NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059244

Metagenome / Metatranscriptome Family F059244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059244
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 46 residues
Representative Sequence FTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Number of Associated Samples 120
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.76 %
% of genes from short scaffolds (< 2000 bps) 92.54 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.433 % of family members)
Environment Ontology (ENVO) Unclassified
(25.373 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.463 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.08%    β-sheet: 0.00%    Coil/Unstructured: 68.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF04012PspA_IM30 94.78
PF09084NMT1 2.99
PF00005ABC_tran 0.75
PF12974Phosphonate-bd 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG1842Phage shock protein ATranscription [K] 189.55
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.99
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.51 %
UnclassifiedrootN/A1.49 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_110560236All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300000955|JGI1027J12803_105743407All Organisms → cellular organisms → Bacteria → Acidobacteria1233Open in IMG/M
3300002914|JGI25617J43924_10303871All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300004091|Ga0062387_100604765All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300004619|Ga0068953_1392789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1194Open in IMG/M
3300005174|Ga0066680_10604499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300005177|Ga0066690_10930793All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005178|Ga0066688_10096366All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300005187|Ga0066675_10377684All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300005332|Ga0066388_103323139All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005332|Ga0066388_107381793All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005542|Ga0070732_10377993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300005591|Ga0070761_10938055All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300005602|Ga0070762_10286187All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300005610|Ga0070763_10102749All Organisms → cellular organisms → Bacteria → Acidobacteria1444Open in IMG/M
3300005712|Ga0070764_10724401All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300005921|Ga0070766_10883363Not Available612Open in IMG/M
3300006059|Ga0075017_100134997All Organisms → cellular organisms → Bacteria1746Open in IMG/M
3300006059|Ga0075017_100519304All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium905Open in IMG/M
3300006086|Ga0075019_10727979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300006173|Ga0070716_101641904All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300006796|Ga0066665_10867122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300006914|Ga0075436_101204103All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300009012|Ga0066710_102101266All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300009029|Ga0066793_10718119All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300009137|Ga0066709_104258181All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300009143|Ga0099792_10828239All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300009143|Ga0099792_11234463All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300009519|Ga0116108_1064277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1143Open in IMG/M
3300009640|Ga0116126_1078098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1220Open in IMG/M
3300009640|Ga0116126_1105620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium994Open in IMG/M
3300009644|Ga0116121_1035328All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300009644|Ga0116121_1309052All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300010048|Ga0126373_10434781All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300010360|Ga0126372_11144144All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300010362|Ga0126377_11594864All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300010362|Ga0126377_12239630All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300010379|Ga0136449_100832961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1517Open in IMG/M
