| Basic Information | |
|---|---|
| Family ID | F059252 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.75 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 95.52 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.045 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.164 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.090 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.478 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF03824 | NicO | 66.42 |
| PF13490 | zf-HC2 | 8.21 |
| PF00579 | tRNA-synt_1b | 1.49 |
| PF13795 | HupE_UreJ_2 | 1.49 |
| PF07676 | PD40 | 1.49 |
| PF04542 | Sigma70_r2 | 1.49 |
| PF01479 | S4 | 0.75 |
| PF00296 | Bac_luciferase | 0.75 |
| PF10099 | RskA | 0.75 |
| PF04545 | Sigma70_r4 | 0.75 |
| PF08281 | Sigma70_r4_2 | 0.75 |
| PF02645 | DegV | 0.75 |
| PF00180 | Iso_dh | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.49 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.49 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.49 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.49 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.04 % |
| Unclassified | root | N/A | 8.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT01A6U8E | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 2228664021|ICCgaii200_c1031650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300004157|Ga0062590_102823937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300004480|Ga0062592_100209954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1383 | Open in IMG/M |
| 3300005335|Ga0070666_10919483 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005338|Ga0068868_100125606 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300005355|Ga0070671_100306699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
| 3300005356|Ga0070674_100127195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1895 | Open in IMG/M |
| 3300005439|Ga0070711_100820432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300005445|Ga0070708_101845403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005455|Ga0070663_101248736 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005467|Ga0070706_100414891 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300005471|Ga0070698_100105172 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300005540|Ga0066697_10653218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300005553|Ga0066695_10637619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300005559|Ga0066700_10491787 | Not Available | 857 | Open in IMG/M |
| 3300005560|Ga0066670_10758346 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005564|Ga0070664_101762078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300005569|Ga0066705_10204683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
| 3300005575|Ga0066702_10421680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 816 | Open in IMG/M |
| 3300005614|Ga0068856_102319424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
| 3300005764|Ga0066903_104132354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300005764|Ga0066903_105714903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300005842|Ga0068858_100542884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1125 | Open in IMG/M |
| 3300005844|Ga0068862_102231293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300006032|Ga0066696_10451175 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006046|Ga0066652_100247934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
| 3300006173|Ga0070716_101363032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300006175|Ga0070712_100393274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300006175|Ga0070712_101159849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300006358|Ga0068871_100957691 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300006573|Ga0074055_11719597 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006581|Ga0074048_11799777 | Not Available | 862 | Open in IMG/M |
| 3300006797|Ga0066659_10682803 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006804|Ga0079221_11664298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300006804|Ga0079221_11718709 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006806|Ga0079220_10180492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
| 3300006847|Ga0075431_101832821 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300006871|Ga0075434_100015904 | All Organisms → cellular organisms → Bacteria | 7226 | Open in IMG/M |
