| Basic Information | |
|---|---|
| Family ID | F059293 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYGYDHKRTEAQFETTWKELQQGLPTTGDQGFLLGVSDNKL |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 92.54 % |
| % of genes from short scaffolds (< 2000 bps) | 81.34 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.791 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.702 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.134 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.239 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF05235 | CHAD | 31.34 |
| PF02597 | ThiS | 13.43 |
| PF13620 | CarboxypepD_reg | 2.24 |
| PF13662 | Toprim_4 | 1.49 |
| PF13519 | VWA_2 | 1.49 |
| PF00753 | Lactamase_B | 0.75 |
| PF00903 | Glyoxalase | 0.75 |
| PF11918 | Peptidase_S41_N | 0.75 |
| PF14697 | Fer4_21 | 0.75 |
| PF01609 | DDE_Tnp_1 | 0.75 |
| PF11008 | DUF2846 | 0.75 |
| PF11528 | DUF3224 | 0.75 |
| PF13692 | Glyco_trans_1_4 | 0.75 |
| PF00092 | VWA | 0.75 |
| PF13091 | PLDc_2 | 0.75 |
| PF13088 | BNR_2 | 0.75 |
| PF00535 | Glycos_transf_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 31.34 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 31.34 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 13.43 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 13.43 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.75 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.75 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.75 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.79 % |
| Unclassified | root | N/A | 8.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001170|JGI12704J13340_1014978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300001180|JGI12695J13573_1008440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300001686|C688J18823_10509547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101430644 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101810391 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004091|Ga0062387_100044755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2075 | Open in IMG/M |
| 3300004633|Ga0066395_10302479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300004643|Ga0062591_101670510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300005458|Ga0070681_11991363 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005610|Ga0070763_10066357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1754 | Open in IMG/M |
| 3300005921|Ga0070766_10132681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300005921|Ga0070766_10159645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1387 | Open in IMG/M |
| 3300006041|Ga0075023_100340574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300006046|Ga0066652_101070078 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300006050|Ga0075028_100788388 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006059|Ga0075017_100917259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300006173|Ga0070716_100010026 | All Organisms → cellular organisms → Bacteria | 4738 | Open in IMG/M |
| 3300007982|Ga0102924_1166979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300009635|Ga0116117_1196711 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009643|Ga0116110_1163118 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300009683|Ga0116224_10014151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3969 | Open in IMG/M |
| 3300009683|Ga0116224_10238540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300009698|Ga0116216_10646470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009700|Ga0116217_10055760 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300009792|Ga0126374_10061220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1967 | Open in IMG/M |
