Basic Information | |
---|---|
Family ID | F059288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 39 residues |
Representative Sequence | GLRQALLQQKRDYDAGFVQKQFESSWKGGAQALKLDDLV |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.03 % |
% of genes near scaffold ends (potentially truncated) | 90.30 % |
% of genes from short scaffolds (< 2000 bps) | 90.30 % |
Associated GOLD sequencing projects | 115 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.060 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.925 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.866 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.284 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF01653 | DNA_ligase_aden | 28.36 |
PF13302 | Acetyltransf_3 | 23.13 |
PF03120 | DNA_ligase_OB | 2.99 |
PF08323 | Glyco_transf_5 | 2.24 |
PF07690 | MFS_1 | 2.24 |
PF12826 | HHH_2 | 1.49 |
PF16396 | DUF5005 | 1.49 |
PF03331 | LpxC | 0.75 |
PF07519 | Tannase | 0.75 |
PF12852 | Cupin_6 | 0.75 |
PF04371 | PAD_porph | 0.75 |
PF13673 | Acetyltransf_10 | 0.75 |
PF13683 | rve_3 | 0.75 |
PF07638 | Sigma70_ECF | 0.75 |
PF00753 | Lactamase_B | 0.75 |
PF02146 | SIR2 | 0.75 |
PF01370 | Epimerase | 0.75 |
PF07969 | Amidohydro_3 | 0.75 |
PF07978 | NIPSNAP | 0.75 |
PF13620 | CarboxypepD_reg | 0.75 |
PF00301 | Rubredoxin | 0.75 |
PF03576 | Peptidase_S58 | 0.75 |
PF04120 | Iron_permease | 0.75 |
PF03795 | YCII | 0.75 |
PF13432 | TPR_16 | 0.75 |
PF06841 | Phage_T4_gp19 | 0.75 |
PF03693 | ParD_antitoxin | 0.75 |
PF14520 | HHH_5 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 31.34 |
COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 2.24 |
COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 2.24 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.49 |
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG2957 | Agmatine/peptidylarginine deiminase | Amino acid transport and metabolism [E] | 0.75 |
COG3609 | Transcriptional regulator, contains Arc/MetJ-type RHH (ribbon-helix-helix) DNA-binding domain | Transcription [K] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.06 % |
Unclassified | root | N/A | 11.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig07270 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300000789|JGI1027J11758_12653314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300001545|JGI12630J15595_10094129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 589 | Open in IMG/M |
3300001593|JGI12635J15846_10160799 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300001593|JGI12635J15846_10796224 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005293|Ga0065715_10662125 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005332|Ga0066388_108699689 | Not Available | 504 | Open in IMG/M |
3300005434|Ga0070709_11379497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
3300005436|Ga0070713_100284057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1519 | Open in IMG/M |
3300005537|Ga0070730_10000076 | All Organisms → cellular organisms → Bacteria | 125057 | Open in IMG/M |
3300005540|Ga0066697_10194205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1206 | Open in IMG/M |
3300005542|Ga0070732_10856744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