| 3300006954|Ga0079219_12318473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300009177|Ga0105248_13063169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300009792|Ga0126374_11642071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300010044|Ga0126310_11032533 | Not Available | 649 | Open in IMG/M |
| 3300010301|Ga0134070_10059291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300010304|Ga0134088_10369907 | Not Available | 697 | Open in IMG/M |
| 3300010320|Ga0134109_10457524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300010322|Ga0134084_10320327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300010337|Ga0134062_10634592 | Not Available | 554 | Open in IMG/M |
| 3300010366|Ga0126379_13256153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300010371|Ga0134125_12100865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300010396|Ga0134126_10091627 | Not Available | 3747 | Open in IMG/M |
| 3300010396|Ga0134126_10906101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300010400|Ga0134122_11396015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300011107|Ga0151490_1764355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 706 | Open in IMG/M |
| 3300011994|Ga0120157_1033153 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012189|Ga0137388_10976513 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012189|Ga0137388_11017852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 764 | Open in IMG/M |
| 3300012199|Ga0137383_10598398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300012206|Ga0137380_10354249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1309 | Open in IMG/M |
| 3300012206|Ga0137380_10858844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012206|Ga0137380_11056992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300012211|Ga0137377_11697157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300012353|Ga0137367_11128304 | Not Available | 528 | Open in IMG/M |
| 3300012354|Ga0137366_11171658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300012356|Ga0137371_10899417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300012359|Ga0137385_11062025 | Not Available | 667 | Open in IMG/M |
| 3300012488|Ga0157343_1013400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300012907|Ga0157283_10165359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300012929|Ga0137404_11557187 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300012972|Ga0134077_10491914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300012972|Ga0134077_10512975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300012984|Ga0164309_10477007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300013307|Ga0157372_11192419 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300013307|Ga0157372_12202165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300015167|Ga0167661_1090863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 544 | Open in IMG/M |
| 3300017654|Ga0134069_1221905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300017792|Ga0163161_10896625 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300018433|Ga0066667_10148635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1649 | Open in IMG/M |
| 3300018468|Ga0066662_12739013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300019882|Ga0193713_1165456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
| 3300021080|Ga0210382_10452514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300024254|Ga0247661_1103238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300025885|Ga0207653_10410956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300025907|Ga0207645_10461559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 858 | Open in IMG/M |
| 3300025911|Ga0207654_10262425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1162 | Open in IMG/M |
| 3300025917|Ga0207660_10327611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1224 | Open in IMG/M |
| 3300025922|Ga0207646_10754188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 868 | Open in IMG/M |
| 3300025931|Ga0207644_11269303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300025936|Ga0207670_11637571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300025939|Ga0207665_11127344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 625 | Open in IMG/M |
| 3300025939|Ga0207665_11230322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 597 | Open in IMG/M |
