| Basic Information | |
|---|---|
| Family ID | F059326 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VITIEQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATIIDQE |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.49 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 94.78 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.507 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.448 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.985 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (70.149 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.40% β-sheet: 0.00% Coil/Unstructured: 72.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF01887 | SAM_HAT_N | 3.73 |
| PF02782 | FGGY_C | 0.75 |
| PF00291 | PALP | 0.75 |
| PF00285 | Citrate_synt | 0.75 |
| PF07676 | PD40 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 3.73 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.51 % |
| Unclassified | root | N/A | 1.49 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004114|Ga0062593_103060043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300004643|Ga0062591_101750025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300004643|Ga0062591_102552402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005093|Ga0062594_101972536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300005280|Ga0065696_1230711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300005330|Ga0070690_101712657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300005334|Ga0068869_102080468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005353|Ga0070669_101401749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300005365|Ga0070688_101224669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005406|Ga0070703_10282724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005438|Ga0070701_10836675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300005440|Ga0070705_100621063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300005441|Ga0070700_100017220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4127 | Open in IMG/M |
| 3300005444|Ga0070694_100397260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300005459|Ga0068867_100066620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2683 | Open in IMG/M |
| 3300005459|Ga0068867_100980121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300005468|Ga0070707_101890153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005547|Ga0070693_100732649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300005564|Ga0070664_101122828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300005577|Ga0068857_100149491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2115 | Open in IMG/M |
| 3300005614|Ga0068856_102374083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005615|Ga0070702_101178290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300005616|Ga0068852_102536726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005618|Ga0068864_100099949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2571 | Open in IMG/M |
| 3300005618|Ga0068864_101376516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300005618|Ga0068864_102047826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300005618|Ga0068864_102673173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300005719|Ga0068861_101057595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300005840|Ga0068870_10910911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300005840|Ga0068870_11020220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005840|Ga0068870_11321240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005841|Ga0068863_100301477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1554 | Open in IMG/M |