| 3300009839|Ga0116223_10140607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1503 | Open in IMG/M |
| 3300010046|Ga0126384_12398201 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010322|Ga0134084_10043916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
| 3300010322|Ga0134084_10281351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300010337|Ga0134062_10389976 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010343|Ga0074044_10020313 | All Organisms → cellular organisms → Bacteria | 4810 | Open in IMG/M |
| 3300010358|Ga0126370_10508068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300010373|Ga0134128_12378711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300010401|Ga0134121_11467745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300012202|Ga0137363_10404229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300012202|Ga0137363_11535837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300012206|Ga0137380_10422869 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012349|Ga0137387_10158616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1614 | Open in IMG/M |
| 3300012683|Ga0137398_10097950 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300012923|Ga0137359_10499718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300012927|Ga0137416_10557022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 994 | Open in IMG/M |
| 3300012958|Ga0164299_11623862 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012960|Ga0164301_10127108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1517 | Open in IMG/M |
| 3300012961|Ga0164302_10650969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300012971|Ga0126369_13408213 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300013307|Ga0157372_10796321 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300014155|Ga0181524_10246425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300014156|Ga0181518_10354099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300014168|Ga0181534_10834498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300014657|Ga0181522_10207868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300014968|Ga0157379_12317560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300015262|Ga0182007_10411036 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300016387|Ga0182040_10192052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1494 | Open in IMG/M |
| 3300017938|Ga0187854_10060979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1853 | Open in IMG/M |
| 3300017961|Ga0187778_10799990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300017975|Ga0187782_10019655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4921 | Open in IMG/M |
| 3300017995|Ga0187816_10379080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300017996|Ga0187891_1234800 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300017998|Ga0187870_1160597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300018007|Ga0187805_10011110 | All Organisms → cellular organisms → Bacteria | 3794 | Open in IMG/M |
| 3300018012|Ga0187810_10011989 | All Organisms → cellular organisms → Bacteria | 3043 | Open in IMG/M |
| 3300018030|Ga0187869_10008954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6277 | Open in IMG/M |
| 3300018034|Ga0187863_10070230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1979 | Open in IMG/M |
| 3300018042|Ga0187871_10110939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1573 | Open in IMG/M |