3300005554|Ga0066661_10411635 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005559|Ga0066700_10262474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1210 | Open in IMG/M |
3300005560|Ga0066670_10910189 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005563|Ga0068855_100175995 | All Organisms → cellular organisms → Bacteria | 2421 | Open in IMG/M |
3300005610|Ga0070763_10525783 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300005840|Ga0068870_10039453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2444 | Open in IMG/M |
3300005994|Ga0066789_10505740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
3300006028|Ga0070717_10817770 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300006050|Ga0075028_100494961 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300006052|Ga0075029_100046075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2516 | Open in IMG/M |
3300006173|Ga0070716_100157067 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300006173|Ga0070716_101075196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
3300006893|Ga0073928_10512312 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300006954|Ga0079219_11823484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
3300009038|Ga0099829_10493450 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300009177|Ga0105248_12460204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300009645|Ga0116106_1162832 | Not Available | 712 | Open in IMG/M |
3300009700|Ga0116217_10321985 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300009792|Ga0126374_10539557 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300009792|Ga0126374_10931615 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300010043|Ga0126380_10140552 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300010048|Ga0126373_11393051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300010159|Ga0099796_10380686 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300010339|Ga0074046_10782407 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300010343|Ga0074044_10462020 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300010359|Ga0126376_10349122 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300010360|Ga0126372_13124792 | Not Available | 514 | Open in IMG/M |
3300010361|Ga0126378_12774847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300010366|Ga0126379_11299214 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300010366|Ga0126379_12834325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300010371|Ga0134125_11095544 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300010375|Ga0105239_13369751 | Not Available | 520 | Open in IMG/M |
3300010376|Ga0126381_101459600 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300010376|Ga0126381_102540768 | Not Available | 734 | Open in IMG/M |
3300010376|Ga0126381_104967375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300010866|Ga0126344_1319814 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300011269|Ga0137392_10458452 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300011271|Ga0137393_10182079 | Not Available | 1767 | Open in IMG/M |
3300012203|Ga0137399_11047099 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300012205|Ga0137362_11545668 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300012206|Ga0137380_11728082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300012207|Ga0137381_10217758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1656 | Open in IMG/M |
