3300017776 | Seawater | SYYQVRVTDYKIDDCNCKAREFRSYSPCKHMKRLQEKLTHLAI |
| Ga0181395_12251091 | 3300017779 | Seawater | IERGRVTDYKIDDCECPARQFRSYSPCKHMKRLHEKLSHLAL |
| Ga0181380_10923943 | 3300017782 | Seawater | YTVKVTDYKIVDCECKAREFRPYSPCKHMKRLHEKTGHKLV |
| Ga0181580_101936471 | 3300017956 | Salt Marsh | NKKNGKLNYYQVTVTDYKISDCSCPARGFRRYTQCKHMKRLHEKLGHLDI |
| Ga0181580_103131181 | 3300017956 | Salt Marsh | RVRVTDYKIDDCECPARQFRSYSPCKHMKRLKEKLNHLSI |
| Ga0181590_106763061 | 3300017967 | Salt Marsh | KYYQVRVTDYKIDDCECPARQFRSYSPCKHMKRLNEKLSHLTT |
| Ga0181579_105907911 | 3300018039 | Salt Marsh | TDYKIDDCECPARQFRSYSPCKHMKRLNEKLSHLSI |
| Ga0181561_100828701 | 3300018410 | Salt Marsh | VKVTDYKIVDCTCPAREFNRYSPCKHMKRLHEKIGNEL |
| Ga0181558_104547451 | 3300018417 | Salt Marsh | VRVTDYKIDDCECPARQFRSYSPCKHMKRLNEKLSHLSI |
| Ga0181592_101498411 | 3300018421 | Salt Marsh | RVTDYKIDDCECPARQFRSYSPCKHMKRLNEKLSHLSI |
| Ga0181591_102348361 | 3300018424 | Salt Marsh | LSYYRVTVEDWKIVDCECKAREFRRHTPCKHMKRLNEKLTHLAI |
| Ga0181591_109604921 | 3300018424 | Salt Marsh | GKLSYYRVTVEDWKIVDCECKAREFRKFTPCKHMKRLNQKLTHLAI |
| Ga0211735_104029181 | 3300020162 | Freshwater | YRVTVEDWKIVDCKCPAREFRRHTPCKHMKRLNEKLTHLTI |
| Ga0206125_103884493 | 3300020165 | Seawater | QVRVTDYKIDDCNCKAREFRSYSPCKHMKRLHEKLTHLSI |
| Ga0206124_102389132 | 3300020175 | Seawater | FDYKISDCECKAREFRPYSPCKHMKRLREKLTHLSI |
| Ga0206131_103335322 | 3300020185 | Seawater | YYTVTVTDFKITDCECPAREFRSYTPCKHMKRLNEKLTHLAI |
| Ga0211506_11431861 | 3300020365 | Marine | GNLKYYQVRVTDYKIDDCECMARQFRPHSPCKHMKRLKEKLSHLAI |
| Ga0211666_103857221 | 3300020392 | Marine | KKGNLKYYQVRVTDYKIDDCECMARQFRPYSPCKHMKRLKEKLDHLAI |
| Ga0211497_100452156 | 3300020394 | Marine | DYKIDDCECMARQFRPYSPCKHMKRLKEKLDHLAI |
| Ga0211651_100889441 | 3300020408 | Marine | EHKIDDCECMARQFRPYSPCKHMKRLKEKLSHLSI |
| Ga0211651_101778731 | 3300020408 | Marine | VRVTDYKIDDCECMARQFRPHSPCKHMKRLKEKLNHLAI |
| Ga0211539_101742101 | 3300020437 | Marine | DYVIDDCECMARQFRPYSPCKHMKRLKEKLSHLSI |
| Ga0211558_102000424 | 3300020439 | Marine | QVRVTDYKIDDCECMARQFRPYSPCKHMKRLHEKLGHLAI |
| Ga0211558_104002413 | 3300020439 | Marine | RVTDYKIDDCECMARQFRPYSPCKHMKRLHEKLSHFAI |
| Ga0211574_102383343 | 3300020446 | Marine | LKYYQVRVTDYKIDDCECMARQFRPHSPCKHMKRLKEKLDHLAI |
