Basic Information | |
---|---|
Family ID | F059274 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 40 residues |
Representative Sequence | VYQTLTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAA |
Number of Associated Samples | 114 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.27 % |
% of genes near scaffold ends (potentially truncated) | 97.01 % |
% of genes from short scaffolds (< 2000 bps) | 91.79 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.582 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.851 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.821 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.254 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF01969 | Ni_insertion | 38.06 |
PF09334 | tRNA-synt_1g | 5.22 |
PF01554 | MatE | 2.24 |
PF01425 | Amidase | 1.49 |
PF01676 | Metalloenzyme | 0.75 |
PF14236 | DUF4338 | 0.75 |
PF08570 | DUF1761 | 0.75 |
PF07244 | POTRA | 0.75 |
PF14100 | DUF6807 | 0.75 |
PF01784 | NIF3 | 0.75 |
PF00067 | p450 | 0.75 |
PF03485 | Arg_tRNA_synt_N | 0.75 |
PF00665 | rve | 0.75 |
PF01226 | Form_Nir_trans | 0.75 |
PF01738 | DLH | 0.75 |
PF04542 | Sigma70_r2 | 0.75 |
PF00491 | Arginase | 0.75 |
PF08281 | Sigma70_r4_2 | 0.75 |
PF13519 | VWA_2 | 0.75 |
PF00756 | Esterase | 0.75 |
PF00072 | Response_reg | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 38.06 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.97 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.49 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.75 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 0.75 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.75 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.75 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.75 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.75 |
COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.75 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.75 |
COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.58 % |
Unclassified | root | N/A | 16.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_103271349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100604839 | Not Available | 973 | Open in IMG/M |
3300002558|JGI25385J37094_10196154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300004092|Ga0062389_102283757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300004092|Ga0062389_104247851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300004092|Ga0062389_104412327 | Not Available | 529 | Open in IMG/M |
3300004152|Ga0062386_101038616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300005176|Ga0066679_10476619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300005176|Ga0066679_10500294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
3300005176|Ga0066679_10802394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
3300005332|Ga0066388_101981806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1043 | Open in IMG/M |
3300005338|Ga0068868_101321435 | Not Available | 670 | Open in IMG/M |
3300005540|Ga0066697_10243643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300005554|Ga0066661_10511384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300005568|Ga0066703_10633419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300005591|Ga0070761_10799250 | Not Available | 593 | Open in IMG/M |
3300005993|Ga0080027_10192151 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300006173|Ga0070716_100493066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300006175|Ga0070712_101625686 | Not Available | 565 | Open in IMG/M |
3300006755|Ga0079222_10059552 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300006954|Ga0079219_10436529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