| 3300025961|Ga0207712_10201068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1580 | Open in IMG/M |
| 3300025981|Ga0207640_10809427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300026023|Ga0207677_10763716 | Not Available | 863 | Open in IMG/M |
| 3300026035|Ga0207703_10898370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 848 | Open in IMG/M |
| 3300026318|Ga0209471_1064678 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300026538|Ga0209056_10506067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300026542|Ga0209805_1322832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300026550|Ga0209474_10343680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 842 | Open in IMG/M |
| 3300026550|Ga0209474_10425413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300027775|Ga0209177_10427493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300027821|Ga0209811_10125256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300027821|Ga0209811_10310765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300028379|Ga0268266_10048727 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
| 3300028380|Ga0268265_12173623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300028587|Ga0247828_10947141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300028704|Ga0307321_1020145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1172 | Open in IMG/M |
| 3300028705|Ga0307276_10035545 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300028705|Ga0307276_10123447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300028707|Ga0307291_1046851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
| 3300028707|Ga0307291_1180335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300028711|Ga0307293_10266686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300028711|Ga0307293_10288065 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300028716|Ga0307311_10176794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300028716|Ga0307311_10231406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300028768|Ga0307280_10021559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1858 | Open in IMG/M |
| 3300028787|Ga0307323_10034431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1764 | Open in IMG/M |
| 3300028791|Ga0307290_10297268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300028799|Ga0307284_10358859 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300028824|Ga0307310_10226156 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300028828|Ga0307312_10772639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300028828|Ga0307312_11109630 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028875|Ga0307289_10329363 | Not Available | 628 | Open in IMG/M |
| 3300028876|Ga0307286_10045002 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300028878|Ga0307278_10200195 | Not Available | 891 | Open in IMG/M |
| 3300028885|Ga0307304_10201026 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031847|Ga0310907_10150705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300031943|Ga0310885_10578960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300031995|Ga0307409_100599785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
| 3300031996|Ga0308176_11908255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300032180|Ga0307471_102219209 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300032180|Ga0307471_104283660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300034817|Ga0373948_0033741 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.75% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_00266640 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | IAVLARKAFRRLSFEGSLIRLLPAVSALVILAAGVAMTLRALPKVA |
| ICCgaii200_10316504 | 2228664021 | Soil | RASFEGRLLRLLPAASALVILAAGLAMTARALPKVH |
| Ga0062590_1028239371 | 3300004157 | Soil | AVLARRVFKRMSFEGRLIRLLPAASALVILAAGLAMTAHAVPKVS* |
| Ga0062592_1002099541 | 3300004480 | Soil | SAFRRGTFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0070666_109194831 | 3300005335 | Switchgrass Rhizosphere | TGIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0068868_1001256061 | 3300005338 | Miscanthus Rhizosphere | GVGLLAVLARSTFRRLSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVA* |
| Ga0070671_1003066991 | 3300005355 | Switchgrass Rhizosphere | VGLAAVVARSAFRRASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS* |