| 3300018042|Ga0187871_10625609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300018062|Ga0187784_10276928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300018085|Ga0187772_11297223 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300018088|Ga0187771_11461129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300020581|Ga0210399_11034102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300020583|Ga0210401_10552869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300021403|Ga0210397_10354358 | Not Available | 1088 | Open in IMG/M |
| 3300021403|Ga0210397_10428120 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300021405|Ga0210387_10873162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300021420|Ga0210394_10326560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1347 | Open in IMG/M |
| 3300021433|Ga0210391_10471034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300021433|Ga0210391_10508064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300021474|Ga0210390_10003366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13718 | Open in IMG/M |
| 3300021477|Ga0210398_10319509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1266 | Open in IMG/M |
| 3300021477|Ga0210398_11505632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021560|Ga0126371_11083253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300021560|Ga0126371_12234209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300022521|Ga0224541_1007633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300022557|Ga0212123_10443791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300025412|Ga0208194_1005952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2159 | Open in IMG/M |
| 3300025928|Ga0207700_11304130 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300025929|Ga0207664_11487754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300025939|Ga0207665_10045869 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
| 3300026298|Ga0209236_1112814 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300026529|Ga0209806_1150901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300026540|Ga0209376_1174348 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300027334|Ga0209529_1010981 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300027829|Ga0209773_10144831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300027855|Ga0209693_10393646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
| 3300027875|Ga0209283_10464849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300027884|Ga0209275_10250245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300027889|Ga0209380_10117427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
| 3300027894|Ga0209068_10799751 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027905|Ga0209415_10943666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300027908|Ga0209006_10769012 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027910|Ga0209583_10146118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300028016|Ga0265354_1014311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300028651|Ga0302171_10059207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
| 3300028678|Ga0302165_10224938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300028792|Ga0307504_10013592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
| 3300030003|Ga0302172_10230423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300030399|Ga0311353_10099610 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300030524|Ga0311357_10968406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300030707|Ga0310038_10096147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1556 | Open in IMG/M |