3300010866|Ga0126344_1048523All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300011076|Ga0138574_1006780All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300011077|Ga0138572_1059366All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300011109|Ga0138539_1115583All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium654Open in IMG/M
3300012189|Ga0137388_11206714All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012203|Ga0137399_10993331All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300012209|Ga0137379_11059278All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300012923|Ga0137359_11343505All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012927|Ga0137416_10074915All Organisms → cellular organisms → Bacteria → Acidobacteria2469Open in IMG/M
3300012930|Ga0137407_10658784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300012957|Ga0164303_10738566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300012971|Ga0126369_10699969All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300012971|Ga0126369_13409291All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300014501|Ga0182024_12059103All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300014654|Ga0181525_10472078All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300015359|Ga0134085_10137385All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300016294|Ga0182041_10482552All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300016404|Ga0182037_11374753All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300017943|Ga0187819_10570878All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300017955|Ga0187817_10045748All Organisms → cellular organisms → Bacteria2687Open in IMG/M
3300017972|Ga0187781_10041352All Organisms → cellular organisms → Bacteria3175Open in IMG/M
3300018006|Ga0187804_10441322All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300018022|Ga0187864_10131841All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1257Open in IMG/M
3300018035|Ga0187875_10710994All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300018037|Ga0187883_10770422All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300018038|Ga0187855_10074307All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300018044|Ga0187890_10578176All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300018047|Ga0187859_10446050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300018085|Ga0187772_10865966All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300018088|Ga0187771_10068800All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300018088|Ga0187771_11049184All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018090|Ga0187770_10066060All Organisms → cellular organisms → Bacteria2639Open in IMG/M
3300019264|Ga0187796_1054084All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300019284|Ga0187797_1007654All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300019284|Ga0187797_1112342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae587Open in IMG/M
3300019890|Ga0193728_1180767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300020581|Ga0210399_11285197All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300021171|Ga0210405_10177106All Organisms → cellular organisms → Bacteria → Acidobacteria1690Open in IMG/M
3300021171|Ga0210405_10750071All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300021180|Ga0210396_11427471All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300021181|Ga0210388_11724375All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300021406|Ga0210386_11351123All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300021474|Ga0210390_11601373All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300021476|Ga0187846_10168871All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300021559|Ga0210409_10860539All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium780Open in IMG/M
3300026323|Ga0209472_1312381All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300026327|Ga0209266_1293843All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300026514|Ga0257168_1109006All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300026527|Ga0209059_1055080All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300026536|Ga0209058_1090976All Organisms → cellular organisms → Bacteria1570Open in IMG/M