| 3300005841|Ga0068863_102387897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005844|Ga0068862_101765043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300006058|Ga0075432_10478706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006169|Ga0082029_1225985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300006237|Ga0097621_101700208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300006755|Ga0079222_12427507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300006794|Ga0066658_10687984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300006847|Ga0075431_100728934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300006847|Ga0075431_101611732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300006847|Ga0075431_102111387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300006871|Ga0075434_100140879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300006880|Ga0075429_101733588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300006881|Ga0068865_101285988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300006894|Ga0079215_10663204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300006954|Ga0079219_11802194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300007004|Ga0079218_12588447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300007258|Ga0099793_10492957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300009098|Ga0105245_11091742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300009101|Ga0105247_11515398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300009143|Ga0099792_10677225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300009162|Ga0075423_10650522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300009162|Ga0075423_10937574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300009162|Ga0075423_12636412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300009177|Ga0105248_10687246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300009177|Ga0105248_11582210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300009553|Ga0105249_13057689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300009553|Ga0105249_13137981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300009789|Ga0126307_10156296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
| 3300010036|Ga0126305_10678208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300010037|Ga0126304_11051215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300010040|Ga0126308_10987347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300010044|Ga0126310_10418374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 959 | Open in IMG/M |
| 3300010044|Ga0126310_10935152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300010047|Ga0126382_12420550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300010166|Ga0126306_10816698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300010397|Ga0134124_12300494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300010400|Ga0134122_10553742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300010403|Ga0134123_11721629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012899|Ga0157299_10119471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300012927|Ga0137416_12130602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012930|Ga0137407_10328395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300012948|Ga0126375_11187059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300012958|Ga0164299_11203037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300013102|Ga0157371_10428764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300013296|Ga0157374_12970907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300013306|Ga0163162_12401069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300013307|Ga0157372_11763278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300013307|Ga0157372_11786615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300013307|Ga0157372_12247324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300014326|Ga0157380_11261782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300014487|Ga0182000_10193767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300014745|Ga0157377_10179300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300014968|Ga0157379_10183864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1888 | Open in IMG/M |