| 3300031057|Ga0170834_112639890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300031128|Ga0170823_15442921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300031231|Ga0170824_128535058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300031681|Ga0318572_10939607 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031753|Ga0307477_10296067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1118 | Open in IMG/M |
| 3300031753|Ga0307477_10494251 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031823|Ga0307478_11454652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300031823|Ga0307478_11562015 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031946|Ga0310910_10814168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 735 | Open in IMG/M |
| 3300031962|Ga0307479_10169645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2144 | Open in IMG/M |
| 3300032180|Ga0307471_100948649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300032892|Ga0335081_10207286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2704 | Open in IMG/M |
| 3300032892|Ga0335081_10575012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300032892|Ga0335081_10730989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1195 | Open in IMG/M |
| 3300032895|Ga0335074_11259964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300033888|Ga0334792_120735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.48% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.24% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028651 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12704J13340_10149782 | 3300001170 | Forest Soil | MYGPEHKRTEAQFDTAWSELQQGLPAAGEGGFLLGVSDNKLLLDGV |
| JGI12695J13573_10084402 | 3300001180 | Forest Soil | MYGYQHKRTEAQFETTWNELKQGLPTTGDQGFLLGVS |
| C688J18823_105095472 | 3300001686 | Soil | MYGYEHKRTEGQFETTWNELANALPAGGFLLGVSDNK |
| JGI24743J22301_100698722 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | VHSLNILVKYTRLYGVGHKRTEGQFETTWAELQAAL |
| JGIcombinedJ26739_1014306441 | 3300002245 | Forest Soil | LIKYTRLYGVSHKRTEGQFQTAWNELQQALPKGGDTGFLLGVSDN |
| JGIcombinedJ26739_1018103911 | 3300002245 | Forest Soil | MYGYSHKRTEAQFEVTWNELQQGLPTTGDSGFLLGVSDNKL |
| Ga0063454_1005853572 | 3300004081 | Soil | VHSLNILIKYARMYGFDHKRTEGQFETTWNELQNALPAGGDA |
| Ga0062387_1000447552 | 3300004091 | Bog Forest Soil | MYGYDHKRTEAQFETAWNELQQALPAGGDSGFLLGVSDQKLLLD |
| Ga0066395_103024793 | 3300004633 | Tropical Forest Soil | MYGYEHKRTEAQFETTWSELQNALPSGGFLLGVSDNKLLLDGIPL |
| Ga0062591_1016705101 | 3300004643 | Soil | VHSLNILVKYTRLYGVDHKRTEGQFETTWAELQAALPKAGDSGFL |
| Ga0070681_119913631 | 3300005458 | Corn Rhizosphere | VHSLNILVKYTRLYGFDHKRTEGQFDITWNELQQGLPATGDSGFLLGCSDNKLL |
| Ga0070763_100663573 | 3300005610 | Soil | VNHKRTEGQFEGAWNELQQALPKSGDTGFLLGVSGNKLLLDGIPL |
| Ga0070766_101326812 | 3300005921 | Soil | MYGYDHKRTEAQFETTWKELQQGLPTTGDQGFLLGV |
| Ga0070766_101596451 | 3300005921 | Soil | MYGYNHKRTEAQFETTWKELQQGLPTTGDAGFLLGVSDNKLLLD |
| Ga0075023_1003405741 | 3300006041 | Watersheds | VKYTRLYGVNHKRTEGQFQVTWTELQQSLPKTGDGGFVLGVADNKL |
| Ga0066652_1010700781 | 3300006046 | Soil | VKYVRLYGFEHKRTEAQFETTWSELQQGLPKGADGNFLLGVSENKLLLDGI |
| Ga0075028_1007883882 | 3300006050 | Watersheds | VRLYGFQHKRTEGQFEVTWNELQNGLPKGTDGGFLLGVSDNRLLLDGVALE |
| Ga0075017_1009172591 | 3300006059 | Watersheds | VRLYGFEHKRTETQFETAWNELQQAVPKAGDQGFLLGVSGSTLLL |
| Ga0070716_1000100261 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYVRLYGFEHKRTETQFEVAWNELQQALPKAGEQGFLLGVSG |
| Ga0102924_11669791 | 3300007982 | Iron-Sulfur Acid Spring | MYGYEHKRTEAQFETAWNELKQGLPTTGDAGFLLG |
| Ga0116117_11967111 | 3300009635 | Peatland | MYGYEHKRTENQFEVTWNELQQGLPTAGDAGFLLGVSDNKLLL |
| Ga0116110_11631181 | 3300009643 | Peatland | LIKYTRLYGVTHKRTEGQFQTAWSELQQALPKSGDTGFLLGVADNKLLLDGIP |