3300027073|Ga0208366_1015513All Organisms → cellular organisms → Bacteria → Acidobacteria824Open in IMG/M
3300027505|Ga0209218_1011196All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300027516|Ga0207761_1094682All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300027559|Ga0209222_1083914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300027676|Ga0209333_1081951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300027684|Ga0209626_1054180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1007Open in IMG/M
3300027824|Ga0209040_10537594All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027846|Ga0209180_10386671All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300027853|Ga0209274_10284501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300027853|Ga0209274_10504679All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300027855|Ga0209693_10503544All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300027862|Ga0209701_10215069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1140Open in IMG/M
3300027889|Ga0209380_10442593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium760Open in IMG/M
3300027898|Ga0209067_10497336All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300028906|Ga0308309_10410391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1162Open in IMG/M
3300028906|Ga0308309_11184143Not Available659Open in IMG/M
3300029911|Ga0311361_10436150All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300029943|Ga0311340_10301706All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300030007|Ga0311338_11155567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300030057|Ga0302176_10078651All Organisms → cellular organisms → Bacteria → Acidobacteria1278Open in IMG/M
3300030618|Ga0311354_10284034All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300030618|Ga0311354_10679220All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium988Open in IMG/M
3300030627|Ga0210269_10395878All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300030741|Ga0265459_11574958All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300030741|Ga0265459_13591403All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300030937|Ga0138302_1256250All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300030939|Ga0138303_1145154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300030940|Ga0265740_1002794All Organisms → cellular organisms → Bacteria → Acidobacteria1249Open in IMG/M
3300031023|Ga0073998_11304562All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300031057|Ga0170834_107716464All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300031708|Ga0310686_105323692All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300031712|Ga0265342_10024829All Organisms → cellular organisms → Bacteria → Proteobacteria3778Open in IMG/M
3300031820|Ga0307473_10465876All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300031879|Ga0306919_10569322All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300031912|Ga0306921_11374735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300031941|Ga0310912_10092648All Organisms → cellular organisms → Bacteria → Proteobacteria2211Open in IMG/M
3300031942|Ga0310916_10311237All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300031947|Ga0310909_10433059All Organisms → Viruses → Predicted Viral1104Open in IMG/M
3300032160|Ga0311301_10514728All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300032180|Ga0307471_103464661All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300032805|Ga0335078_12587893All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300032828|Ga0335080_11890766All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300032896|Ga0335075_10134504All Organisms → cellular organisms → Bacteria3131Open in IMG/M
3300032897|Ga0335071_10842856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium865Open in IMG/M
3300032954|Ga0335083_10154135All Organisms → cellular organisms → Bacteria → Proteobacteria2165Open in IMG/M