3300007076|Ga0075435_100512566 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300007258|Ga0099793_10205257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
3300009012|Ga0066710_101145361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1204 | Open in IMG/M |
3300009088|Ga0099830_10206807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1538 | Open in IMG/M |
3300009089|Ga0099828_10305261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
3300009090|Ga0099827_10732613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300010048|Ga0126373_12399932 | Not Available | 587 | Open in IMG/M |
3300010325|Ga0134064_10451219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300010335|Ga0134063_10117027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300010366|Ga0126379_10420612 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300011270|Ga0137391_10740009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300011271|Ga0137393_10213851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
3300012096|Ga0137389_10787918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300012096|Ga0137389_11321212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300012201|Ga0137365_10062046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2823 | Open in IMG/M |
3300012202|Ga0137363_10963177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300012202|Ga0137363_11052437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
3300012203|Ga0137399_11126488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
3300012205|Ga0137362_10195542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1740 | Open in IMG/M |
3300012205|Ga0137362_10840072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
3300012206|Ga0137380_11434941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300012351|Ga0137386_10351369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300012357|Ga0137384_10853386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300012361|Ga0137360_10707033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300012362|Ga0137361_11836442 | Not Available | 524 | Open in IMG/M |
3300012363|Ga0137390_11943379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300012582|Ga0137358_10469401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300012582|Ga0137358_10765263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
3300012685|Ga0137397_10798323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300012917|Ga0137395_10176823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
3300012917|Ga0137395_10977153 | Not Available | 608 | Open in IMG/M |
3300012922|Ga0137394_11175179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012923|Ga0137359_10123115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2301 | Open in IMG/M |
3300012927|Ga0137416_10159512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1774 | Open in IMG/M |
3300012927|Ga0137416_10369360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
3300012930|Ga0137407_10266618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
3300012971|Ga0126369_13723663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300013307|Ga0157372_11687904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300015054|Ga0137420_1241388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2382 | Open in IMG/M |
3300015245|Ga0137409_11154650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300016371|Ga0182034_10637210 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300017659|Ga0134083_10026730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2079 | Open in IMG/M |
3300017955|Ga0187817_10551709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300018006|Ga0187804_10083554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