| 3300014968|Ga0157379_11176288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300015371|Ga0132258_13834220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
| 3300015372|Ga0132256_101994730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300015372|Ga0132256_103711657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300018051|Ga0184620_10098681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300018081|Ga0184625_10259836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300018422|Ga0190265_10221273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300021445|Ga0182009_10208988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
| 3300024287|Ga0247690_1031046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300025321|Ga0207656_10532734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300025903|Ga0207680_10982538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300025911|Ga0207654_10166313 | Not Available | 1428 | Open in IMG/M |
| 3300025911|Ga0207654_10265638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300025912|Ga0207707_10516636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300025913|Ga0207695_11529422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300025918|Ga0207662_10276709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1109 | Open in IMG/M |
| 3300025922|Ga0207646_10051035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3701 | Open in IMG/M |
| 3300025925|Ga0207650_11467032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300025930|Ga0207701_11465948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300025936|Ga0207670_10684045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300025938|Ga0207704_11104583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300025941|Ga0207711_11991505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300025942|Ga0207689_11558622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300025945|Ga0207679_11590380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300025949|Ga0207667_11960935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300025961|Ga0207712_10063657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2626 | Open in IMG/M |
| 3300025961|Ga0207712_11999966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300025981|Ga0207640_10967963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300026088|Ga0207641_10300443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1516 | Open in IMG/M |
| 3300026088|Ga0207641_10860895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300026095|Ga0207676_11161800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300026116|Ga0207674_11338887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300026116|Ga0207674_11770408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300026116|Ga0207674_12092522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300026118|Ga0207675_101010281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300026118|Ga0207675_101866394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300026118|Ga0207675_102591413 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027018|Ga0208475_1013655 | Not Available | 793 | Open in IMG/M |
| 3300027787|Ga0209074_10376477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300030511|Ga0268241_10095178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300031716|Ga0310813_12018506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031740|Ga0307468_100470630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300031852|Ga0307410_10660157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300032004|Ga0307414_11286884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300032004|Ga0307414_11560055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300032005|Ga0307411_11234680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300032005|Ga0307411_11429575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300032157|Ga0315912_10714133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300033412|Ga0310810_11124096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.72% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.72% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.97% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.73% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.49% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere Bulk Soil | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005280 | Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soil | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062593_1030600432 | 3300004114 | Soil | GAGEKFNVLVITIEPREATVVQVTLSPKNLALLLKDPEGTGKAITEEATIIDQE* |
| Ga0062591_1017500252 | 3300004643 | Soil | LVITIERREATVVQVTLSPKNLALLMKDPEGTGKAITQEATIIDQE* |
| Ga0062591_1025524021 | 3300004643 | Soil | YIYLRSAGDKHHVLVITIGERDATVVQVTVSAKNLALLLRDPEGTGKSITEEATIIDQE* |
| Ga0062594_1019725362 | 3300005093 | Soil | DAKYNVLVITIEQREAAVVQVTLSPQNLLLLMKDPEGTGKNITQEATIIDQE* |
| Ga0065696_12307111 | 3300005280 | Switchgrass Rhizosphere Bulk Soil | YLRDAGQKFHVLVITIAERDATVVQITIKPEHLAKLLKDPEGTGKEITEEATIIDQE* |
| Ga0070690_1017126572 | 3300005330 | Switchgrass Rhizosphere | IEQREATVVQVTLSPQNLLLLMKDPEGTGKNITQEATIIDQE* |
| Ga0068869_1020804682 | 3300005334 | Miscanthus Rhizosphere | AKYNVLVITIEQREATVVQVTLSPQNLLLLMKDPEGTGKNITQEATIIDQE* |
| Ga0070669_1014017492 | 3300005353 | Switchgrass Rhizosphere | VNISPRDAAVVQATLSPKNLALLMKDPEEGGKALRQEAIIDQE* |
| Ga0070688_1012246691 | 3300005365 | Switchgrass Rhizosphere | KVNVLVITIEQRDATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE* |
| Ga0070703_102827242 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LFVREADEKFNVLVITIEQREATVVQVTLSPQNLLLLMKDPEGTGKNITQEATIIDQE* |
| Ga0070701_108366751 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | KYNVLVITIEQREATVVQVTLSPQNLLLLMKDPEGTGKNITQEATIIDQE* |
| Ga0070705_1006210632 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GDKFNVLVITIDQRDATVVQVTLSPRNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0070700_1000172205 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | NVLVITIEQRDATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE* |
| Ga0070694_1003972602 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LVVTIEPRDATVVQVTLSPKNVALLMKDPEGTGKAITEEATIVDPE* |
| Ga0068867_1000666203 | 3300005459 | Miscanthus Rhizosphere | NVLVITIDQRDATVVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE* |
| Ga0068867_1009801212 | 3300005459 | Miscanthus Rhizosphere | REAGEKYNVLVITIDQRDATVVQVTLSPENLKLLLKDPEGTGKAITEEATIIDQE* |
| Ga0070707_1018901531 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QREATVVQVTLSPENLKRLLKDPEGTGKAITEEATIVDQE* |
| Ga0070693_1007326492 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | NVLVITIDERDATVVQVTLSAKNLALLLKDPEGTGKAITDEATLIDQE* |
| Ga0070664_1011228281 | 3300005564 | Corn Rhizosphere | FLKDAGDKFDVLVITIEQRDASVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0068857_1001494913 | 3300005577 | Corn Rhizosphere | VVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE* |
| Ga0068856_1023740832 | 3300005614 | Corn Rhizosphere | IFLRDNGDKTNVLVITIDTRDATVVQVTLSQKNLALLLKDPEGTGKAITEEATLIDQE* |
| Ga0070702_1011782901 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VRNNGDKFNVLVITIDPGDATVVQVTLSAKNLALLMKDPDGMGKAITDEATVVDQ* |
| Ga0068852_1025367261 | 3300005616 | Corn Rhizosphere | DATVVQVTVSGKNLALLLKDPEGTGKSITQEATIIDQE* |
| Ga0068864_1000999494 | 3300005618 | Switchgrass Rhizosphere | VVQVTLSPKNLALLLKDPEGTGKAITQEATILDQE* |
| Ga0068864_1013765161 | 3300005618 | Switchgrass Rhizosphere | DGEQVYIYLREAGQKFHALVITIAQRDATVVQVTLSEKNLALLLKDPEGTGKSITEEATINDQE* |
| Ga0068864_1020478262 | 3300005618 | Switchgrass Rhizosphere | SAQDQEQVYIFLKEAGDKFNVLVITIEQREATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0068864_1026731732 | 3300005618 | Switchgrass Rhizosphere | REATVVQVTLSPKNFLLLLKDPEGTGKSISQEATIIDQE* |