3300012211|Ga0137377_11472261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300012285|Ga0137370_10037581 | All Organisms → cellular organisms → Bacteria | 2551 | Open in IMG/M |
3300012285|Ga0137370_10082043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1790 | Open in IMG/M |
3300012357|Ga0137384_10306601 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300012363|Ga0137390_10130069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2496 | Open in IMG/M |
3300012582|Ga0137358_10917071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300012685|Ga0137397_10195992 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300012923|Ga0137359_11249824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012929|Ga0137404_10273889 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300012929|Ga0137404_10618443 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300012930|Ga0137407_11882784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300012930|Ga0137407_12178256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300012960|Ga0164301_10719412 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300013102|Ga0157371_11546653 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300013105|Ga0157369_11696943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300013308|Ga0157375_12565832 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300016404|Ga0182037_11476706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300017943|Ga0187819_10847325 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300017959|Ga0187779_10539377 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300017999|Ga0187767_10017414 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300018007|Ga0187805_10586485 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300018044|Ga0187890_10391655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300020580|Ga0210403_10093506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2434 | Open in IMG/M |
3300020581|Ga0210399_11058355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 651 | Open in IMG/M |
3300020583|Ga0210401_11413724 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300021088|Ga0210404_10607741 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300021171|Ga0210405_11011421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300021362|Ga0213882_10327050 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300021401|Ga0210393_11104873 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300021406|Ga0210386_11515723 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300021432|Ga0210384_11437469 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300021478|Ga0210402_10381584 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300021478|Ga0210402_11235242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300022731|Ga0224563_1000620 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300025898|Ga0207692_10758380 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300025906|Ga0207699_10701765 | Not Available | 741 | Open in IMG/M |