3300033891|Ga0334811_164029All Organisms → cellular organisms → Bacteria546Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.46%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.48%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.73%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.73%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.73%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.24%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.24%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.49%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.49%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.75%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.75%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.75%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.75%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.75%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004619Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011076Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011077Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011109Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019264Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027516Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030940Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_11056023613300000559SoilEKERFTGWRLKKQQEERKIAETVGHFVSENPITTGDTASPASGSKTAQRS*
JGI1027J12803_10574340723300000955SoilRLRKQQEERKIAETVGYFVSENPITTGDIASPASGSKTTQRS*
JGI25617J43924_1030387113300002914Grasslands SoilFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS*
Ga0062387_10060476523300004091Bog Forest SoilKQQEEKKIADAVGYFVTENPITTGDLSASAVPSKTAQGS*
Ga0068953_139278913300004619Peatlands SoilVSREKERFASWRLKKQQEEKKIGEAVGYFVSENPITTGDVNAPPPPSKTAQRS*
Ga0066680_1060449923300005174SoilREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVKAVPSPSPSKATQRS*
Ga0066690_1093079313300005177SoilWRLKKQQEEKKIADAVGYFVSENPITTGAVLAQPPVSKTAQRS*
Ga0066688_1009636613300005178SoilNDEVAREKERLASWRLKKQQEEKKIADAVGYFVSENPITTGPAQTQPPVSKTARRSE*
Ga0066675_1037768413300005187SoilGWRLKKQQEEKKIADAVGYFVSENPITTGPVSAQPPVSKTAQRS*
Ga0066388_10332313923300005332Tropical Forest SoilEKERFSGWRIKKQQEEKKIADAVGCFVTENPITTGPVSAQPPVSKTAQRS*
Ga0066388_10738179313300005332Tropical Forest SoilREKERFAGWRLKKQHEEKKIADTVGYFVSENPITTGLVQAQPTVSKQPQRS*
Ga0070732_1037799323300005542Surface SoilVSREKERFTGWKLKKQQEEKKIAEAVGYFVTENPITTGDVSAPPPTPKTVQRS*
Ga0070761_1093805513300005591SoilNNEEVSREKERFTGWRLKKQQEEKKISEAVGYFVSENPITTGEVNAPPPTSKIAQRS*
Ga0070762_1028618713300005602SoilKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDLNAPTPPSKTEQRS*
Ga0070763_1010274913300005610SoilRLKKQQEEKKIAEAVGYFVTENPITTGAAQAEPSPKTAQRS*
Ga0070764_1072440123300005712SoilVLREKERLTGWRLKKQQEEKKIAEAVGYFVTENPITTGEVNASTPPSKTVQRS*
Ga0070766_1088336313300005921SoilEKKIAEAVGYFVTENPITTGDVNAVTSPSPSKATQRS*
Ga0075017_10013499713300006059WatershedsRFTGWRLKKQQEEKKIAEAVGYFVTENQITTGDVNGPPPPSKTAQRS*
Ga0075017_10051930413300006059WatershedsNDAVSREKERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDANAAPPQPKPVQR*
Ga0075019_1072797913300006086WatershedsNNDAISREKERFTGWRLKKQQEEKKIADAVGYFVTENPITTGDVNAAPSPTKATQRS*
Ga0070716_10164190423300006173Corn, Switchgrass And Miscanthus RhizosphereERFTGWRLKKQQEEKKISDAVGYFVSENPITTGNVNAEQQPPVTKKAQRS*
Ga0066665_1086712213300006796SoilTGWRLKKQQEEKKIAEAVGYFVTENAITTGDVNAPPPPSKTAQRS*
Ga0075436_10120410323300006914Populus RhizosphereWEKERFTGWRLKKQQEERKIAETVGYFVSENPITRGDIESTTSGSKTAQRS*
Ga0066710_10210126623300009012Grasslands SoilQQEEKKIADAVGYFVSENPITTGPVSAQPPVSKTAQRS
Ga0066793_1071811913300009029Prmafrost SoilERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPPTSKTAQRS*
Ga0066709_10425818123300009137Grasslands SoilWRMKKQKEEKKIADAVGYFVTENPITTGEPKPPASGAKQASGPKQ*
Ga0099792_1082823923300009143Vadose Zone SoilRFTGWRLKKQQEEKKIAEAVGYFVTENPITTGGVNAPPPPSKTAQRS*
Ga0099792_1123446313300009143Vadose Zone SoilNNEEVSREKQRFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSNTAQHS*
Ga0116108_106427713300009519PeatlandEEVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS*
Ga0116126_107809833300009640PeatlandLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRY*
Ga0116126_110562023300009640PeatlandLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS*
Ga0116121_103532813300009644PeatlandEVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGEVKAPAPPSKTAQRS*
Ga0116121_130905213300009644PeatlandKQQEEKKIAEAVGYFVSENPITTGAVGAPVTPSKT*
Ga0126373_1043478113300010048Tropical Forest SoilKKQQEEKKIADAVGYFVSENPITTGAAETTPPASQTARRS*
Ga0126372_1114414413300010360Tropical Forest SoilKIADAVGYFVSENPITTGTVVSTPDAAAKPAKRS*
Ga0126377_1159486413300010362Tropical Forest SoilRLKKQQEEKKIAETVGYFVSENPITTGDLPPSASGSKTAQR*