| Ga0068861_1010575951 | 3300005719 | Switchgrass Rhizosphere | TIAQRDATVVQVTLSEKNLALLLKDPEGTGKSITEEATINDQE* |
| Ga0068870_109109112 | 3300005840 | Miscanthus Rhizosphere | DKTNVLVITIDERDATVVQVTLSQKNLALLLKDPEGTGKAITEEATLKDQE* |
| Ga0068870_110202202 | 3300005840 | Miscanthus Rhizosphere | NVLVITIEQRDATVVQVTLSPKNLALLMKDPEGTGKAITEEATLIDQE* |
| Ga0068870_113212402 | 3300005840 | Miscanthus Rhizosphere | NVLVITIEQREATVVQVTLSPHNLLLLMKDPEGTGKSITQEATIIDQE* |
| Ga0068863_1003014771 | 3300005841 | Switchgrass Rhizosphere | IEQREATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQEE* |
| Ga0068863_1023878971 | 3300005841 | Switchgrass Rhizosphere | YIFVREAGDKFNTLVITIDQRDATVVQVTLSPKNLALLMKDPEGTGKAITEEATIIDPE* |
| Ga0068862_1017650431 | 3300005844 | Switchgrass Rhizosphere | LKDAGDKFNVLVITIEQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0075432_104787061 | 3300006058 | Populus Rhizosphere | VLVITIDERDATVVQVTLSQKNLALLLKDPEGTGKAITEEATLNDQE* |
| Ga0082029_12259852 | 3300006169 | Termite Nest | VITSAQRDAAVVQVNLSRKNHALLLKDPEGTGKSITEEATIIDQE* |
| Ga0097621_1017002081 | 3300006237 | Miscanthus Rhizosphere | EQVYIFLKDAGDKFNVLVITIDQRDATVVQVTLSPRNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0079222_124275071 | 3300006755 | Agricultural Soil | RDATVVQVTLSPKNLSLLLKDPEGTGKAITQEATINDQE* |
| Ga0066658_106879842 | 3300006794 | Soil | ITIEERDATVVQVTLSQKNLARLLRDPEGTGKAITEEATIIDQE* |
| Ga0075431_1007289341 | 3300006847 | Populus Rhizosphere | IFVREAGEKFNVLVITIEPREATVVQVTLSPKNFALLLKDPEGTGKGITQEATIIDQE* |
| Ga0075431_1016117322 | 3300006847 | Populus Rhizosphere | LVITIDQRDASVVQVTLSPKNLVELMKDPEGTGKAIAEEATIIDQE* |
| Ga0075431_1021113871 | 3300006847 | Populus Rhizosphere | KFNVLVITITSRDATVVQVNLSRKNLALLLKDPEGTGKSITEEATIIDQE* |
| Ga0075434_1001408794 | 3300006871 | Populus Rhizosphere | QNYIYLKNAGEKYNVLVINIEERDATVVQVTISSKNLALLLKDPEGTGKSITEEATIIDQE* |
| Ga0075429_1017335881 | 3300006880 | Populus Rhizosphere | VLVITIDERDATVVQVTLSQKNLALLLKDPEGTGKAITEEATINDQE* |
| Ga0068865_1012859881 | 3300006881 | Miscanthus Rhizosphere | DNGDKTNVLVITIDERDATVVQVTLSAKNLALLLKDPEGTGKSITEEATLIDQE* |
| Ga0079215_106632041 | 3300006894 | Agricultural Soil | DNAEQVYIYVRESGDKFKVLIITIERREAVVVQATLSPKNLALLIKDPEGMGKSITEEATINDQE* |
| Ga0079219_118021941 | 3300006954 | Agricultural Soil | VQVTLSPENLKLLLKDPEGTGKAITEEATIIDQE* |
| Ga0079218_125884471 | 3300007004 | Agricultural Soil | VYIYVRESGDKFKVLIITIERREAVVVQATLSPKNLALLIKDPEGMGKSITEEATINDQE |
| Ga0099793_104929572 | 3300007258 | Vadose Zone Soil | VVQVTLSPKNLALLMQDPNGMGRAITEDATTTDPE* |
| Ga0105245_110917421 | 3300009098 | Miscanthus Rhizosphere | AGDKFNVLVITIDQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0105247_115153982 | 3300009101 | Switchgrass Rhizosphere | DATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0099792_106772252 | 3300009143 | Vadose Zone Soil | EATVVQVTLSPKNLALLMQDPNGMGRAITEDATTTDPE* |
| Ga0075423_106505222 | 3300009162 | Populus Rhizosphere | FLKEAGDKFNVLVITIEQREATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0075423_109375741 | 3300009162 | Populus Rhizosphere | DVLVITIGQREATVVQVTLSPKTLVLLMQDPEEMGKTITDDATLNDPE* |
| Ga0075423_126364121 | 3300009162 | Populus Rhizosphere | VITIDQPDPTVVRVTHSPRNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0105248_106872461 | 3300009177 | Switchgrass Rhizosphere | ITIDQRDATVVQVTLSPKNLALLLKDPEGTGKVITQEATINDQE* |
| Ga0105248_115822102 | 3300009177 | Switchgrass Rhizosphere | ATVVQVALSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0105249_130576892 | 3300009553 | Switchgrass Rhizosphere | VITIEPREATVVQVTLSPKNLALLLKDPEGTGKAITQEATILDQE* |
| Ga0105249_131379812 | 3300009553 | Switchgrass Rhizosphere | DATVVQVTLSPKNLALLMKDPEGTGKSITEEATIIDQE* |
| Ga0126307_101562963 | 3300009789 | Serpentine Soil | YIFLKDAGDKFNVLVITIEQREATVVQVTLSPKNLALLLKDPEGTGKAITQEATIIDQE* |
| Ga0126305_106782081 | 3300010036 | Serpentine Soil | EKFNVLVVTIEQRDATVVQVTLSPKNLALLLKDPEGTGKAITEEATIIDQE* |
| Ga0126304_110512151 | 3300010037 | Serpentine Soil | DVLVITIEQRDATVVQVTLSPRNVALLLKDPEGTGKAITQEATINDQE* |