3300018062|Ga0187784_10406304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
3300019789|Ga0137408_1445514 | Not Available | 4009 | Open in IMG/M |
3300019882|Ga0193713_1030221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
3300020021|Ga0193726_1197269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300020579|Ga0210407_10423150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
3300020579|Ga0210407_10729405 | Not Available | 767 | Open in IMG/M |
3300020581|Ga0210399_10418740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
3300020581|Ga0210399_11148092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300020583|Ga0210401_11116519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300021088|Ga0210404_10403680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300021088|Ga0210404_10414786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300021088|Ga0210404_10427070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300021168|Ga0210406_10015959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7137 | Open in IMG/M |
3300021180|Ga0210396_10005847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11823 | Open in IMG/M |
3300021181|Ga0210388_11372034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300021401|Ga0210393_11666937 | Not Available | 505 | Open in IMG/M |
3300021401|Ga0210393_11687507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300021406|Ga0210386_11160928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 654 | Open in IMG/M |
3300021407|Ga0210383_11466164 | Not Available | 565 | Open in IMG/M |
3300021420|Ga0210394_11128006 | Not Available | 675 | Open in IMG/M |
3300021474|Ga0210390_11532998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300021559|Ga0210409_10331782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
3300021559|Ga0210409_10618757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
3300024330|Ga0137417_1083390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300024331|Ga0247668_1110598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300025460|Ga0208562_1040553 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300025527|Ga0208714_1018973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1696 | Open in IMG/M |
3300025910|Ga0207684_10429469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 1135 | Open in IMG/M |
3300026301|Ga0209238_1013861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3129 | Open in IMG/M |
3300026304|Ga0209240_1279743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300026309|Ga0209055_1073724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
3300026334|Ga0209377_1177613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300026497|Ga0257164_1057037 | Not Available | 634 | Open in IMG/M |
3300026538|Ga0209056_10385827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300026551|Ga0209648_10381438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
3300026552|Ga0209577_10561598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
3300026555|Ga0179593_1265118 | All Organisms → cellular organisms → Bacteria | 5132 | Open in IMG/M |
3300026557|Ga0179587_10023442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3352 | Open in IMG/M |
3300027537|Ga0209419_1077926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300027667|Ga0209009_1142070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300027729|Ga0209248_10228272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300027738|Ga0208989_10186545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
3300027795|Ga0209139_10159792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300027812|Ga0209656_10345939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