| Ga0116135_13145272 | 3300009665 | Peatland | MEHRRTEAQFATTWKELQNGLPRGTEGAFLLGVSGNTLLLDGIPLETGQA |
| Ga0116224_100141511 | 3300009683 | Peatlands Soil | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGVADNKL |
| Ga0116224_102385401 | 3300009683 | Peatlands Soil | VTHKRTEGQFETAWSELQQALPKSGDTGFLLGVADNKL |
| Ga0116216_106464701 | 3300009698 | Peatlands Soil | LIKYTRLYGVTHKRTEGQFQTAWSELQQAVPKSGDTGFLLGVSDNKLLLDG |
| Ga0116217_100557601 | 3300009700 | Peatlands Soil | MYGYEHKRTEAQFEMAWNELKQGLPTTGDQGFLLGVSDNKLLLDG |
| Ga0126374_100612201 | 3300009792 | Tropical Forest Soil | MYGYDHKRTEAQFETTWNELQTALPSKSFLLGVSDNKLLLDEIPLES |
| Ga0116223_101406071 | 3300009839 | Peatlands Soil | LIKYTRLYGVTHKRTEGQFQTAWSELQQAVPKSGDTGFLLGVSDNKLLL |
| Ga0126384_123982011 | 3300010046 | Tropical Forest Soil | MYGFEHKRTEAQFETAWNELQQAIPKSGESGFLLGVSDNKLLLDGIPLDTGQAERS |
| Ga0134084_100439161 | 3300010322 | Grasslands Soil | LYGFEHTRTAGQFEITWNELQQGLPKERDGAFLLGVSENKL |
| Ga0134084_102813512 | 3300010322 | Grasslands Soil | LYGFEHKRTAGQFEITWNELQQGLPKERDGAFLLGVSENKLLLD |
| Ga0134062_103899762 | 3300010337 | Grasslands Soil | VKYVRLYGFGHKRTEGQFEITWNELQQGLPKGTDGGFLLGVSEHTLLLDG |
| Ga0074044_100203131 | 3300010343 | Bog Forest Soil | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGVADNK |
| Ga0126370_105080681 | 3300010358 | Tropical Forest Soil | MYGYDHKRTEAQFEITWNELQQGLPATGDAGFLLGVSDNKLLLDGI |
| Ga0134128_123787111 | 3300010373 | Terrestrial Soil | VHSLNILVKYTRLYGVGHKRTEGQFETTWAELQAALPKAG |
| Ga0134121_114677451 | 3300010401 | Terrestrial Soil | VHSLNILVKYTRLYGVDHKRTEGQFETTWAELQAALPKAGDS |
| Ga0137393_101047704 | 3300011271 | Vadose Zone Soil | VHSLNILVKYVRMYGFEHKRTKGQFEIAWNELQAAIPQAGD |
| Ga0137363_104042291 | 3300012202 | Vadose Zone Soil | MYGPDHKRTEAQFETAWNELQQGLPKAGDGGFLLGVS |
| Ga0137363_115358371 | 3300012202 | Vadose Zone Soil | MYGPDHKRTEAQFETAWNELQQGLPKAGDGGFLLG |
| Ga0137380_104228691 | 3300012206 | Vadose Zone Soil | MYGYEHKRTEAQFETTWKELQQGLPTTGDAGFLLG |
| Ga0137387_101586161 | 3300012349 | Vadose Zone Soil | LYGFEHKRSAGQFEITWNELQQGLPKERDGAFLLGVSENKLLL |
| Ga0137398_100979502 | 3300012683 | Vadose Zone Soil | MYGYSHKRTEAQFEVAWKELQQGLPVAGDGGFLLGVSDNMLL |
| Ga0137359_104997182 | 3300012923 | Vadose Zone Soil | LYGFEHKRTAGQFEITWNELQQGLPKERDGAFLLGVSEN |
| Ga0137416_105570221 | 3300012927 | Vadose Zone Soil | LVKYTRLYGVKHKRTEGQFDITWKELREGLPKTGDTGFL |
| Ga0164299_116238621 | 3300012958 | Soil | VHSLNILVKYTRLYGFDHKRTEGQFDITWNELQQGLPATGDSGFLL |
| Ga0164301_101271082 | 3300012960 | Soil | LNILVKYVRLYGFEHKRTETQFEVAWNELQQALPKAGEQGFLLGVSG |
| Ga0164302_106509692 | 3300012961 | Soil | MYGFDHKRTEGQFETTWNELQTALPANGDAGFLLGVSENRLLLDGIP |
| Ga0126369_134082131 | 3300012971 | Tropical Forest Soil | MYGYEHKRTEAQFEITWNELQHGLPATGDAGFLLGVSDNKL |
| Ga0157372_107963212 | 3300013307 | Corn Rhizosphere | VHSLNILVKYTRLYGFDHKRTEGQFDITWNELQQGLPATGDSGFL |
| Ga0181524_102464251 | 3300014155 | Bog | LYGVAHKRTEAQFQTTWNELKQAVPASGDTGFLLGVSGNKLLLDG |
| Ga0181518_103540991 | 3300014156 | Bog | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGVSDNKLLLDG |
| Ga0181534_108344981 | 3300014168 | Bog | MYGYEHKRTEAQFETTWNELQTALPAGGDAGFLLGVSDNKLL |
| Ga0181522_102078681 | 3300014657 | Bog | LYGTNHKRTEGQFQTAWDELQQALPKSGDTGFLLGVS |
| Ga0157379_123175601 | 3300014968 | Switchgrass Rhizosphere | VHSLNILVKYTRLYGVDHKRTEGQFETTWAELQAALPKAGDSGFLLGVS |
| Ga0182007_104110361 | 3300015262 | Rhizosphere | VKYVRLYGFDHKRTEGQFETTWAELQQSLPPGTEGSFLLGVSDNKLLLDGIPL |
| Ga0182040_101920521 | 3300016387 | Soil | MYGYEHKRTEAQFETTWSELQSALPSGGFLLGVSDNKLLL |
| Ga0187854_100609791 | 3300017938 | Peatland | LIKYTRLYGVTHKRTEGQFQTAWSELQQALPKSGDTGFLL |