| Ga0211535_102152244 | 3300020461 | Marine | TDYKIDDCECMARQFRPYSPCKHMKRLKEKLSHLAI |
| Ga0211640_103564731 | 3300020465 | Marine | NKLNYYNVRVTEHKIDDCECMARQFRPHSPCKHMKRLKEKLSHLSI |
| Ga0181598_13170261 | 3300020810 | Salt Marsh | YYRVTVEDWKIVDCECKGREFRKFTPCKHMKRLNEKLTHLAI |
| Ga0206687_14762121 | 3300021169 | Seawater | WVDDVDLKFVGYDKKTGKLSYYNVKVTDYKIDDCECPARSFRSYQPCKHMKRLHEKLTHLSI |
| Ga0213859_101290961 | 3300021364 | Seawater | KTGKLSYYNVKVTDYKIVDCECKAREFSRYTPCKHMKNLHKKLGHSL |
| Ga0213863_100256051 | 3300021371 | Seawater | KLSYYNVKVTDYKISDCECKAREFKPHSACKHMKRLHQKLNHLSI |
| Ga0213866_104766571 | 3300021425 | Seawater | LNYYNVKVTDYKIVDCNCMAREFRPYSPCKHMKRLHEKLGHSL |
| Ga0222717_1001808810 | 3300021957 | Estuarine Water | VRVTDYRIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0222717_100656311 | 3300021957 | Estuarine Water | QVKVTDYKIDDCNCKAREFRSYSPCKHMKRLHEKLTHLSI |
| Ga0222717_104219471 | 3300021957 | Estuarine Water | KTGKLSYYQVRVTDSKIDDCECPARSFRSHSPCKHMKRLQQKLTHLSI |
| Ga0222717_104334941 | 3300021957 | Estuarine Water | YQVKVTDYKIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0222716_100318291 | 3300021959 | Estuarine Water | LSYYQVRVTDYKIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0222719_104232061 | 3300021964 | Estuarine Water | VKVTDWKIVDCTCKAREFRKFSPCKHMKNLQSKNQILSL |
| Ga0255773_102055051 | 3300022925 | Salt Marsh | LKYYQVRVTDYKIDDCECPARQFRSYSPCKHMKRLNEKLSHLTT |
| Ga0255769_100419831 | 3300022927 | Salt Marsh | RNKKTGKLSYYNVRVTDYQIVDCECKAREFHRYTPCKHMKRLQEKCGHLTIS |
| Ga0255770_103507271 | 3300022937 | Salt Marsh | TDWKISDCECKAREFRRHTPCKHMKRLNEKLTHLAI |
| Ga0255751_101447164 | 3300023116 | Salt Marsh | YYDVTVTDWKISDCECKAREFRRHTPCKHMKRLNEKLTHLAI |
| Ga0255751_101694243 | 3300023116 | Salt Marsh | VTDYKIDDCECPARQFRSHSPCKHMKRLNEKLTHLAI |
| Ga0255761_104273302 | 3300023170 | Salt Marsh | SYYNVKVTDYKISDCECKAREFKPHSACKHMKRLHQKLNHLSI |
| Ga0255759_101917181 | 3300023178 | Salt Marsh | TGKLSYYQVKVTDYKIVDCECPARSFRAYTPCKHMKRLHEKLSHYSI |
| Ga0233402_11038532 | 3300024229 | Seawater | TGKLSHYNVKVTDYKISDCECKAREFRAHTPCKHMKRLHEKLTHLSI |
| Ga0228655_100313815 | 3300024236 | Seawater | LTRSGNVKVTDYKISDCECKAREFRPHSACKHMKRLHEKLTHLSI |
| Ga0228675_100337215 | 3300024247 | Seawater | RSGNVKVTDYKISDCECKAREFRPHSACKHMKRLHEKLTHLSI |