3300027862|Ga0209701_10125721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
3300027862|Ga0209701_10244121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
3300027862|Ga0209701_10433926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300027903|Ga0209488_10912042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300028047|Ga0209526_10929764 | Not Available | 526 | Open in IMG/M |
3300028776|Ga0302303_10005244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6835 | Open in IMG/M |
3300031057|Ga0170834_103864541 | Not Available | 535 | Open in IMG/M |
3300031057|Ga0170834_107202957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300031128|Ga0170823_12787644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300031469|Ga0170819_14759944 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300031561|Ga0318528_10655984 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031682|Ga0318560_10637179 | Not Available | 577 | Open in IMG/M |
3300031719|Ga0306917_10836668 | Not Available | 721 | Open in IMG/M |
3300031719|Ga0306917_11342245 | Not Available | 552 | Open in IMG/M |
3300031720|Ga0307469_10187001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1601 | Open in IMG/M |
3300031778|Ga0318498_10463831 | Not Available | 560 | Open in IMG/M |
3300031820|Ga0307473_10878909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300031833|Ga0310917_10553472 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300031962|Ga0307479_10376780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
3300032042|Ga0318545_10257734 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300032059|Ga0318533_11040216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300032783|Ga0335079_11210225 | Not Available | 759 | Open in IMG/M |
3300032805|Ga0335078_11036227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
3300032828|Ga0335080_12251625 | Not Available | 522 | Open in IMG/M |
3300033158|Ga0335077_10844659 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.21% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.73% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.24% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.24% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.75% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1032713491 | 3300000955 | Soil | VYQILTNRLRQALVRYIHEKYGVELAIVLERPPKIEMGEA |
JGIcombinedJ26739_1006048391 | 3300002245 | Forest Soil | VYLILSNRLREALAAHIREKYGVEVAVVLERPPKIEMGEAASPVC |
JGI25385J37094_101961541 | 3300002558 | Grasslands Soil | VYQELTNRLREALAAHIQEKYGVALAIVLERPPKIEMGEAASPV |
Ga0062389_1022837571 | 3300004092 | Bog Forest Soil | VYQTLTNRLREALAGHIREKYGMELAIALERPPKIEMGEAA |
Ga0062389_1042478512 | 3300004092 | Bog Forest Soil | VYLTIIQRLRESLTAHIREKYGAEITVVLEKPPKLELGEA |
Ga0062389_1044123272 | 3300004092 | Bog Forest Soil | VYQILKERLREALTRHIVLTYHVDIGVVLEKPPTIEMGEAASPV |
Ga0062386_1010386161 | 3300004152 | Bog Forest Soil | LATERGNVYQELTIRLREALAAHIRAAYGVELSVVLDRPPKIEMGEAAS |
Ga0066679_104766191 | 3300005176 | Soil | VYQKLTNRLSEALAGYIREKYGVELAIVLERPPKIEMGEAASPM |
Ga0066679_105002941 | 3300005176 | Soil | VYQTLTNRLREALAGHIREKYGVKLAIVLERPPKIAMGEAA |
Ga0066679_108023942 | 3300005176 | Soil | VYQTLMNQLREALAGYIREKYGVELAIVLERPPKIEMGEA |
Ga0066388_1019818061 | 3300005332 | Tropical Forest Soil | VYLTLTNRLRTALEQHIGQKYGLELPIVLERPPKIEMGEAAS |
Ga0068868_1013214351 | 3300005338 | Miscanthus Rhizosphere | VYLILMNRLREALARHIREKYGVELGVPLERPPKLAMGEAASPVS |
Ga0066697_102436432 | 3300005540 | Soil | VYQTLTNRLREALAAHIKEKYGVELEIVLNRPPKLDMGE |
Ga0066661_105113842 | 3300005554 | Soil | VYHKLTNRLREALAGYIREKYGVEPAIALERPPKIEMG |
Ga0066703_106334193 | 3300005568 | Soil | VYQTLTNRLREALAGHIREKYGVELAIMLERPPKIEMGEAASP |