Ga0126377_1223963023300010362Tropical Forest SoilKKIADAVGYFVAENPITTGDVSAVPSPSKATQRS*
Ga0136449_10083296133300010379Peatlands SoilKKQQEEKKIAEAVGYFVTENPITGEVNAPPPPSKTAQRS*
Ga0126344_104852313300010866Boreal Forest SoilQQEEKKIAEAVGYFTSENPITTGDVNAPPPPSKTAQRS*
Ga0138574_100678013300011076Peatlands SoilKKIAEAVGYFVSENPITTGEVKAASPGSKTVQKS*
Ga0138572_105936613300011077Peatlands SoilSWRLKKQQEEKKIGEAVGYFVSENPITTGDVNAPPPPSKTAQRS*
Ga0138539_111558323300011109Peatlands SoilEEVSREKERFTGWRLKKQQEEKKIGEAVGYFVSENPITTGDVNAPPPSSKTAQRS*
Ga0137388_1120671423300012189Vadose Zone SoilEVSREKERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPPPSKTAQHS*
Ga0137399_1099333123300012203Vadose Zone SoilKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS*
Ga0137379_1105927823300012209Vadose Zone SoilAGWRLKKQQEEKKIADAVGYFVSENPISTGPVSAQPPVSKTAQRS*
Ga0137359_1134350513300012923Vadose Zone SoilKERFTGWRLKKQQEEKKIAEAVGYFATENPITTGDVNAPPPPSKTAQRS*
Ga0137416_1007491513300012927Vadose Zone SoilQQEEKKIAEAVGYFVTENPITTGDVNTLPPPSKTLQRS*
Ga0137407_1065878423300012930Vadose Zone SoilQQEEKKIAEAVGYFVAENPITTGDVNALPPPSNTAQHS*
Ga0164303_1073856613300012957SoilKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAVPSPSPSKATQRS*
Ga0126369_1069996923300012971Tropical Forest SoilWRLKKQQEEKKIADAVGYFVSENPITTGSAVSIPDAAAKPAKRS*
Ga0126369_1340929123300012971Tropical Forest SoilSREKQRFTGWRLKKQQEEKKIAEAVGYFVEENPITIGEVSAQPSPSKVTQHS*
Ga0182024_1205910313300014501PermafrostVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAAPPPSKTAQRS*
Ga0181525_1047207813300014654BogVSREKERFSGWRLKKQQEEKKIADAVGYFVAENPITTGDVNAPPPPSNTAQRS*
Ga0134085_1013738513300015359Grasslands SoilKQQEEKKIADAVGYFVSENPITTGDSSAPPVSKTVQRS*
Ga0182041_1048255213300016294SoilRFAGWRLKKQQEEKKIADTVGYFVTENPITTGEQNVAPTSSKASQKS
Ga0182037_1137475323300016404SoilSGWRLKKQQEEKKIADTVGYFVSENPITTGDVDATSPGSKPVQKS
Ga0187819_1057087813300017943Freshwater SedimentRFTGWRLKKQQEEKKIADAVGYFVTENPITTGDLNAAPSPTKATQRS
Ga0187817_1004574813300017955Freshwater SedimentEKKIGEAVGYFVSENPITTGDVNAPPPPSKTAQRS
Ga0187781_1004135243300017972Tropical PeatlandTGWRLKKQQEEKKIGEAVGYFVSENPITTGDVNAPPPPSKTAQRS
Ga0187804_1044132213300018006Freshwater SedimentQEEKKIAEAVGYFVTENPITMGDVNAPSPSPKAAQRS
Ga0187864_1013184133300018022PeatlandEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0187875_1071099423300018035PeatlandEKTRFTGWRLKKQQEEKKIAEAVGYFVSENPITTGAAQAEPSPKTAQRS
Ga0187883_1077042213300018037PeatlandGWRLKKQQEEKKIAEAVGYFVSENPITTGAAQAEPSPKTAQRS
Ga0187855_1007430733300018038PeatlandEKERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGAVGAPVTPSKT
Ga0187890_1057817623300018044PeatlandEKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGEVKAPAPPSKTAQRS
Ga0187859_1044605013300018047PeatlandEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0187772_1086596613300018085Tropical PeatlandKQQEEKKIADTVGYFVTENPITTGEQNAAPTSSKASQKS
Ga0187771_1006880043300018088Tropical PeatlandLKKQQEEKKIADTVGYFVSENPITTGEQNTTPTSSKASQKS
Ga0187771_1104918423300018088Tropical PeatlandSREKERFSGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNSPSSPKATQRS
Ga0187770_1006606013300018090Tropical PeatlandKKQQEEKKIADTVGYFVAENPITTGGSTVAPASSKTSQRS
Ga0187796_105408423300019264PeatlandMQANSDAITRERERFAGWRLKKQQEEKKIADTVGYFVTENPITTGDVNATPPSSRSAQKS
Ga0187797_100765433300019284PeatlandETERVTGWRLKKQQEEKKIADTVGYFVAENPITTGGSTVAPASSKTSQRS
Ga0187797_111234213300019284PeatlandNSDAISRERERFTGWRLKKQQEEKKIADTVGYFVAENPITTGELNAAPTSSKASQKS
Ga0193728_118076723300019890SoilEVLREKERLTGWRLKKQQEEKKIAEAVGYFVTENPITKGDVNAPAPPAKTAQRS
Ga0210399_1128519713300020581SoilGWRLKKQQEEKKIAEAVGYFVSENPITTGEVKPTSPGTKTVQKS
Ga0210405_1017710613300021171SoilWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0210405_1075007123300021171SoilSREQERFTGWRLKKQQEEKKIADAVGYFTNENPITTGDVNAPPPPSKTAQRS
Ga0210396_1142747123300021180SoilVVLKKQQEEKKIAEAVGYFVTENPITTGDVNATPPPSKTAQRS
Ga0210388_1172437513300021181SoilFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNQTTPPSKTAQRS
Ga0210386_1135112323300021406SoilKERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPPTSKTAQRS
Ga0210390_1160137313300021474SoilFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPAPPSKTAQRS
Ga0187846_1016887113300021476BiofilmRERFTGWKLKKQQEEKKIADTVGYFVTENPITTGEQNVAPTSSKASQKS
Ga0210409_1086053923300021559SoilEEKKIAEAVGYFVTENPITTGEVNAPPPPSKTAQRS