3300025911|Ga0207654_10208491 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300025912|Ga0207707_11282464 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300025914|Ga0207671_10692561 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300025920|Ga0207649_11362821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300025941|Ga0207711_11624151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300026498|Ga0257156_1044318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 911 | Open in IMG/M |
3300026551|Ga0209648_10568521 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300027905|Ga0209415_10601603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300027910|Ga0209583_10141325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300027911|Ga0209698_10130224 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300028047|Ga0209526_10013041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5740 | Open in IMG/M |
3300028380|Ga0268265_11481585 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300028775|Ga0302231_10403998 | Not Available | 576 | Open in IMG/M |
3300028779|Ga0302266_10191310 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300030053|Ga0302177_10242633 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300030972|Ga0075400_10571015 | Not Available | 508 | Open in IMG/M |
3300031231|Ga0170824_118960387 | Not Available | 657 | Open in IMG/M |
3300031241|Ga0265325_10533586 | Not Available | 508 | Open in IMG/M |
3300031446|Ga0170820_11310335 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300031469|Ga0170819_14769050 | Not Available | 886 | Open in IMG/M |
3300031474|Ga0170818_102671043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1482 | Open in IMG/M |
3300031679|Ga0318561_10505787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300031715|Ga0307476_11050861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300031715|Ga0307476_11321167 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300031754|Ga0307475_11323188 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300031781|Ga0318547_10318868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 946 | Open in IMG/M |
3300031820|Ga0307473_10497000 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300031912|Ga0306921_10407714 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
3300031912|Ga0306921_11932617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 630 | Open in IMG/M |
3300031962|Ga0307479_11042093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 786 | Open in IMG/M |
3300032055|Ga0318575_10683184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300032160|Ga0311301_12080553 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300032180|Ga0307471_101427510 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300032205|Ga0307472_100407726 | Not Available | 1139 | Open in IMG/M |
3300032261|Ga0306920_101317229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
3300032783|Ga0335079_10833919 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300032828|Ga0335080_11257072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300032955|Ga0335076_11727425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300033158|Ga0335077_10511655 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300033290|Ga0318519_10578391 | Not Available | 681 | Open in IMG/M |
3300034124|Ga0370483_0003693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4166 | Open in IMG/M |