Ga0070761_107992502 | 3300005591 | Soil | VYLTLCERLRAALAEHIREKYGVEAKVVLERPPKIEMG |
Ga0080027_101921511 | 3300005993 | Prmafrost Soil | VYLTLCERLRAALAGHIREKYGVELAVVLERPPKIEM |
Ga0070716_1004930661 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLEVTKRLRDALAKFIRERYHLDLPIVLERPPKI |
Ga0070712_1016256862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VYLTLMNRLREALARHIREKYGVELGVPLERPPKL |
Ga0079222_100595521 | 3300006755 | Agricultural Soil | VYQTLTNRLREALAAHIKEKYQVELEIVLNRPPKL |
Ga0079219_104365291 | 3300006954 | Agricultural Soil | VYQTLTNRLRDTLATHIREKYGVQIEVVLDRPPKLEM |
Ga0075435_1005125661 | 3300007076 | Populus Rhizosphere | VYPTLLNRLRRALAAHIREKYGIELAVVLERPPKLEMGE |
Ga0099793_102052571 | 3300007258 | Vadose Zone Soil | VYQTLTNRLREALTGHIREKYGVDLAIVLERPPKIEM |
Ga0066710_1011453612 | 3300009012 | Grasslands Soil | VYQTLTNRLREALAGHIREKYGVKLAIVLERPPKIEMGEAASPV |
Ga0099830_102068073 | 3300009088 | Vadose Zone Soil | VYRTLTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAA |
Ga0099828_103052611 | 3300009089 | Vadose Zone Soil | VYQTLTNRLREALAGLIREKYGVELAIVLERPPKIE |
Ga0099827_107326132 | 3300009090 | Vadose Zone Soil | VYQTLTKRLREALARHIREKYGVELAFALERPPKIEMG |
Ga0126373_123999321 | 3300010048 | Tropical Forest Soil | VYLTLLLRLKEALAAHIQEKYGVELKIALERPPKLEMGEAA |
Ga0134064_104512192 | 3300010325 | Grasslands Soil | VYQTLTSRLREALAAHIKEKYGVELEIVLNRPPKLDMGEAAS |
Ga0134063_101170272 | 3300010335 | Grasslands Soil | VYQTLTSRLREALAAHIKEKYGVELEIVLNRPPKLDM |
Ga0126379_104206122 | 3300010366 | Tropical Forest Soil | VYLILLDRLRDALARHIQQRYGVDLSLVLEKPPKLG |
Ga0137391_107400092 | 3300011270 | Vadose Zone Soil | VYQELTNRLRAALAAHIREKYGVELTIVLERPPQIEMGEAAS |
Ga0137393_102138511 | 3300011271 | Vadose Zone Soil | VYLELTKRLREALARHIRAKYGVELPIVLERPPKIE |
Ga0137389_107879181 | 3300012096 | Vadose Zone Soil | VYQELTKRLREALAGHIREKYGVELAIVLERPPKIEMG |
Ga0137389_113212121 | 3300012096 | Vadose Zone Soil | VYQTLTKRLREALTGHIREKYGVELAIVLERPPKIEMGEAASP |
Ga0137365_100620463 | 3300012201 | Vadose Zone Soil | MYQRLTERLRKALAEHIREKYGVELAVVLERPPKIEMGEA |
Ga0137363_109631772 | 3300012202 | Vadose Zone Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPKLEMGEA |
Ga0137363_110524372 | 3300012202 | Vadose Zone Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPK* |
Ga0137399_111264881 | 3300012203 | Vadose Zone Soil | VYQTLTNRLRQALAGHIREKYGVELAIVLERPPKIEMGEA |
Ga0137362_101955422 | 3300012205 | Vadose Zone Soil | MNRLREALAGHIREKYGVELAIVLERPPKIEMGEAAS |
Ga0137362_108400722 | 3300012205 | Vadose Zone Soil | VYQVLTNRLREALAGHIHEKYGVELAIVLERPPKIEMGE |
Ga0137380_114349412 | 3300012206 | Vadose Zone Soil | VYQTLTNRLREALAGHIREKYGVKLAIVLERPPKIEM |
Ga0137386_103513691 | 3300012351 | Vadose Zone Soil | VYQTLTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAASP |
Ga0137384_108533861 | 3300012357 | Vadose Zone Soil | VYQTLTNRLRKALAGHIREKYGVELAIVLERPPKIE |
Ga0137360_107070331 | 3300012361 | Vadose Zone Soil | VYQELTKRLREALAGHIREKYGLELAIVLERPPKIEMGE |
Ga0137361_118364421 | 3300012362 | Vadose Zone Soil | LYLTIIKKLRESLAAHIKEKYGAEITVALEKPPKLEMCEAASPV |
Ga0137390_119433792 | 3300012363 | Vadose Zone Soil | VYQTLTKRLREALAGHIREKYGVELAIVLERPPKIEM |
Ga0137358_104694012 | 3300012582 | Vadose Zone Soil | VYLEITARLRDALAKLIRAKYHVELPIVLERPPKIDMGEAAS |
Ga0137358_107652631 | 3300012582 | Vadose Zone Soil | VYQVLTNRLREALAGHIHEKYGVELAIVLERPPKIEMGEAASPV |
Ga0137397_107983232 | 3300012685 | Vadose Zone Soil | MTKRLRELLAAYIRERYGVELAIVLERPPKIEMGEAASPVC |
Ga0137395_101768232 | 3300012917 | Vadose Zone Soil | VYLEIKARLRDALAKLIRAKYHVELPIVLERPPKIDM |
Ga0137395_109771531 | 3300012917 | Vadose Zone Soil | MYLEITTRLRDALAKHIRGKYHIELPTVLERPPKIEMGEAA |
Ga0137394_111751791 | 3300012922 | Vadose Zone Soil | VYQILTNRLREALAGHIHEKYGVELAIVLERPPKIEMGEAASPV |