| Ga0070674_1001271954 | 3300005356 | Miscanthus Rhizosphere | IGLAAVLARTAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0070711_1008204321 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAVFAKQIFKRASFEGRLVRLLPAASALVILAAGLTMTVRALPKVA* |
| Ga0070708_1018454032 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAVYAKQIFKRASFEGRLIRLLPAASALVILAAGLAMTARALPKVH* |
| Ga0070663_1012487361 | 3300005455 | Corn Rhizosphere | GIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0070706_1004148911 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TFFSRVSFEGPLMRALPTLSALVVIGLGVAMTLRAVPKVV* |
| Ga0070698_1001051724 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AFARRSFDGLLIRALPAASALVILAAGVAMTAKALPKVH* |
| Ga0066697_106532182 | 3300005540 | Soil | ARSAFRRFSFEGRLVRLLPTVSALVILVAGLLMTVHALPGVS* |
| Ga0066695_106376191 | 3300005553 | Soil | TGIGLAAVLARSVFRRVNLDGRFIALLPAVSAFVILAAGVVMTIHALPRVA* |
| Ga0066700_104917871 | 3300005559 | Soil | GFDGPLVRLLPAASALVILATGLAMTVRAVPKVS* |
| Ga0066670_107583462 | 3300005560 | Soil | KQIFKRASFNGPLVRLLPAASALVILVAGLAMTVRALPKVS* |
| Ga0070664_1017620781 | 3300005564 | Corn Rhizosphere | GIGLAAVLARSAFRRASFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0066705_102046833 | 3300005569 | Soil | VAVFAKQIFKRASFEGRFVRLLPAASALVILAAGLAMTVRALPKVS* |
| Ga0066694_102312431 | 3300005574 | Soil | GLAAVLAKRVFARASFDGRLLRALPALSALVILAAGVAMTARALPKVG* |
| Ga0066702_104216801 | 3300005575 | Soil | VIARSAFKRLSFGGRLLSVLPAVSALVILAAGIAMTARALPGVS* |
| Ga0068856_1023194241 | 3300005614 | Corn Rhizosphere | ALSITGVGLLAVLARSTFRRLSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVA* |
| Ga0066903_1041323541 | 3300005764 | Tropical Forest Soil | VSFEGSIIRLLPAASALVVLGLGVAMTVRALPHVI* |
| Ga0066903_1057149031 | 3300005764 | Tropical Forest Soil | AVLAKRVFARVSFEGRLASLLPAASALVILVAGMAMTLRAIPRIGG* |
| Ga0068858_1005428841 | 3300005842 | Switchgrass Rhizosphere | LSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR* |
| Ga0068862_1022312932 | 3300005844 | Switchgrass Rhizosphere | AAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS* |
| Ga0066696_104511751 | 3300006032 | Soil | GIGLAAVVARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS* |
| Ga0066652_1002479341 | 3300006046 | Soil | SITGIGVVAVLARSAFRRVSFDGTLIRLLPAASALVILAAGLAMTFRALPKVA* |
| Ga0070716_1013630321 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSAFRRFSFEGRLVRLLPTGSALVILVAGLLMTVHALPGVS* |
| Ga0070712_1003932741 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AVFAKQIFKRASFEGRLVRLLPAASALVILAAGLMMTARALPKVH* |
| Ga0070712_1011598491 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ASFEGRLVRLLPAASALVILAAGLMMTARALPKVH* |
| Ga0068871_1009576911 | 3300006358 | Miscanthus Rhizosphere | VVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0074055_117195971 | 3300006573 | Soil | LVAVFAKQIFKRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS* |
| Ga0074048_117997771 | 3300006581 | Soil | RRVSFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0066659_106828031 | 3300006797 | Soil | IGLAAVLARGVFRRVGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG* |
| Ga0079221_116642982 | 3300006804 | Agricultural Soil | ATFEGRLVRLLPAASALVILAAGPAMTLRAVPKVS* |
| Ga0079221_117187092 | 3300006804 | Agricultural Soil | AGLALSITGIGLIAVLAKHVFRRASFDGRLIRLLTAASALVILAAGLAMTVRALPKVS* |
| Ga0079220_101804921 | 3300006806 | Agricultural Soil | GIGLAAVLARSAFRRASFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0075431_1018328211 | 3300006847 | Populus Rhizosphere | MSFEGRLVRLLPAASALVILAAGLAMTAHAVPKVS* |
| Ga0075434_10001590414 | 3300006871 | Populus Rhizosphere | AKQVFKRASFEGRLVRLLPAASALVILVAGLAMTVRALPKVS* |
| Ga0079219_123184732 | 3300006954 | Agricultural Soil | ATFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0105248_130631691 | 3300009177 | Switchgrass Rhizosphere | RASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS* |
| Ga0126374_116420712 | 3300009792 | Tropical Forest Soil | RSFDGALVRALPVLSALVILAAGVAMAASALPKVR* |
| Ga0126310_110325332 | 3300010044 | Serpentine Soil | GCAAVLARSAFRRVSFDGRLVRLLPAASALVILAAGLAMTVHAVPSLS* |
| Ga0134070_100592911 | 3300010301 | Grasslands Soil | FSRVSFDGAVVRVLPAVSAVVVLALGVAMTLRAVPRVL* |
| Ga0134088_103699071 | 3300010304 | Grasslands Soil | RRLSFNGRVLSLLPSASALVILAAGLLMTLHALPQVG* |
| Ga0134109_104575242 | 3300010320 | Grasslands Soil | FRRLSFEGRLIRLLPAVSALVILAAGLAMTLRAVPKVS* |
| Ga0134084_103203272 | 3300010322 | Grasslands Soil | FRRASFEGRLIRLLPAASALVILAAGLAMTVRALPKVS* |
| Ga0134062_106345921 | 3300010337 | Grasslands Soil | SAFRRVSFDGTLIRLLPAASALVILAAGLAMTFRALPKVA* |