3300034124|Ga0370483_0009425 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.99% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.49% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.49% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.49% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.75% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.75% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0270.00000850 | 2166559005 | Simulated | LFGLQQALKAQGKEYDAGFVQKQLQASWKGGSTQLKLDDLV |
JGI1027J11758_126533142 | 3300000789 | Soil | ALKKQGRDYDAGFVEKQFNAAWKGGAGALKMADLV* |
JGI12630J15595_100941292 | 3300001545 | Forest Soil | LQQVLKAQGKNYDAGFVEKQFQASWKGGSTQLKMEDLV* |
JGI12635J15846_101607991 | 3300001593 | Forest Soil | FGLHQALKAEKRDYDAGFIQKQFDASWKGGAAQPLKLEDLV* |
JGI12635J15846_107962242 | 3300001593 | Forest Soil | SLWGLHQALLQQKKEYDAGFVQKQFDSSWKGGSQALELDDLV* |
Ga0065715_106621252 | 3300005293 | Miscanthus Rhizosphere | GLREALKAQKRDYDAGFIQKQFEASWKGTGPALQMGDLV* |
Ga0066388_1086996891 | 3300005332 | Tropical Forest Soil | GLQQALKAQRKEYDASFVQKQLQTSWKGGSAQLKLDDLV* |
Ga0070709_113794971 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RSLFGLMETLKKQGRTYDAGFVENQFHTSWKGTPLKLADLV* |
Ga0070713_1002840573 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SLWGLRQALLQQKRDYDAGFVQKQFETSWKGGAQALKLDDLV* |
Ga0070730_1000007648 | 3300005537 | Surface Soil | LLQQKRDYDAEFVKKQFDAQWKGAPQSLKLDDLV* |
Ga0066697_101942053 | 3300005540 | Soil | LQQALKAQKRDYDAGFVQKQFAGSWKGAGEKLRVEDLV* |
Ga0070732_108567441 | 3300005542 | Surface Soil | QALLQQKRDYDAGFVQKQFDASWKGGPAALKLDDLV* |
Ga0066661_104116352 | 3300005554 | Soil | LFGLQQALKAQGKEYDAGFVQKQLQASWKGGSTQLKLDDLV* |
Ga0066700_102624742 | 3300005559 | Soil | LFGLQQALKAQGKEYDAGFVQKQLQASWKGRNTQLKPDDLV* |
Ga0066670_109101892 | 3300005560 | Soil | ALKAQKRDYDAGFIQKQFQASWKGGSTQLKMEDLV* |
Ga0068855_1001759954 | 3300005563 | Corn Rhizosphere | LREALKAQKRDYDAGFIQKQFEASWKGTGPALQMGDLV* |
Ga0070763_105257831 | 3300005610 | Soil | ALLQQKRGYDAGFVQKEFEASWKGGAEALKLDDLV* |
Ga0068870_100394531 | 3300005840 | Miscanthus Rhizosphere | GLEQALKAQKRDYDAAFVQKRFRASWKGGAVPLKVEDLV* |
Ga0066789_105057401 | 3300005994 | Soil | NPRSLWGLHQALLQQHRDYDAGFIKSQFDASWKGERSSLKLDDLV* |
Ga0070717_108177701 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | HQALKAEKRDYDAGFIQKEFDGSWKGGAAQPLKLDDLV* |
Ga0075028_1004949611 | 3300006050 | Watersheds | HQSLLQQKREYDAGFVKKQFDSAWKGGATALKVDDLV* |
Ga0075029_1000460753 | 3300006052 | Watersheds | LFGLQQSLLQQKRDYDAGFVRKQLDASWKGSPQVLKLDDLV* |
Ga0070716_1001570672 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SLFGLQQALEAQGKEYDAAFVQKQLQSSWKGGSTQLKLDDLV* |
Ga0070716_1010751961 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ALKAQKRDYDAGFVRKQFQASWKGGPVKLKMEDLV* |
Ga0073928_105123122 | 3300006893 | Iron-Sulfur Acid Spring | HEALKTQKRDYDAGFVQKQFQAAWKGGPAKLKVADLV* |
Ga0079219_118234841 | 3300006954 | Agricultural Soil | LKAQKRDYDAQFVQKQFQASWKGGPSQLRVEDLV* |
Ga0099829_104934501 | 3300009038 | Vadose Zone Soil | LFGLEATLKAQKRDYDAAFVQKRFQASWKGGPGKLKVDDLV* |
Ga0105248_124602042 | 3300009177 | Switchgrass Rhizosphere | SLFGLEAALKAQKRDYDAGFVQKQFQAAWKGGPLNLKVDDLV* |
Ga0116106_11628323 | 3300009645 | Peatland | WGLHQVLLQQKRDYDAGFVQNEFEASWKGGSHTLKLDDLV* |