Ga0137359_101231151 | 3300012923 | Vadose Zone Soil | VYQTLTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAA |
Ga0137416_101595121 | 3300012927 | Vadose Zone Soil | VYLEITARLRDALARLIRAKYRVELPIVLERPPKIDMGEAASPV |
Ga0137416_103693602 | 3300012927 | Vadose Zone Soil | MYQRLTERLREALAKHIREKYGVELAIVLERPPKIEMGE |
Ga0137407_102666181 | 3300012930 | Vadose Zone Soil | VYLTLADRLRASLTRYIREKYGVELVVVLERPPKI |
Ga0126369_137236631 | 3300012971 | Tropical Forest Soil | VYQTLTNRLREALAAHIREKYGLEVAIVLERPPKVEMGEAASPV |
Ga0157372_116879041 | 3300013307 | Corn Rhizosphere | LVERLRAALAAHIRETYGVELSVVLERPPKIEMGEAASPVC |
Ga0137420_12413881 | 3300015054 | Vadose Zone Soil | VYQELTNRLRAALARHIREKYGVELAIVLERPPKI* |
Ga0137409_111546502 | 3300015245 | Vadose Zone Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPKLEMGEAAS |
Ga0182034_106372101 | 3300016371 | Soil | VYLTLLDRLREALAAHIREKYNVELAVVLEKPPKLEMGEAASP |
Ga0134083_100267301 | 3300017659 | Grasslands Soil | VYQTLMNQLREALAGYIREKYGVELAIVLERPPKIEMGEAA |
Ga0187817_105517092 | 3300017955 | Freshwater Sediment | VYQTLTNGLREALAAHVREKYGVELAIVLERPPKIE |
Ga0187804_100835542 | 3300018006 | Freshwater Sediment | VYQTLTNRLREALAAHIRDTYGVELAIVLERPPKIEMGEAASP |
Ga0187784_104063042 | 3300018062 | Tropical Peatland | VYLKIRDRLRDALASHIQATYGVEISVVLERPPKLEMGEAA |
Ga0137408_14455148 | 3300019789 | Vadose Zone Soil | MYQRLTERLRRGAGWVIREKYGWKLAIVLERRPKIEMERQLRSMF |
Ga0193713_10302212 | 3300019882 | Soil | VYLTLLQKLKQALAGHILAKYGVEIAVALEKPPRLEMGEAASPV |
Ga0193726_11972691 | 3300020021 | Soil | VYLTLVERLRTALASHIQEKYGVELAVVLERPPKIEMGEA |
Ga0210407_104231501 | 3300020579 | Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPKLEMG |
Ga0210407_107294052 | 3300020579 | Soil | VYLTLLKRLRETLAGHIREKYGAELSVVLERPPKLEMGEAA |
Ga0210399_104187402 | 3300020581 | Soil | VYLTLTKRLQEALAGHIREKYGVELTVVLERPPKIE |
Ga0210399_111480921 | 3300020581 | Soil | VYQTLTNRLRDALHRHIRHHYGVELVIVLDRPPKIEMGEVASPACFELA |
Ga0210401_111165191 | 3300020583 | Soil | VYQTLTNHLREALAGHIREKYGVEIAIVLERPPKIEMGEAAS |
Ga0210404_104036802 | 3300021088 | Soil | VYHALTNRLREALAGHIREKYGVELAIVLERPPKIEMGEVASPV |
Ga0210404_104147862 | 3300021088 | Soil | VYLTLSNRLRAALARYIREKYGVELTVVLERPPKIEMGEAA |
Ga0210404_104270701 | 3300021088 | Soil | MYQTLTDRLREALAGHIREKYGVALAIVLERPPKIEMGEAA |
Ga0210406_100159591 | 3300021168 | Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPKLEMGEAA |
Ga0210396_1000584711 | 3300021180 | Soil | LYQALTNRLRTALAGYIRQKYGVEPAIALERPPKIEMGEAASPV |
Ga0210388_113720342 | 3300021181 | Soil | LTLVERLRAALAAHIREKYGVELAVVLERPPKIEMGEAASP |
Ga0210393_116669372 | 3300021401 | Soil | VYLTLLKRLRETLAGHIRDKYEVELSVVLERPPKLE |
Ga0210393_116875072 | 3300021401 | Soil | VYQELTNRLREALAGHIRDKYGVELAIALERPPKIEMGEA |
Ga0210386_111609281 | 3300021406 | Soil | VYLEITTRLRGALTKHIRAKYHVELPIVLERPPKIEMGEAASP |
Ga0210383_114661642 | 3300021407 | Soil | VYLTLLKRLRETLAGHIREKYGVELSVVLERPPKLEM |
Ga0210394_111280061 | 3300021420 | Soil | VYLTLSNRLREALAAHIHEKYGVELTVVLERPPKIE |
Ga0210390_115329981 | 3300021474 | Soil | LTLVERLRAGLASHIREKYGVELAVVLERPPKIEM |
Ga0210409_103317822 | 3300021559 | Soil | VYQTLTNRLREALAGHIREKYGVELAITLERPPKIEMGEAASP |
Ga0210409_106187572 | 3300021559 | Soil | VYLTLTNRLRESLGRHIQEKYSVEATVVLERPPKIEMGEAA |
Ga0137417_10833901 | 3300024330 | Vadose Zone Soil | MYQRLTERLREALAKHIREKYGVELAIVLERPPKIEMGEAASPVCVCFEL |
Ga0247668_11105981 | 3300024331 | Soil | VYITLTKRLREALGAHIQEKYGAALGGVALNIVLERPPKIEMGEAASP |
Ga0208562_10405532 | 3300025460 | Peatland | VYLTIIQRLRKALGAHIREKYGCEINILLERPPKLELGEA |
Ga0208714_10189731 | 3300025527 | Arctic Peat Soil | VYQTLLNRLREALAAHVREKYSVEIAVVLERPPKLEMG |
Ga0207684_104294692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRLRESLAAHIKEKYGVEISVALEKPPKLEMGEAASPVC |