| Ga0126379_132561532 | 3300010366 | Tropical Forest Soil | ALSITGVGLAAVVARSAFRRASFEGPLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0134125_121008652 | 3300010371 | Terrestrial Soil | GAFRRFSFDGRVVSLLPTASALVIVAAGLVMTLHALPEVG* |
| Ga0134126_100916271 | 3300010396 | Terrestrial Soil | FKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR* |
| Ga0134126_109061011 | 3300010396 | Terrestrial Soil | LAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0134122_113960151 | 3300010400 | Terrestrial Soil | VGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0151490_17643551 | 3300011107 | Soil | RFSFNGRGLSLLPTASALVILAAGLLMTLHALPQVG* |
| Ga0120157_10331533 | 3300011994 | Permafrost | IGLAAVLARGAFRRVSFDGWVVSFLPTASALVILAAGLVMTLHALPKVG* |
| Ga0137388_109765132 | 3300012189 | Vadose Zone Soil | LARGAFRRVSFDGRLVSLLPTASALVILAAGLLMTVHALPKVG* |
| Ga0137388_110178522 | 3300012189 | Vadose Zone Soil | IGLLAVTARRTFSRLSFESRFVRLLPAASALVIIGLGLAMTARAIPGIA* |
| Ga0137383_105983982 | 3300012199 | Vadose Zone Soil | GLALAITGVGLLAVLAKSAFRRANFDGRLMRLLPVASAFVILVAGLAMTVRALPKVG* |
| Ga0137380_103542493 | 3300012206 | Vadose Zone Soil | RRSFSRLSFENRLLRLLPAASALVIIGLGLAMTARALPGIA* |
| Ga0137380_108588441 | 3300012206 | Vadose Zone Soil | IFKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH* |
| Ga0137380_110569922 | 3300012206 | Vadose Zone Soil | VGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG* |
| Ga0137377_116971572 | 3300012211 | Vadose Zone Soil | AVFAKQIFKRASFEGRLVRLLPAASALVILVAGLAMTARALPKVG* |
| Ga0137367_111283041 | 3300012353 | Vadose Zone Soil | FRRASFEGRLVRLLPAASALVILVAGIAMTARALPKVS* |
| Ga0137366_111716581 | 3300012354 | Vadose Zone Soil | VGLLAVLAKRAFARVSFDRGLVALLPAASALVILLAGVVMTVRALPKVTL* |
| Ga0137371_108994171 | 3300012356 | Vadose Zone Soil | IFKRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS* |
| Ga0137385_110620252 | 3300012359 | Vadose Zone Soil | VLARSAFRRFSFEGRFVSLLPTVSALVILAAGLLMTVHALPRVS* |
| Ga0157343_10134002 | 3300012488 | Arabidopsis Rhizosphere | AFKRMSFEGRLIRLLPAASALVILAAGLAMTAHAVPKVS* |
| Ga0157283_101653592 | 3300012907 | Soil | AGLALTITAIGCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS* |
| Ga0137404_115571871 | 3300012929 | Vadose Zone Soil | AFRRVSFDGRVVSLLPTASALVIVAAGLLMTLHALPRVD* |
| Ga0134077_104919141 | 3300012972 | Grasslands Soil | LFRRASFEGGLIRLLPAVSALVVLALGLAMTLRALPRVA* |
| Ga0134077_105129751 | 3300012972 | Grasslands Soil | QIFKRPSFEGPLVRLLPAVSALVILAAGLAMTVRALPKVA* |
| Ga0164309_104770071 | 3300012984 | Soil | TAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0157372_111924193 | 3300013307 | Corn Rhizosphere | ASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS* |
| Ga0157372_122021651 | 3300013307 | Corn Rhizosphere | YAKQIFKRASFEGRLVRMLPAASALVILAAGLAMTMRALPKVS* |
| Ga0167661_10908633 | 3300015167 | Glacier Forefield Soil | VPIGIGLVAIGARRAFSRMSFEGRFVRALPAISALVIFGLGLAMT |
| Ga0134069_12219052 | 3300017654 | Grasslands Soil | VAVYAKQIFKRASFEGRLVRLLPAASALVILAAGLAMTLRALPKVS |
| Ga0163161_108966252 | 3300017792 | Switchgrass Rhizosphere | GCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0066667_101486351 | 3300018433 | Grasslands Soil | GVGLLAVLARSTFRRLSFEGSLMRLLPAASALVILAAGVAMTLRAFPKVT |
| Ga0066662_127390131 | 3300018468 | Grasslands Soil | ARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS |
| Ga0193713_11654562 | 3300019882 | Soil | IGLAAVFARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR |
| Ga0210382_104525141 | 3300021080 | Groundwater Sediment | LSFDGRLIRLLPAASALVILVAGLAMTVRALPKVS |
| Ga0247661_11032382 | 3300024254 | Soil | TAFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0207653_104109561 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VARTTFRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0207645_104615592 | 3300025907 | Miscanthus Rhizosphere | MSPIRLHRLLAAVLARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR |
| Ga0207654_102624253 | 3300025911 | Corn Rhizosphere | IGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0207660_103276113 | 3300025917 | Corn Rhizosphere | LAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0207646_107541882 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GAFRRLSFEGRFVSLLPAVSALVILAAGLAMTVHSLPKVR |
| Ga0207644_112693031 | 3300025931 | Switchgrass Rhizosphere | GLALSITGVGLAAVVARSAFRRASFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS |
| Ga0207670_116375711 | 3300025936 | Switchgrass Rhizosphere | GLAAVLARTAFRRMSFEGRLVRLLPAVSALVILAAGLAMTVRAVPKVS |