| Ga0187778_107999902 | 3300017961 | Tropical Peatland | VKYVRLYGFEHKRTETQFDTSWKELQEGLPQGRDGGFLLGVSDNKLLL |
| Ga0187782_100196556 | 3300017975 | Tropical Peatland | VKYVRLYGFEHKRTEVQFDTTWKELQEGLPRGRDTGFLLGVSD |
| Ga0187816_103790801 | 3300017995 | Freshwater Sediment | VKYTRLYGVNHKRTDGQFQMTWTELQQALGGENGFLLGVS |
| Ga0187891_12348002 | 3300017996 | Peatland | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGVADNKLLLDGIPL |
| Ga0187870_11605971 | 3300017998 | Peatland | MYGYEHKRTEAQFEVAWNELQQGLPAAGDGGFLLGVSDNKLLLDGV |
| Ga0187805_100111101 | 3300018007 | Freshwater Sediment | MYGYEHKRTEAQFETTWNELKQGLPTTGDQGFLLGVSDNKLLLD |
| Ga0187810_100119891 | 3300018012 | Freshwater Sediment | MLVKYTRLYGVNHKRTEGQFQTTWNELQPAISGDTGFLLGVSDNKLLLDGIPLD |
| Ga0187869_100089541 | 3300018030 | Peatland | MYGYEHKRTEAQFEVTWNELQQGLPAAGDSGFLLGVSDNKLLLDG |
| Ga0187863_100702301 | 3300018034 | Peatland | LVKYTRLYGVTHKRTEGQFESTWKELQQALPKNSDTGF |
| Ga0187871_101109391 | 3300018042 | Peatland | LIKYTRLYGVTHKRTEGQFESTWKGLQQALPKSSDTGFLLGVSDNKLL |
| Ga0187871_106256092 | 3300018042 | Peatland | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGV |
| Ga0187784_102769281 | 3300018062 | Tropical Peatland | VHSLNILIKYARMYGYDHKRTEAQFETTWNELQQG |
| Ga0187772_100304821 | 3300018085 | Tropical Peatland | VHSLNILIKYARMYGYDHKRSEAQFETTWNELQHALPAGGENGFLLGV |
| Ga0187772_112972232 | 3300018085 | Tropical Peatland | VKYVRLYGFQHKRTEAQFDTTWKELQQGVAGRDTGFLLGVSDNKLL |
| Ga0187771_114611292 | 3300018088 | Tropical Peatland | VKYVRLYGFNHKRTETQFETTWKELQEGLPGGAEGGFLL |
| Ga0210399_110341021 | 3300020581 | Soil | VKYVRLYGFNHKRTEGQFEITWKELQQGLPGGKDGNFLLG |
| Ga0210401_105528691 | 3300020583 | Soil | VKYTRLYGVNHKRTEGQFETAWSELQQALPKGRDTGFLLGVS |
| Ga0210397_103543581 | 3300021403 | Soil | MYGFEHKRTEAQFETAWNELQQALPKGGEGGFLLGVSDNK |
| Ga0210397_104281202 | 3300021403 | Soil | MYGYSHKRTEAQFEVTWNELQQGLPTTGDSGFLLGV |
| Ga0210387_108731621 | 3300021405 | Soil | MYGYEHKRTEAQFEVAWKELQQGLPVAGEGGFLLGVSDNKLLLDGI |
| Ga0210394_103265602 | 3300021420 | Soil | VKYVRLYGFNHKRTEGQFEITWKELQQGLPGGKDGNFLL |
| Ga0210391_104710342 | 3300021433 | Soil | MYGYDHKRTEAQFEITWKELQQGLPAAGDGGFLLGVSDNKLLLDGIP |
| Ga0210391_105080642 | 3300021433 | Soil | MYGYEHKRTEAQFETTWNELKQGLPTTGDQGFLLGVSDNKLLLDG |
| Ga0210390_100033661 | 3300021474 | Soil | MYGPDHKRTEAQFETAWNELQHGLPAAGEGGFLLGVSD |
| Ga0210398_103195092 | 3300021477 | Soil | MYGYDHKRTEAQFETTWKELQQGLPTTGDQGFLLGVSDNKLL |
| Ga0210398_115056321 | 3300021477 | Soil | MYGPDHKRTEAQFETAWNELQHGLPAAGEGGFLLGV |
| Ga0126371_110832531 | 3300021560 | Tropical Forest Soil | MYGYDHKRTEAQFETTWNELQNALPGGGFLLGVSDNKLLLDGIPLESG |
| Ga0126371_122342092 | 3300021560 | Tropical Forest Soil | MYGYEHKRTEAQFETTWSELQSALPSGGFLLGVSDNKLLLDGI |
| Ga0224541_10076332 | 3300022521 | Soil | MYGPDHKRTEAQFETAWNELQNGLPTAGEGGFLLGVSDNKL |
| Ga0212123_104437912 | 3300022557 | Iron-Sulfur Acid Spring | MYGYEHKRTEAQFETAWNELKQGLPTTGDAGFLLGVSD |
| Ga0208194_10059521 | 3300025412 | Peatland | LVKYTRLYGVTHKRTEGQFETTWKELQEALPKSNDT |
| Ga0207663_112669362 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VHSLNILIKYARMYGFDHKRTEGQFETTWNELQTALP |
| Ga0207700_113041301 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MYGYSHKRTEAQFEVTWSELQQGLPTTGDSGFLLGVSDNKL |
| Ga0207664_112588011 | 3300025929 | Agricultural Soil | VHSLNILIKYARMYGFDHKRTEGQFETTWNELQTALPAG |
| Ga0207664_114877541 | 3300025929 | Agricultural Soil | VKYVRLYGFEHKRTETQFEIAWNELQQALPKAGDQGFLLGVSGNKLLL |
| Ga0207665_100458691 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYVRLYGFEHKRTETQFEVAWNELQQALPKAGEQGFLLGVSGTK |
| Ga0207665_104076681 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYVRLYGFGHKRTEGQFEITWNELQQGLPKGTDG |