Ga0209472_131238113300026323SoilEKERVAGWRLKKQQEEKKIADAVGYFVSENPITTGPVPAQPPVSKTAQRS
Ga0209266_129384323300026327SoilEKERFSGWRLKKQQEEKKIADAVGYFVSENPITTGAVSAQPPVSKTAQRS
Ga0257168_110900613300026514SoilEKQRFTGWLLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPTSKKATQRS
Ga0209059_105508013300026527SoilERLASWRLKKQQEEKKIADAVGYFVSENPITTGPAQTQPPVSKTARRSE
Ga0209058_109097613300026536SoilNNDEIAKEKQRFTGWRLKKQQEEKKIADAVGYFVSENPITTGDSSAPPVSKTVQRS
Ga0208366_101551323300027073Forest SoilLKKQQEEKKIAEAVGYFVTENPITTGDVNAVTSPSPSKATQRS
Ga0209218_101119613300027505Forest SoilEEKKIAEAVGYFVSENPITTGAAQAEPSPKTAQRS
Ga0207761_109468213300027516Tropical Forest SoilISREKERFAGWRLKKQQEEKKIAEAVGYFVTENPITTGDVSAPPPTPKTAPRS
Ga0209222_108391413300027559Forest SoilKQQEEKKIAEAVGYFVSENPITTGAAQAEPSPKTAQRS
Ga0209333_108195123300027676Forest SoilEEVSREKERFSGWRLKKQQEEKKIADAVGYFVAENPITTGDVNAPPPPSNTAQRS
Ga0209626_105418023300027684Forest SoilEEKKIAEAVGYFTSENPITTGDVNAPPPPSKTAQRS
Ga0209040_1053759413300027824Bog Forest SoilKKQQAEKKIAEAVGYFVSENPITTGDGNAPPPTSKTA
Ga0209180_1038667113300027846Vadose Zone SoilEVSREKERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPPPSKTAQHS
Ga0209274_1028450113300027853SoilVTREKTRFTGWRLKKQQEEKKIAEAVGYFVSENPITTGAAQAEPSPKTAQRS
Ga0209274_1050467913300027853SoilFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNTPPPPSKAAQRS
Ga0209693_1050354423300027855SoilKERFSGWRLKKQQEEKKIADAVGYFVAENPITTGDVNAPPPPSNTAQRS
Ga0209701_1021506933300027862Vadose Zone SoilLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0209380_1044259323300027889SoilNNDAISREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAVTSPSPSKATQRS
Ga0209067_1049733613300027898WatershedsNDAISREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNASPSPTKTTQRS
Ga0308309_1041039113300028906SoilRLKKQQEEKKIAEAVGYFTSENPITTGDVNAPPPPSKTAQRS
Ga0308309_1118414323300028906SoilEKKIAEAVGYFVTENPITTGDVNAVTSPSPSKATQRS
Ga0311361_1043615013300029911BogQSNNEEVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPAPSSKTAQRS
Ga0311340_1030170613300029943PalsaWRLKKQQEEKKIAEAVGYFVTENPITTGAAQAEPSPKTAQRS
Ga0311338_1115556723300030007PalsaWRLKKQQEEKKIADAVGYFVAENPITTGDVNAPPPPSNTAQRS
Ga0302176_1007865113300030057PalsaKKQQEEKKIAEAVGYFVAENPITTGDVNAPPPPSKTAQRS
Ga0311354_1028403413300030618PalsaEEKKIADAVGYFVAENPITTGDVNAPPPPSNTAQRS
Ga0311354_1067922023300030618PalsaNEEVSREKERFSSWRLKKQQEEKKIAEAVGYFVAENPITTGDVNAPPPPSKTAQRS
Ga0210269_1039587823300030627SoilKKQQEEKKIAEAVGYFVAENPITTADVNAPPPSKTAQRS
Ga0265459_1157495813300030741SoilERFTGWRLKKQQEEKKIAEAVGYFVSENPITTGDVNAPPPTSKIAQRS
Ga0265459_1359140313300030741SoilREKERFSGWRLKKQQEEKKIAEAVGYFVAENPITTADVNAPPPSKTAQRS
Ga0138302_125625013300030937SoilISREKERFTGWRLKKQQEEKKITEAVGYFTSENPITTGDVNAPPPPSKTAQRF
Ga0138303_114515413300030939SoilQEEKKIGEAVGYFVTENPITTGDVNAVPSPSPSKATQRS
Ga0265740_100279413300030940SoilTGWRLKKQQEEKKIAEAVGYFVTENPITTGAAQAEPSPKTAQRS
Ga0073998_1130456213300031023SoilERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0170834_10771646413300031057Forest SoilKKQQEEKKIAEAVGYFVSENPITTGEVKPTSPGTKTVQKS
Ga0310686_10532369213300031708SoilKKQQEEKKIAETVGYFVSENPITTGEVKPIPPSAASTGSKTVKKS
Ga0265342_1002482953300031712RhizosphereNNEEVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDLNAPAPSSKTEQRS
Ga0307473_1046587623300031820Hardwood Forest SoilKQQEEKKIAEAVGYFVTENPITTGDVNAPPPPSKTAQRS
Ga0306919_1056932223300031879SoilKQQEEKKIAEVVGYFVSENPITTGEVKPASPGTKTVQKS
Ga0306921_1137473523300031912SoilQQEEKKIAEAVGYFVTENPITTGDVNAVPSPPKATQRS
Ga0310912_1009264833300031941SoilSREKERFTGWRLKKQQEEKKIADTVGYFVAENPITTGDPGVASANPKASQRP
Ga0310916_1031123733300031942SoilFSGWRLKKQQEEKKIADTVGYFVSENPITTGDVDATSPGSKPVQKS
Ga0310909_1043305913300031947SoilEKKIAEVVGYFVSENPITTGEVKPASPGTKTVQKS
Ga0311301_1051472833300032160Peatlands SoilTGGRLKKQQEEKKIGEAVGYFVSENPITTGDVNAPPPPSKTAQRS
Ga0307471_10346466123300032180Hardwood Forest SoilFTGWRLKKQQEEKKIGDAVGYFVSENPITTGNSSAAPPVSKTVQRS
Ga0335078_1258789313300032805SoilNSDAISRERERFTGWRLKKQQEEKKIADTVGYFVSENPITTGDLNAAPESSKTQRS
Ga0335080_1189076623300032828SoilKQQEEKKIAEAVGYFVTENPITTGDVNSAPSPATVTQRS
Ga0335075_1013450443300032896SoilEEKKIAEAVGYFVTENPITTGEVSASSSPIKVAQRS
Ga0335071_1084285623300032897SoilRLKKQQEEKKIADAVGYFVTENPITTGDVNAAPPSSKKQQNS
Ga0335083_1015413513300032954SoilLKKQQEEKKIAEAVGYFVTENPITTGEISASSSPIKVAQRS
Ga0334811_164029_372_5453300033891SoilNNEEVSREKERFTGWRLKKQQEEKKIAEAVGYFVTENPITTGDLNAPPPPSKTAQRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.