| Ga0207665_111273442 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LRTTSPTSSPLALSITAIGLLAVLARRAFRRLSFEGGLLRLLPAASAVVILAAGIVMTVHAVPQLA |
| Ga0207665_112303221 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ARSAFRRFSFEGRLVRLLPTGSALVILVAGLLMTVHALPGVS |
| Ga0207712_102010681 | 3300025961 | Switchgrass Rhizosphere | FKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH |
| Ga0207640_108094272 | 3300025981 | Corn Rhizosphere | GLALSITGIGLAAVLARSAFRRASFDGRLMRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0207677_107637162 | 3300026023 | Miscanthus Rhizosphere | RGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0207703_108983701 | 3300026035 | Switchgrass Rhizosphere | VFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPGVR |
| Ga0209471_10646783 | 3300026318 | Soil | FNRVRFDGRVIGLLPALSALVILVAGLAMTARAVPKLG |
| Ga0209056_105060672 | 3300026538 | Soil | ARGVFRRVGFDGRVVSLLPTASALVIVAAGLLMTFHALPRVG |
| Ga0209805_13228321 | 3300026542 | Soil | GIGLLAVLAKHAFRRGRFDGRLFGLLPAASALVIVVAGIAMTLRAIPKVH |
| Ga0209474_103436802 | 3300026550 | Soil | GIGLAAVVARSAFRRLSFEGRLLSLLPAVSALVIVAAGIAMTARALPRLS |
| Ga0209474_104254131 | 3300026550 | Soil | AVLAKHVFRRASFEGRLIRLLPAASALVILAAGLAMTVRALPKVS |
| Ga0209177_104274932 | 3300027775 | Agricultural Soil | ALSITGVGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0209811_101252562 | 3300027821 | Surface Soil | LSFEGRALSLLPAASALVIVAAGLAMTIHSLPGVR |
| Ga0209811_103107652 | 3300027821 | Surface Soil | LARTAFRRVSFDGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0268266_100487271 | 3300028379 | Switchgrass Rhizosphere | VLARGVFKRLSFEGRALSLLPAASALVILAAGLAMTIHSLPAVR |
| Ga0268265_121736231 | 3300028380 | Switchgrass Rhizosphere | LALTITAIGCAAVLARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0247828_109471411 | 3300028587 | Soil | VLARGAFRRVSFEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0307321_10201453 | 3300028704 | Soil | VAVFAKRLFRRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS |
| Ga0307276_100355451 | 3300028705 | Soil | LSFDGRLVSLLPAASALVILAAGAAMTLHALPKVR |
| Ga0307276_101234472 | 3300028705 | Soil | SSFEGRLVRLLPAASALVILAAGLAMTARALPKVS |
| Ga0307291_10468513 | 3300028707 | Soil | FRRVSFEGRLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0307291_11803351 | 3300028707 | Soil | IGLVAVFAKRLFRRASFEGRLVRLLPAASALVILAAGLAMTVRALPKVS |
| Ga0307293_102666862 | 3300028711 | Soil | LARGAFRRLSFDGRVVSLLPTASALVILAAGLVMTLHALPKVG |
| Ga0307293_102880652 | 3300028711 | Soil | IGLLAVLARGAFRRFSFDGRVVSLLPTASALVIVAAGLVMTLHALPEVG |
| Ga0307311_101767941 | 3300028716 | Soil | AVVLARGAFRRFSFDGRVVSLLPIASALVIVAVGLVMTLHALPKVG |
| Ga0307311_102314061 | 3300028716 | Soil | FRRVSFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| Ga0307280_100215591 | 3300028768 | Soil | KRVFKRASFEGRLVRLLPAASALVILAAGLAMTARALPKVH |
| Ga0307323_100344314 | 3300028787 | Soil | FRRLSFEGPVMRLLPAASALVILAAGLAMTAHAVPKVG |
| Ga0307290_102972682 | 3300028791 | Soil | RLSFDGPAMRLLPAASALVILAAGLAMTVHAVPKVG |
| Ga0307284_103588592 | 3300028799 | Soil | FGRIGFDGRLVRLLPAASALVILLAGVAMTARAFPKVG |
| Ga0307310_102261562 | 3300028824 | Soil | LARSAFRRLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR |
| Ga0307312_107726391 | 3300028828 | Soil | RLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR |
| Ga0307312_111096301 | 3300028828 | Soil | IGLAVVLARGAFRRFSFDGRAVSLLPTASALVIVAVGLVMTLHALPKVG |
| Ga0307289_103293631 | 3300028875 | Soil | LSFEGRLMRLLPAASALVILAAGVAMTLRAFPKVT |
| Ga0307286_100450021 | 3300028876 | Soil | ARSAFRRLSFEGRALSLLPAVSALVILAAGVAMTVHALPQVR |
| Ga0307278_102001951 | 3300028878 | Soil | AKRAFSRLSFQGRVAGLLPAASALVILVAGVAMTLHALPKVS |
| Ga0307304_102010262 | 3300028885 | Soil | LAAVLARGAFRRVSFDGRVLSLLPTASALVIVAAGVLMTLHALPRVG |
| Ga0310907_101507051 | 3300031847 | Soil | FRRATFEGRLVRVLPAASALVILAAGLAMTLRAVPKVS |
| Ga0310885_105789601 | 3300031943 | Soil | VSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0307409_1005997853 | 3300031995 | Rhizosphere | LARGAFRRVSLEGPLVRLLPAASALVILAAGLAMTVRAVPKVS |
| Ga0308176_119082551 | 3300031996 | Soil | AVLARTAFRRVSFEGRLVRLLPAASALVILAAGVAMTLRAVPKVS |
| Ga0307471_1022192091 | 3300032180 | Hardwood Forest Soil | FSRVSFEGPLMRALPTVSALVVIGLGVAMTLRAVPKVV |
| Ga0307471_1042836602 | 3300032180 | Hardwood Forest Soil | VAAVLARGAFRRVSFDGRLVSLLPTASALVILVAGLLMTVHALPRVG |
| Ga0373948_0033741_886_1041 | 3300034817 | Rhizosphere Soil | TGVGLAAVVARSAFRRATFEGRLVRLLPAASALVILAAGLAMTLRAVPKVS |
| ⦗Top⦘ |