| Ga0207674_113324752 | 3300026116 | Corn Rhizosphere | VHSLNILIKYARMYGFDHKRTEGQFETTWNELQTALPAGA |
| Ga0209236_11128142 | 3300026298 | Grasslands Soil | VKYVRLYGFEHKRTEAQFETTWSELQQGLPKGADGNFLL |
| Ga0209806_11509012 | 3300026529 | Soil | VKYVRLYGFDHKRTAGQFATAWKELQNGLPSAGESGFLLGVSGSKLL |
| Ga0209376_11743482 | 3300026540 | Soil | VKYVRLYGFEHKRTEAQFETTWSELQQGLPKGADGNFLLGVS |
| Ga0209529_10109813 | 3300027334 | Forest Soil | MYGYTHKRTEAQFETTWKELQQGLPTTGDAGFLLGV |
| Ga0209773_101448312 | 3300027829 | Bog Forest Soil | VKYVRLYGSQHKRTEGQFEVTWNELQHGLPESGFLLGVS |
| Ga0209693_103936462 | 3300027855 | Soil | VKYVRLYGFQHKRTEGQFEVTWNELQHGLPDSGFLLGVSENRLLL |
| Ga0209283_104648491 | 3300027875 | Vadose Zone Soil | LIKYTRLYGVNHKRTVGQFETAWSELQQALPKTGDTGFLLGVSDNKLLLDG |
| Ga0209275_102502451 | 3300027884 | Soil | VKYVRLYGFNHKRTEGQFEITWKELQQGLPGGKDGNFLLGVSENRL |
| Ga0209380_101174272 | 3300027889 | Soil | MYGYDHKRTEAQFETTWKELQQGLPTTGDQGFLLGVSDNKL |
| Ga0209068_107997512 | 3300027894 | Watersheds | VRLYGFQHKRTEGQFEVTWNELQNGLPKGSDGGFLLGVSDNRLLLDGVALESG |
| Ga0209415_106904861 | 3300027905 | Peatlands Soil | VHSLNILIKYARMYGPDHKRTEAQFETTWRELQQGLPTAGEG |
| Ga0209415_109436661 | 3300027905 | Peatlands Soil | VKYVRLYGFNHKRTEGQFEITWKELQLGLPSGRDGNFLLGVSENRLL |
| Ga0209006_107690121 | 3300027908 | Forest Soil | MYGYDHKRTEAQFEITWNELQQGLPTTGDSGFLLGVSDNKLLLDGIP |
| Ga0209583_101461182 | 3300027910 | Watersheds | VKYVRLYGSDHKRTEGQFAIAWNELQEGLPKGTEGSFLLGVSENKLLLDGI |
| Ga0265354_10143112 | 3300028016 | Rhizosphere | MYGYEHKRTEAQFETTWNELQNGLPTAGDAGFLLGVSD |
| Ga0302171_100592071 | 3300028651 | Fen | VKYTRLYGVNHKRTDGQFQVTWTELQQSLPKTGDG |
| Ga0302165_102249381 | 3300028678 | Fen | VKYTRLYGVKHKRTEGQFQITWKELQDGLPKTGETGFLLGVA |
| Ga0307504_100135923 | 3300028792 | Soil | MYGYEHKRTESQFETTWNELANALPAGGFLLGVSDNKLLLDGIPLES |
| Ga0302172_102304232 | 3300030003 | Fen | VKYTRLYGVKHKRTEGQFQITWKELQDGLPKTGETGFLLGVADNRL |
| Ga0311353_100996101 | 3300030399 | Palsa | LVKYTRLYGVTHKRTEGQFNTAWNELQQALPKSGDTGFL |
| Ga0311357_109684061 | 3300030524 | Palsa | MYGPDHKRTEAQFETAWNELRNGLPAAGEGGFLLG |
| Ga0310038_100961471 | 3300030707 | Peatlands Soil | VTHKRTEGQFETAWSELQQALPKSGDTGFLLGVADNKLL |
| Ga0170834_1126398902 | 3300031057 | Forest Soil | MYGYGHKRTEAQFEITWKELQQGLPTTGDQGFLLGVS |
| Ga0170823_154429211 | 3300031128 | Forest Soil | LIKYTRLYGTNHKRTEGQFQTAWSELQHALPKSGDTGFLLGVSDNK |
| Ga0170824_1285350581 | 3300031231 | Forest Soil | MYGPDHKRTEAQFEVTWNELQQGLPAAGEGGFLLGVSD |
| Ga0318572_109396072 | 3300031681 | Soil | MYGFDHKRTEGQFETAWNELQQALPKSGEGGFLLGVSDNKLLLD |
| Ga0307477_102960672 | 3300031753 | Hardwood Forest Soil | MYGPEHKRTEAQFEIAWKELQQGLPSAGEGGFLLGVSDNKLLLD |
| Ga0307477_104942512 | 3300031753 | Hardwood Forest Soil | MYGYAHKRTEAQFETTWKELKQGLPTTGDQGFLLGVSDNK |
| Ga0307478_114546522 | 3300031823 | Hardwood Forest Soil | VKYVRLYGFEHKRTESQFETAWNELQQAVPKAGEQGFLLGVSGN |
| Ga0307478_115620152 | 3300031823 | Hardwood Forest Soil | MYGYDHKRTEAQFEITWNELQQGLPTTGDSGFLLGVSDNKLLL |
| Ga0310910_108141682 | 3300031946 | Soil | MYGSDHKRTEAQFETTWNELANALPGGGFLLGVSDNK |
| Ga0307479_101696453 | 3300031962 | Hardwood Forest Soil | VHSLNILIKYARMYGYQHKRTEAQFETTWNELKQGLPTTGDQG |
| Ga0307471_1009486492 | 3300032180 | Hardwood Forest Soil | LIKYTRLYGVNHKRTVGQFETAWSELQQALPKTGDTG |
| Ga0335081_102072861 | 3300032892 | Soil | VKYVRLYGFEHKRTEVQFDTSWKELQEGLPQGRDGGFLL |
| Ga0335081_105750121 | 3300032892 | Soil | MYGYDHKRTEAQFETTWKELQNALPAGGDSGLLLGVS |
| Ga0335081_107309891 | 3300032892 | Soil | MYGYDHKRTETQFEVTWNELQSALPAGGEGGFLLG |
| Ga0335074_112599642 | 3300032895 | Soil | VKYVRLYGFTHKRTESQFETTWKELQQGLPKGSEGGFLLGVIDNKLLLDGVQLEA |
| Ga0334792_120735_1_132 | 3300033888 | Soil | LIKYTRLYGVTHKRTEGQFETAWSELQQALPKSGDTGFLLGVAD |
| ⦗Top⦘ |