Ga0116217_103219853 | 3300009700 | Peatlands Soil | LRQALLQQKREYDAGFVHKQFESSWKGQALKLDDLA* |
Ga0126374_105395573 | 3300009792 | Tropical Forest Soil | LQQTLKKQGREYDASFVQKQFDASWKGGANTLKMEDLV* |
Ga0126374_109316152 | 3300009792 | Tropical Forest Soil | LVEALKKQGRDYDAGFVQKQFKSSWKGGTTTLKLDDLV* |
Ga0126380_101405521 | 3300010043 | Tropical Forest Soil | QALLKQQRDYDAGFVKKQLDASWKGSTQPLKLDDLV* |
Ga0126373_113930513 | 3300010048 | Tropical Forest Soil | KQALLQQKRDYDAGFVQKQFEDSWKGGAQALKLDALV* |
Ga0099796_103806862 | 3300010159 | Vadose Zone Soil | HQALLQQKRAYDAGYIQKQFEASWKGGAQALKVDDLV* |
Ga0074046_107824072 | 3300010339 | Bog Forest Soil | LHQALLQQKRGYDAGFVQKQFEASWKGGVQALKLDDLV* |
Ga0074044_104620201 | 3300010343 | Bog Forest Soil | RSLWGLRQALLQQKRAYDAGFVQKAFEASWKGGAQVLKLDDLV* |
Ga0126376_103491222 | 3300010359 | Tropical Forest Soil | LQQALKAQGKEYDAGFVQKQLQDSWKGKGGSTQLKLDDLV* |
Ga0126372_131247921 | 3300010360 | Tropical Forest Soil | QALKVQGRDYDAQFVEKQFRDYWDGGSLTLKVESLV* |
Ga0126378_127748471 | 3300010361 | Tropical Forest Soil | GLRQSLLQQKREYDAGFVQKQFESSWKGGALALKLDDLV* |
Ga0126379_112992142 | 3300010366 | Tropical Forest Soil | LFGLQQALLKQQRDYDAGFVKKQLDASWKGSTQPLKLDDLV* |
Ga0126379_128343252 | 3300010366 | Tropical Forest Soil | GLHESLKMQGREYDAGFVESEFKSSWKGSAALKVDDLV* |
Ga0134125_110955442 | 3300010371 | Terrestrial Soil | RSLFGLEQALKAQKRDYDAAFVQKRFRASWKGGTVPLKVEDLV* |
Ga0105239_133697512 | 3300010375 | Corn Rhizosphere | RSLFGLQQALKAQGKEYDAGFVEKQLQAAWKGGSTQLKLDDLV* |
Ga0126381_1014596001 | 3300010376 | Tropical Forest Soil | LEQSLLQQKRDYDAGFVRKQLDTSWKGSPQSLKLDDLV* |
Ga0126381_1025407681 | 3300010376 | Tropical Forest Soil | LFGLQQALKVQGRDYDAQFVEKQFRDYWDGGSLTLKVESLV* |
Ga0126381_1027112672 | 3300010376 | Tropical Forest Soil | ALRAQGKDYDAGFVQKQFEASWKGENSSLRMNDLI* |
Ga0126381_1049673752 | 3300010376 | Tropical Forest Soil | LLKQKRDYDAGFVKKQLDASWKGTTQALKLDDLV* |
Ga0126344_13198141 | 3300010866 | Boreal Forest Soil | QALLQQKRDYDAGFIQKQFEGSWKGGAPALTLDDLV* |
Ga0137392_104584523 | 3300011269 | Vadose Zone Soil | LHQALMEQKREYDAGFIQKQFESSWKGGSGSLKLEDLV* |
Ga0137393_101820791 | 3300011271 | Vadose Zone Soil | HQALLQQKRGYDAGFVEKQFESSWKGGSQALKLDDLV* |
Ga0137399_110470991 | 3300012203 | Vadose Zone Soil | LKAEKRDYDAGFIQKQFDASWKGAAGQGLKLEDLV* |
Ga0137362_115456682 | 3300012205 | Vadose Zone Soil | WGLHQTLLQQKRGYDAGFVQKQFESSWKGGTQALKLDDLV* |
Ga0137380_117280821 | 3300012206 | Vadose Zone Soil | LWGLRQALLLEKREYDAGFVQKQFDASWKGGARALKLDDLV* |
Ga0137381_102177581 | 3300012207 | Vadose Zone Soil | SLFGLQQALKAQGKEYDAGFVEKQLQASWKGSTQLKLDDLV* |
Ga0137377_114722611 | 3300012211 | Vadose Zone Soil | EQALKAQKRDYDAGFVEKQFRESWKGGNIPLKVADL* |
Ga0137370_100375811 | 3300012285 | Vadose Zone Soil | YHPRNPRALFGLQLALKAQKRDYDAGFVEKQFQSSWKGGNTQLKVADL* |
Ga0137370_100820432 | 3300012285 | Vadose Zone Soil | FGLQEALKAQGKEYDAGFVHKELQSSWKGGATQLKLDDLV* |
Ga0137384_103066011 | 3300012357 | Vadose Zone Soil | MQQALQAQGKEYDAGFVQKQLHSSWKGGSTQLKLDDLV* |
Ga0137390_101300692 | 3300012363 | Vadose Zone Soil | LKAEKRDYDAGFIQKQFDASWKGGAAQPLKLDDLV* |
Ga0137358_109170711 | 3300012582 | Vadose Zone Soil | RSLFGLQQALKAQGKEYDAGFVQKQLQTSWKGGSTKLKLDDLV* |
Ga0137397_101959921 | 3300012685 | Vadose Zone Soil | HPRNPRALFGLEAALKAQKRDYDAAFVQKRFQAAWKGGPAKLKVDDLV* |
Ga0137359_112498242 | 3300012923 | Vadose Zone Soil | RSLFGFQQALKAQKRDYDAGFVEKQFQASWKGGNTQLKVADL* |