| (restricted) Ga0233438_100742871 | 3300024255 | Seawater | KLSYYQVKVTDYKIDDCNCKAREFRSYSPCKHMKRLHEKLTHLSI |
| Ga0228670_10012251 | 3300024319 | Seawater | KKTGKLSYYQVKVTDYKIDDCNCKAREFRSYSPCKHMKRLHEKLTHLSI |
| Ga0228656_10483873 | 3300024322 | Seawater | YYQVRVTDYRIDDCECKAREFRPHSPCKHMKRLKEKLTHLSI |
| Ga0244776_105757703 | 3300024348 | Estuarine | TDYKISDCECKAREFRKHSPCKHMKRLHEKLNHLSI |
| Ga0208298_10175991 | 3300025084 | Marine | TGKLSYYQVRVTDYKIDDCECPARSFRSYTPCKHMKRLQQKLTHLSI |
| Ga0208434_10107855 | 3300025098 | Marine | YYQVRVTDYKIDDCECPARSFRSYTPCKHMKRLQQKLTHLSI |
| Ga0209653_11203433 | 3300025695 | Marine | VTDWKIVDCECKAREFRKFTPCKHMKRLNEKLTHLAI |
| Ga0209602_11072591 | 3300025704 | Pelagic Marine | RVTDYRIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0209137_12312231 | 3300025767 | Marine | DVTVTDYKISDCECKAREFRKHSPCKHMKRLHEKLNHLSI |
| Ga0209555_101000061 | 3300025879 | Marine | DYKISDCECKAREFRKHSPCKHMKRLHEKLTHLSI |
| Ga0228620_100544016 | 3300026483 | Seawater | YNVKVTDYHISDCECKAREFRAHTPCKHMKRLHEKLTHLSI |
| Ga0208807_10414812 | 3300027239 | Estuarine | YKVKVTDYKIVDCTCPAREFNRYSPCKHMKRLHEKIGNEL |
| Ga0208310_10221171 | 3300027250 | Estuarine | DYKISDCECKAREFRAHTPCKHMKRLHEKLTHLSI |
| Ga0207994_10671511 | 3300027416 | Estuarine | VKVTDYKIDDCECPARSFRSYQPCKHMKRLHEKLTHLSI |
| Ga0209710_11000671 | 3300027687 | Marine | KTGKLSYYEVTVTDYKISDCECPARSFRSYSPCKHMKRLHEKLTHLSI |
| Ga0209107_100400316 | 3300027797 | Freshwater And Sediment | VEKTKKLKYYNVTVKDFVIVDCECEGRQFRRFSACKHMKRLQEKTGHLEIK |
| Ga0209702_100469081 | 3300027976 | Freshwater | TGKVPNYKVTVENYKITECGCPARSFKKYTPCKHMKNLHTKLGPHILI |
| Ga0247584_10504661 | 3300028110 | Seawater | KVTDYHISDCECKAREFRAHTPCKHMKRLHEKLTHLSI |
| Ga0247584_11611721 | 3300028110 | Seawater | VRVTDYRIDDCNCKAREFRSYSPCKHMKRLHEKLTHLCI |
| Ga0228645_11043213 | 3300028128 | Seawater | KLSYYQVKVTDYKIDDCNCKAREFRSYSPCKHMKRLQEKLTHLSI |
| Ga0228609_10361373 | 3300028133 | Seawater | GKLSYYQVRVTDYKIDDCECPARQFRSYSPCKHMKRLHEKLSHLEL |
| Ga0257106_10557365 | 3300028194 | Marine | YNVKVTDHKIVDCECKAREFSRYTPCKHMKRLHEKIGHSL |
| Ga0308020_10707101 | 3300031175 | Marine | TGKLSYYEVTVTDYKISDCECPARSFRSYSPCKHMKRLNEKLTHLSI |
| Ga0307998_10204245 | 3300031702 | Marine | VTVTDYKVTDCGCPARSFRKYTPCKHMKRLHEKLGHVTI |
| ⦗Top⦘ |