| Ga0126308_109873472 | 3300010040 | Serpentine Soil | VITIEQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATIIDQE* |
| Ga0126310_104183743 | 3300010044 | Serpentine Soil | VLVITIADRDATVVQVTLSPKNLAILMRDPEGTGKSITEEATIIDQE* |
| Ga0126310_109351521 | 3300010044 | Serpentine Soil | LVITIEPREATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0126382_124205502 | 3300010047 | Tropical Forest Soil | HVLVITIDEHDATVVQVTLSQKNLALLLKDPEGTGKAITEEATINDQE* |
| Ga0126306_108166981 | 3300010166 | Serpentine Soil | AGDKFNVLVITIEQRDATVVQVTLSPKNLAQLLKDPEGTGKAITQEATINDQE* |
| Ga0134124_123004942 | 3300010397 | Terrestrial Soil | DKTDVLVITIDARDATVVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE* |
| Ga0134122_105537421 | 3300010400 | Terrestrial Soil | INIAERDATVVQVTVSGKNLALLLKDPEGTGKSITEEATIIDQE* |
| Ga0134123_117216291 | 3300010403 | Terrestrial Soil | VITIDERDATVVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE* |
| Ga0157299_101194712 | 3300012899 | Soil | VITIDQRDATVVQVTLSPKNLALLMKDPEGTGKAITEEATIIDPE* |
| Ga0137416_121306022 | 3300012927 | Vadose Zone Soil | IFLRNAGDNFHVLVITIEQREATVVQITLSQKNLALLMQDPNGMGRAITEDATTTDPE* |
| Ga0137407_103283951 | 3300012930 | Vadose Zone Soil | VITIEQREATVVQVTLSPKNPALLMQDPNGMGRAITEDATTTDPE* |
| Ga0126375_111870591 | 3300012948 | Tropical Forest Soil | DKYNVLVVNISQRDATVVQVTISERNLALLLKDPEGAGKAITDEATINDQE* |
| Ga0164299_112030371 | 3300012958 | Soil | AIEPRDASVVQVTLSPENLKLLLKDPEGTGKAITEEATIIDQE* |
| Ga0157371_104287642 | 3300013102 | Corn Rhizosphere | FNVLVITIEQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0157374_129709071 | 3300013296 | Miscanthus Rhizosphere | IEQRDATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE* |
| Ga0163162_124010691 | 3300013306 | Switchgrass Rhizosphere | KTNVLVITIDERDATVVQVTLSRKNLALLLKDPEGTGKSITEEATLIDQE* |
| Ga0157372_117632781 | 3300013307 | Corn Rhizosphere | RNAGDKYHVLVITIEERDATVVQVTVSGKNLALLLKDPEGTGKSITEEATINDQE* |
| Ga0157372_117866151 | 3300013307 | Corn Rhizosphere | QRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0157372_122473242 | 3300013307 | Corn Rhizosphere | TYIFLRDAGDKTNVLVVTIDERDATVVQVTLSQKNLALLLKDPEGTGKAITEEATLIDQE |
| Ga0157380_112617822 | 3300014326 | Switchgrass Rhizosphere | RDATVVQVNLSRKNLALLLKDPEGTGKSITEEATIIDQE* |
| Ga0182000_101937671 | 3300014487 | Soil | DATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE* |
| Ga0157377_101793002 | 3300014745 | Miscanthus Rhizosphere | ITIGERDATVVQVTVSAKNLALLLRDPEGTGKSITDEATIIDQE* |
| Ga0157379_101838641 | 3300014968 | Switchgrass Rhizosphere | KFNVLVITIEQREATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQEE* |
| Ga0157379_111762881 | 3300014968 | Switchgrass Rhizosphere | KFNVLVITIEQREATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0132258_138342202 | 3300015371 | Arabidopsis Rhizosphere | LKDAGDKFNVLVITIDQRDATVVQVTLSPKNLALLLKDPEGTGKAITQEATINDQE* |
| Ga0132256_1019947302 | 3300015372 | Arabidopsis Rhizosphere | SQREATVVQVTISEKNLALLLKDPEGAGKAITEEATINDQE* |
| Ga0132256_1037116571 | 3300015372 | Arabidopsis Rhizosphere | IFLREAGEKCNVLVITIDQRDANEVQVNLSPENLKLLLKDPEGTGKAITEEATLNDQK* |
| Ga0184620_100986811 | 3300018051 | Groundwater Sediment | LRSSGDKFNVLVITIEKRDATVVQITLSPKNLALLMQDPNSMGRAITEDATINDQE |
| Ga0184625_102598362 | 3300018081 | Groundwater Sediment | VLVITIGQREGTVVQATLSSKNLALLLKDPEGAGKNITNEATIIDNE |
| Ga0190265_102212733 | 3300018422 | Soil | IEQREGTVVQVTLSPKNLALLMKDPEGTGKSITQEATIVDQE |
| Ga0182009_102089881 | 3300021445 | Soil | YIFLREADEKFNVLVVTIEPRDATVVQATLSPENLKLLLKDPEGTGKAITDEATIIDQE |
| Ga0247690_10310461 | 3300024287 | Soil | LIVSIEQRDATVIQVTLSPTNFARLLKDPEGTGKAIAEEATINDQE |
| Ga0207656_105327342 | 3300025321 | Corn Rhizosphere | NNGDKFNVLVITIDPGDATVVQVTLSAKNLALLMKDPDGMGKAITDEATVVDQ |
| Ga0207680_109825381 | 3300025903 | Switchgrass Rhizosphere | RDAGEKINVLVITIEQRDATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE |
| Ga0207654_101663134 | 3300025911 | Corn Rhizosphere | FNVLVITIEPREATVVQVTLSPKNLALLLKDPEGTGKAIAQEATIVDQE |