Ga0137404_102738892 | 3300012929 | Vadose Zone Soil | GLQQALKAQKRDYDAGFVEKQFQASWKGGNTQLKVADL* |
Ga0137404_106184432 | 3300012929 | Vadose Zone Soil | ALKAQKRDYDAGFVEKQFQASWKGGDTQLKVADL* |
Ga0137407_118827841 | 3300012930 | Vadose Zone Soil | FGLQQALKAQKRDYDAGFVGKQFQASWKGGNTQLKLADL* |
Ga0137407_121782561 | 3300012930 | Vadose Zone Soil | LKAQKRDYDAAFVQKRFQASWKGGPAKLKVDDLV* |
Ga0164301_107194123 | 3300012960 | Soil | EALRREKRDYDAQFVDKQFQTSWKGGALRVEDLV* |
Ga0157371_115466532 | 3300013102 | Corn Rhizosphere | LFGLREALKAQKRDYDAGFIQKQFEASWKGTGPALQMGDLV* |
Ga0157369_116969432 | 3300013105 | Corn Rhizosphere | REALKAQKRDYDAGFIQKQFEASWKGTGPALQMGDLV* |
Ga0157375_125658322 | 3300013308 | Miscanthus Rhizosphere | GLEEALKAQKRDYDAGFVRKQFQASWKGGPVKLKVEDLV* |
Ga0182037_114767063 | 3300016404 | Soil | SLFGLHETLIRQKREYDAWFIKKQFDASWKGGAQNLKLEDLL |
Ga0182038_107402091 | 3300016445 | Soil | ALKAQGKDYDAGFVQKEFEASWKGETSSLKVEDLV |
Ga0187819_108473251 | 3300017943 | Freshwater Sediment | FGLQQALLLQKRDYDAGFVQKQFDASWKGGPQALKLDDLM |
Ga0187779_105393771 | 3300017959 | Tropical Peatland | QALLEQKRDYDAGFVQKQFEAAWKGSPQALKLDDLV |
Ga0187767_100174141 | 3300017999 | Tropical Peatland | GLRQALLEQKRDYDAGFVQKQFEAAWKGSPQALKLDDLV |
Ga0187805_105864852 | 3300018007 | Freshwater Sediment | SLLQQKRDYDAGFVQKEFDTSWKGGAAQPLKLDDLV |
Ga0187890_103916551 | 3300018044 | Peatland | WGLRQALLLEKREYDAGFVQKQFEASWKGGTEVLKLDDLV |
Ga0210403_100935061 | 3300020580 | Soil | GLRQALLQQKRDYDAGFVQKQFESSWKGGAQALKLDDLV |
Ga0210399_110583552 | 3300020581 | Soil | ALKAQGKEYDAGFVQKQFQASWKGGSTQLKLDDLV |
Ga0210401_114137241 | 3300020583 | Soil | WGLRQALLQQKRDYDAGFVQKQFEASWKGGPEALKLDDLV |
Ga0210404_106077411 | 3300021088 | Soil | NPRSLWGLRQALLQQKRDYDAGFVQKQFEASWKGGPEALKLDDLV |
Ga0210405_110114212 | 3300021171 | Soil | NPRSLWGLHQALMQQKRGYDAGFIQKEFEASWKGGSGELKVEDLV |
Ga0213882_103270502 | 3300021362 | Exposed Rock | WQALKAQGRDYDAAFVDRQFSAAWKGGSKQLRVEDLV |
Ga0210393_111048732 | 3300021401 | Soil | ALLKQKRDYDAGFVQKQFEAAWKGGAVALKLDDLV |
Ga0210386_115157231 | 3300021406 | Soil | WGLHQALLQQKRDYDAGFIQKQFEGSWKGGAPALKLDDLV |
Ga0210384_114374691 | 3300021432 | Soil | QQALLLEKRDYDAGFVQKQLETSWKGGAQALKLDDLV |
Ga0210402_103815842 | 3300021478 | Soil | RSLFGLRQSLLKQKKDYDAGFVQKQFESNWKGGPQALKLDDLV |
Ga0210402_112352421 | 3300021478 | Soil | SLWGLRQALLQQKRDYDAGFVQKQFETSWKGGAQALKLDDLV |
Ga0224563_10006203 | 3300022731 | Soil | LHQALLQQKREYDAGFIQKQFETSWKGGAEGLKLDDLV |
Ga0207692_107583801 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ALEAQGKEYDAAFVQKQLQSSWKGGSTQLKLDDLV |
Ga0207699_107017653 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GLQQALKAQGKKYDAGFLEKQLQTSWKGGSTQLKLDDLV |
Ga0207654_102084912 | 3300025911 | Corn Rhizosphere | LFGLREALKAQKRDYDAGFIQKQFDASWKGTGPALQMGDLV |
Ga0207707_112824641 | 3300025912 | Corn Rhizosphere | FGLEQALKAQKRDYDAASVQKRFRASWKGGAMPLKVEDLV |
Ga0207671_106925611 | 3300025914 | Corn Rhizosphere | GLQQALEAQGKEYDAAFVQKQLQSSWKGGSTQLKLDDLV |
Ga0207649_113628211 | 3300025920 | Corn Rhizosphere | FGLREALKAQKRDYDAGFIQKQFDASWKGTGPALQMGDLV |
Ga0207711_116241512 | 3300025941 | Switchgrass Rhizosphere | LFGLEAALKAQKRDYDAGFVQKQFQAAWKGGPLNLKVDDLV |
Ga0257156_10443182 | 3300026498 | Soil | NPRSLFGLQLALKAQGKEYDAGFVQKQLQASWKGGSTQLKLDDLI |