Ga0209238_10138614 | 3300026301 | Grasslands Soil | LYQTLTKRLREALAEHIREKYGVELPIVLERPPKIEMGEAA |
Ga0209240_12797432 | 3300026304 | Grasslands Soil | VYLILLQRLKEALAGHIREKYGVELAIALEKPPKLE |
Ga0209055_10737241 | 3300026309 | Soil | VYQTLTNRLREALAGHIREKYGVKLAIVLERPPKIA |
Ga0209377_11776131 | 3300026334 | Soil | VYQTLTKHLREALAGHIREKYGVELAIVLERPPKIEMGEAASPVC |
Ga0257164_10570371 | 3300026497 | Soil | VYQTLTNRLREGLARHIREKYGVELTIVLERPTKIEMGEAA |
Ga0209056_103858272 | 3300026538 | Soil | VYHTLTNRLREALARHIQEKYAIELPIVLERPPKIEMGE |
Ga0209648_103814381 | 3300026551 | Grasslands Soil | VYQTLTNRLRQALAGHIREKYGLELAIVLERPPKIEMGE |
Ga0209577_105615982 | 3300026552 | Soil | VYQTLTNRLSEALAGYIREKYGVELAIVLERPPKIEMGEAASPMCF |
Ga0179593_12651186 | 3300026555 | Vadose Zone Soil | VYLTLLKRLRETLAGYIREKYGVELSVVLERPPKLEMGEAAVSGLF |
Ga0179587_100234421 | 3300026557 | Vadose Zone Soil | VYLELTKRLRAALAKHIREKYHVELPIVLERPPKME |
Ga0209419_10779262 | 3300027537 | Forest Soil | VYLEITTRLREALAKHIRAKYHVDLPIVLERPPKTEMGEAA |
Ga0209009_11420701 | 3300027667 | Forest Soil | VYLKLTKRFRDAIDAHIREKYGLDIGIVTERPPKIEMG |
Ga0209248_102282722 | 3300027729 | Bog Forest Soil | VYQTIKNRLRDALTRHIQLTYHVDLSVALERPPKIEMGEAASPVC |
Ga0208989_101865451 | 3300027738 | Forest Soil | VYQELTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAASP |
Ga0209139_101597921 | 3300027795 | Bog Forest Soil | MNRLRTALAAHIQEKYGVELSVVLERPPKLEMGEAASP |
Ga0209656_103459392 | 3300027812 | Bog Forest Soil | VYLTLLNRLRGTLGAHILEKYGVELTVVLERPPKLEMGEAA |
Ga0209701_101257212 | 3300027862 | Vadose Zone Soil | VYQTLTKRWREALAGHIREKYGAELALALERPPKIEMGEAASP |
Ga0209701_102441211 | 3300027862 | Vadose Zone Soil | VYRTLTNRLREALAGHIREKYGVELAIVLERPPKIEMGEAASP |
Ga0209701_104339261 | 3300027862 | Vadose Zone Soil | VYQELTNRLREALAAHIQEKYGVELPIVLERPPKIEMGEA |
Ga0209488_109120422 | 3300027903 | Vadose Zone Soil | VYLEITTKLRDALAKHIRAKYGVELPIMLERPPKIELG |
Ga0209526_109297641 | 3300028047 | Forest Soil | MYLEITARLREALRKHIRARYGMDLAIVLERPPKIEMGE |
Ga0302303_100052448 | 3300028776 | Palsa | VYQTIKNRLREALGRHIRAVYHVEIGVTLERPPKIEMGEA |
Ga0170834_1038645411 | 3300031057 | Forest Soil | VYLTLVERLRTALAAHILEKYGAELAVVLERPPKIEM |
Ga0170834_1072029571 | 3300031057 | Forest Soil | VYLTLSNRLREALAAHIREKYGVELTVVLERPPKIEMGEAASPV |
Ga0170823_127876442 | 3300031128 | Forest Soil | VYLTLLQKLKQALAGHILATYGVEIAVALEKPPKLEM |
Ga0170819_147599442 | 3300031469 | Forest Soil | VYLTLLNRLRESLAAHIREKYNVELAVVLEKPPKLEMG |
Ga0318528_106559841 | 3300031561 | Soil | VYLTLIHRLREALTAHIREKCGVELPIVLEKPPKLELG |
Ga0318560_106371792 | 3300031682 | Soil | VYLTLIRRLREALAAHIREKYGMDIAVALEKPPKLDLGEAA |
Ga0306917_108366683 | 3300031719 | Soil | VYLTLIRRLREALAAHIREKYGIEIAVVLEKPPKLELGEAAS |
Ga0306917_113422452 | 3300031719 | Soil | VYLTLIRRLREALAAHIREKYGVDIPVVLERPPKL |
Ga0307469_101870011 | 3300031720 | Hardwood Forest Soil | VYQTLTNRLREALARHIHEKYGVEMAIVLERPPNIEMGEAAS |
Ga0318498_104638311 | 3300031778 | Soil | VYLTLIRRLREALAAHIREKYGIEIAVVLEKPPKLELG |
Ga0307473_108789092 | 3300031820 | Hardwood Forest Soil | VYLELTNRLREALAGHIREKYGVELAIVLERPPKIE |
Ga0310917_105534721 | 3300031833 | Soil | VYLTLIRRLREALAAHIREKYGMDIAVALEKPPKLDLGEA |
Ga0307479_103767802 | 3300031962 | Hardwood Forest Soil | LYLEITTRLRDALAKHIRAKYGVELPIVLERPPKIEMGEVA |
Ga0318545_102577341 | 3300032042 | Soil | VYLTLIRRLREALAAHIREKYGMDIAVALEKPPKLDLGEAASPVC |
Ga0318533_110402162 | 3300032059 | Soil | VYLTLIKRLREALGAHIHENYGIEIPVVLERPPKIELGEAASPVC |
Ga0335079_112102251 | 3300032783 | Soil | VYLTIRNRLRDALGALIQQKYGVEIAVALEKPPKLELGE |
Ga0335078_110362271 | 3300032805 | Soil | VYLTLLHRLRETLAAHIHEKYGVELNVVLERPPKLEM |
Ga0335080_122516252 | 3300032828 | Soil | VYLTLLNRLRAALARHIQEKYGAELPIVLDRPPKLEMG |
Ga0335077_108446591 | 3300033158 | Soil | VYLTLLHRLRDALTQHIRQTYGVELSIVLEKPPKLEMGE |
⦗Top⦘ |