| Ga0207654_102656382 | 3300025911 | Corn Rhizosphere | FHALVITIAQRDATVVQVTLSEKNLALLLKDPEGTGKSITEEATINDQE |
| Ga0207707_105166361 | 3300025912 | Corn Rhizosphere | KYNVLFISIEEREATVIQVTLSPKNFARLLKDPEGTGKAIAEEATINDQE |
| Ga0207695_115294222 | 3300025913 | Corn Rhizosphere | EPHDATVVQATVSPKNLALLMKDPEEGAKAITQEATIIDQE |
| Ga0207662_102767091 | 3300025918 | Switchgrass Rhizosphere | VINIAERDASVVQVTISSKNLALLLKDPEGTGKSITEEATIIDQE |
| Ga0207646_100510351 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TIERREATVVQVTLSPKNLALLMQDPNGMGRAVTEDATTTDPE |
| Ga0207650_114670322 | 3300025925 | Switchgrass Rhizosphere | TVVQVTISPRNLAQLLKDPEGTGKAITQEATINDQE |
| Ga0207701_114659482 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | KINVLVITNEQRDATVVQVTLSPKNLALLLKDPEGTGKSITQEATINDQE |
| Ga0207670_106840452 | 3300025936 | Switchgrass Rhizosphere | VVQVALSPKNLALLLKDPEGTGKAITQEATINDQE |
| Ga0207704_111045831 | 3300025938 | Miscanthus Rhizosphere | DNGDKTNVLVITIDERDATVVQVTLSAKNLALLLKDPEGTGKSITEEATLIDQE |
| Ga0207711_119915051 | 3300025941 | Switchgrass Rhizosphere | ATVVQVALSPKNLALLLKDPEGTGKAITQEATINDQE |
| Ga0207689_115586221 | 3300025942 | Miscanthus Rhizosphere | DKFNVLVITIDPGDATVVQVTLSAKNLALLMKDPDGMGKAITDEATVVDQ |
| Ga0207679_115903801 | 3300025945 | Corn Rhizosphere | LRNAGDKYNVLVINIAERDATVVQVTVSGKNLALLLKDPEGTGKSITDEATIIDQE |
| Ga0207667_119609352 | 3300025949 | Corn Rhizosphere | TVVQVTLSAKNLALLMKDPDGMGKAITDEATVVDQ |
| Ga0207712_100636574 | 3300025961 | Switchgrass Rhizosphere | LVVTIEPHDATVVQATVSPKNLALLMKDPEEGAKAITQEATINDQE |
| Ga0207712_119999662 | 3300025961 | Switchgrass Rhizosphere | VVQVTVSSKNLALLLKDPEGTGKSITEEATIIDQE |
| Ga0207640_109679631 | 3300025981 | Corn Rhizosphere | NVLVITIDPGDATVVQVTLSAKNLALLMKDPDGMGKAITDEATVVDQ |
| Ga0207641_103004431 | 3300026088 | Switchgrass Rhizosphere | ATVVQVTLSQKNLALLLKDPEGTGKAITQEATINDQE |
| Ga0207641_108608951 | 3300026088 | Switchgrass Rhizosphere | DKTNVLVITIEGRDATVVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE |
| Ga0207676_111618001 | 3300026095 | Switchgrass Rhizosphere | SGDGEQVYIYLREAGQKFHALVITIAQRDATVVQVTLSEKNLALLLKDPEGTGKSITEEATINDQE |
| Ga0207674_113388872 | 3300026116 | Corn Rhizosphere | RNAGDKTNVLVITIEGRDATVVQVTLSAKNLALLLKDPEGTGKAITDEATLIDQE |
| Ga0207674_117704082 | 3300026116 | Corn Rhizosphere | TIDERDATVVQVTLSQKNLALLLKDPEGTGKAITEEATLIDQE |
| Ga0207674_120925221 | 3300026116 | Corn Rhizosphere | DVLVITIDARDATVVQVTLSAKNLALLLKDPEGTGKAITEEATLIDQE |
| Ga0207675_1010102812 | 3300026118 | Switchgrass Rhizosphere | TITQRDATVVQVNLSRKNLALLLKDPEGTGKSITEEATIIDQE |
| Ga0207675_1018663941 | 3300026118 | Switchgrass Rhizosphere | VVQVNLSPKNLALLLKDPEGTGKAITEEATIIDQE |
| Ga0207675_1025914131 | 3300026118 | Switchgrass Rhizosphere | LTLEPREATVIQVTLSPKNLALLIKDPEGTAREITREATIIDQE |
| Ga0208475_10136551 | 3300027018 | Soil | VVQVTLSEKNVALLLKDPEGTGKAITQEATLIDQE |
| Ga0209074_103764771 | 3300027787 | Agricultural Soil | IYLRTAGEKYHVLVITIGERDATVVQVTVSSKNLALLLKDPEGTGKSITEEATINDQE |
| Ga0268241_100951781 | 3300030511 | Soil | RDATVVQATLSPENLKLLLKDPEGTGKAITDQATIIDQE |
| Ga0310813_120185062 | 3300031716 | Soil | GDKYNVLVIAIEQREATVVQVTLSPENLKRLLKDPEGTGKAITEEATIVDQE |
| Ga0307468_1004706301 | 3300031740 | Hardwood Forest Soil | VLVITIDQRDATVVQVTLSPRNLALLLKDPEGTGKAITQEATINDQE |
| Ga0307410_106601571 | 3300031852 | Rhizosphere | FHVLVITIEQNDATVVQATLSPKNLALLLRDPEGTGKAITEEATIIDQE |
| Ga0307414_112868842 | 3300032004 | Rhizosphere | EKFNVLVITIEPHEATVVQVTLSPKNLAQLLKDPEGTAKAITQEATIIDQE |
| Ga0307414_115600552 | 3300032004 | Rhizosphere | SRDATVVQVNLSRKNLALLLKDPEGTGKSITEEATIIDQE |
| Ga0307411_112346801 | 3300032005 | Rhizosphere | KKFQVLVITIEERDATVVQATLSPKNLALLLKDPEGTGRAITQEATIIDQE |
| Ga0307411_114295752 | 3300032005 | Rhizosphere | REASAKFNVLVITIDQRDATVVQVTLSPKNLALLLKDPEGTGKSITEEATIIDQE |
| Ga0315912_107141331 | 3300032157 | Soil | RDATVVQVNLSPKNLALLMKDPEGAGKAITEEATILDQE |
| Ga0310810_111240962 | 3300033412 | Soil | DAGEKYNVLVINIAERDATVVQVTVSPTNLALLLKDPEGTGKSITEEATINDQE |
| ⦗Top⦘ |