Ga0209648_105685212 | 3300026551 | Grasslands Soil | LFGLHQSLMEQKRDYDAGFIQKQFDSSWKGGSGALKLEDLV |
Ga0209415_106016031 | 3300027905 | Peatlands Soil | RQALLQQKRAYDAGFVQKEFEASWKGGTQVLKLDDLV |
Ga0209583_101413253 | 3300027910 | Watersheds | GLHQALKVQGRDYDAGFVEKQFQASWKGGSAQLKLEDLV |
Ga0209698_101302241 | 3300027911 | Watersheds | LHESLKAQKLDYDAGFVQKQFQAAWKGSTQLKVEDLV |
Ga0209526_100130415 | 3300028047 | Forest Soil | LQQVLKAQGKNYDAGFVEKQFQASWKGGSTQLKMEDLV |
Ga0268265_114815851 | 3300028380 | Switchgrass Rhizosphere | RSLFGLEQALKAQKRDYDAAFVQKRFQASWKGGALPLKVEDLV |
Ga0302231_104039981 | 3300028775 | Palsa | GLRQALLQQKREYDAGFIQREFEASWKGGAHLLKLDDLV |
Ga0302266_101913102 | 3300028779 | Bog | QALLQQKREYDAGFVQKEFEASWKSGTQALKLDDLV |
Ga0302177_102426331 | 3300030053 | Palsa | LYQVLLQQKREYDAGFVQKEFEASWKGGSQTLKLDDLV |
Ga0075400_105710152 | 3300030972 | Soil | LQQALKAQGKEYDAGFVEKQLQASWKGGSTQLKLDDLV |
Ga0170824_1189603871 | 3300031231 | Forest Soil | IGLQHALKAQGKEYDAGFVQKQLQASWKGGSTQLKLDDLV |
Ga0265325_105335862 | 3300031241 | Rhizosphere | LWGLHQTLLQEKRDYDAGFVQKQFEASWKGGPTALKLDDLV |
Ga0170820_113103352 | 3300031446 | Forest Soil | WGLRQTLLQQKRDYDAGFVQKQFETSWKGGAQALKLDDLV |
Ga0170819_147690502 | 3300031469 | Forest Soil | QLALKAQGNAYDAGFVEKQLQSSWKGGSTRLKLDDLV |
Ga0170818_1026710431 | 3300031474 | Forest Soil | PRSLWGLRQALLQQKRDYDAGFVQKQFESSWKGGAQALKLDDLV |
Ga0318561_105057871 | 3300031679 | Soil | LHETLIRQKREYDAWFIKKQFDASWKGGAQNLKLEDLL |
Ga0307476_110508612 | 3300031715 | Hardwood Forest Soil | RSLWGLRQALLQQKRAYDAGFVQKEFEGSWKGGARALKLDDLV |
Ga0307476_113211671 | 3300031715 | Hardwood Forest Soil | PRSLWGLHQALLEQKRGYDAGFVQKQFESSWRGASGTLKLDDLV |
Ga0307475_113231882 | 3300031754 | Hardwood Forest Soil | SLFGLQQSLLQQKRDYDAGFVKKQLDTSWKSSSHVLKLDDLV |
Ga0318547_103188681 | 3300031781 | Soil | LWGLRQSLLQQKRDYDAGFVQSQFEASWKGAEELKLDDLV |
Ga0307473_104970002 | 3300031820 | Hardwood Forest Soil | RTLFGLEAALKAQKRDYDAAFVQKRFQASWKGGPAKLKVDDLV |
Ga0306921_104077141 | 3300031912 | Soil | SLLQQKRDYDAGFVRKQLDTSWKGSPQSLKLDDLV |
Ga0306921_119326171 | 3300031912 | Soil | GLQQALKAQKRDYDAQFVGTQFQASWKGPQGGLTLEDLV |
Ga0307479_110420932 | 3300031962 | Hardwood Forest Soil | RSLWGLRQALLQQKRDYDAGFVQKQFEASWKGGPAALKLDDLV |
Ga0318575_106831841 | 3300032055 | Soil | GLHETLIRQKREYDAWFIKKQFDASWKGGAQNLKLEDLL |
Ga0311301_120805532 | 3300032160 | Peatlands Soil | LWGLHQALLQQKRDYDAGFVQKQFEASWKGGLTALKLDDLV |
Ga0307471_1014275101 | 3300032180 | Hardwood Forest Soil | QVFTAQKRDYDAGFVQKQFQASWKGASTLKVEDLV |
Ga0307472_1004077261 | 3300032205 | Hardwood Forest Soil | QQALMAQKRDYDAGLVEKQFQASWKGGNTQLKVADLL |
Ga0306920_1013172291 | 3300032261 | Soil | LFGLHETLIRQKREYDAWFIKKQFDASWKGGAQNLKLEDLL |
Ga0335079_108339193 | 3300032783 | Soil | NPRSLWGLRQALLQQKRDYDAGFVQKQFEASWKGGAQALKLDDLV |
Ga0335080_112570722 | 3300032828 | Soil | GLQQSLLQQKREYDAGFVRKQFESSWKGGALALKLDDLV |
Ga0335076_117274251 | 3300032955 | Soil | ETLKAQKRDYDAIFVQAQFREAWKGSPAQLKIGDLL |
Ga0335077_105116552 | 3300033158 | Soil | LKHALLQQKRDYDAGFVQKQFDAAWKGGPESLKLEDLV |
Ga0318519_105783911 | 3300033290 | Soil | QQALKAQKRDYDAQFVGTQFQTSWKGSQKQLTLEDLV |
Ga0370483_0003693_6_128 | 3300034124 | Untreated Peat Soil | VGLHQALLQQKREYDAGFSQKELEGAWKGGSQALKLDDLV |
Ga0370483_0009425_2606_2743 | 3300034124 | Untreated Peat Soil | NPRSLWGLHQALLQQKREYDAGFSQKELEGAWKGGSQALKLDDLV |
⦗Top⦘ |