| Basic Information | |
|---|---|
| Family ID | F059210 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGS |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.15 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 96.27 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.030 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (50.746 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.672 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 94.03 |
| PF07485 | DUF1529 | 2.24 |
| PF00072 | Response_reg | 1.49 |
| PF13531 | SBP_bac_11 | 0.75 |
| PF00083 | Sugar_tr | 0.75 |
| PF02777 | Sod_Fe_C | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.03 % |
| Unclassified | root | N/A | 5.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10482321 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300004091|Ga0062387_101613975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300004281|Ga0066397_10163735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 517 | Open in IMG/M |
| 3300004635|Ga0062388_102527361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300005177|Ga0066690_10553732 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300005556|Ga0066707_10495186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300005764|Ga0066903_108440845 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006175|Ga0070712_100807602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300006804|Ga0079221_10278786 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006804|Ga0079221_11727860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300006854|Ga0075425_102805254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 536 | Open in IMG/M |
| 3300006893|Ga0073928_10456137 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006904|Ga0075424_102009425 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009088|Ga0099830_11598354 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009143|Ga0099792_10855179 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300010048|Ga0126373_12714553 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010359|Ga0126376_12414189 | Not Available | 573 | Open in IMG/M |
| 3300010361|Ga0126378_12266990 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300010373|Ga0134128_12951720 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010376|Ga0126381_102515957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300010376|Ga0126381_102811246 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300010376|Ga0126381_104084115 | Not Available | 567 | Open in IMG/M |
| 3300010398|Ga0126383_11794224 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300010398|Ga0126383_12711492 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300011269|Ga0137392_10127541 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300012362|Ga0137361_10331983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1394 | Open in IMG/M |
| 3300012923|Ga0137359_11090885 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012924|Ga0137413_10787620 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012927|Ga0137416_10293573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1345 | Open in IMG/M |
| 3300015242|Ga0137412_10544240 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300015371|Ga0132258_11289090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1846 | Open in IMG/M |
| 3300016270|Ga0182036_11605915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 548 | Open in IMG/M |
| 3300016294|Ga0182041_11011212 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300016294|Ga0182041_11277867 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300016319|Ga0182033_10319852 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300016319|Ga0182033_12011550 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300016357|Ga0182032_11445084 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300016371|Ga0182034_10195473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1560 | Open in IMG/M |
| 3300016371|Ga0182034_11094681 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300016404|Ga0182037_10369018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| 3300016422|Ga0182039_10303472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1324 | Open in IMG/M |
| 3300016422|Ga0182039_10528788 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300016445|Ga0182038_10554347 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300016445|Ga0182038_11951696 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020581|Ga0210399_10403632 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300020583|Ga0210401_11326708 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300021168|Ga0210406_11154996 | Not Available | 566 | Open in IMG/M |
| 3300021170|Ga0210400_11221023 | Not Available | 605 | Open in IMG/M |
| 3300021358|Ga0213873_10226540 | Not Available | 586 | Open in IMG/M |
| 3300021432|Ga0210384_11284284 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021478|Ga0210402_11014316 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300022527|Ga0242664_1003063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1909 | Open in IMG/M |
| 3300024330|Ga0137417_1071063 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031057|Ga0170834_112658878 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031231|Ga0170824_118847077 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031446|Ga0170820_14818239 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300031544|Ga0318534_10182402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 3300031545|Ga0318541_10154054 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300031545|Ga0318541_10458752 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031561|Ga0318528_10323375 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300031573|Ga0310915_10049536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2707 | Open in IMG/M |
| 3300031573|Ga0310915_10139220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1671 | Open in IMG/M |
| 3300031573|Ga0310915_10161844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1552 | Open in IMG/M |
| 3300031573|Ga0310915_10171635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300031573|Ga0310915_10803828 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031679|Ga0318561_10765259 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031680|Ga0318574_10322676 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300031680|Ga0318574_10836862 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031713|Ga0318496_10615505 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031719|Ga0306917_10829625 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300031723|Ga0318493_10820037 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031724|Ga0318500_10076686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1480 | Open in IMG/M |
| 3300031744|Ga0306918_10256929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1335 | Open in IMG/M |
| 3300031747|Ga0318502_10254067 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031747|Ga0318502_10476032 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031753|Ga0307477_10350342 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031754|Ga0307475_10289405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
| 3300031763|Ga0318537_10295556 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031765|Ga0318554_10494298 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031768|Ga0318509_10517142 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031771|Ga0318546_10922172 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300031777|Ga0318543_10040992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1853 | Open in IMG/M |
| 3300031781|Ga0318547_10373357 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031781|Ga0318547_10898094 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031794|Ga0318503_10075658 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300031795|Ga0318557_10319539 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031796|Ga0318576_10368933 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031797|Ga0318550_10548981 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300031798|Ga0318523_10548659 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031819|Ga0318568_10672256 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031821|Ga0318567_10709796 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031833|Ga0310917_11075574 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031846|Ga0318512_10663990 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031859|Ga0318527_10355242 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031859|Ga0318527_10498670 | Not Available | 519 | Open in IMG/M |
| 3300031879|Ga0306919_10092428 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300031879|Ga0306919_11052550 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300031880|Ga0318544_10137415 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300031890|Ga0306925_11914541 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031893|Ga0318536_10246382 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031893|Ga0318536_10616245 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031896|Ga0318551_10671503 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031912|Ga0306921_10616593 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300031912|Ga0306921_10897332 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300031912|Ga0306921_11871461 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031941|Ga0310912_10614625 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300031942|Ga0310916_10521603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1012 | Open in IMG/M |
| 3300031942|Ga0310916_10724806 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300031942|Ga0310916_11604313 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300031954|Ga0306926_10180224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2620 | Open in IMG/M |
| 3300031962|Ga0307479_10684658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300032001|Ga0306922_11678769 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300032025|Ga0318507_10361733 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300032041|Ga0318549_10060140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
| 3300032042|Ga0318545_10264233 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032042|Ga0318545_10273926 | Not Available | 606 | Open in IMG/M |
| 3300032051|Ga0318532_10316656 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300032054|Ga0318570_10444710 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032055|Ga0318575_10513293 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300032055|Ga0318575_10561781 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032059|Ga0318533_10412377 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300032059|Ga0318533_10897069 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032059|Ga0318533_11324391 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300032060|Ga0318505_10485976 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300032063|Ga0318504_10445984 | Not Available | 618 | Open in IMG/M |
| 3300032064|Ga0318510_10510930 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300032076|Ga0306924_10269478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1955 | Open in IMG/M |
| 3300032094|Ga0318540_10091941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
| 3300032261|Ga0306920_100312648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2339 | Open in IMG/M |
| 3300032261|Ga0306920_101869686 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300032261|Ga0306920_102970234 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300033289|Ga0310914_10695824 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300033290|Ga0318519_10812173 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300033290|Ga0318519_10813729 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 50.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_104823212 | 3300001867 | Forest Soil | MSRRIKSLQARLTLELGLLFIVASCLAVGGLIYSSSLTAGSLADRELGLRAEDL |
| Ga0062387_1016139752 | 3300004091 | Bog Forest Soil | MRRRIKSLQLRLTIELAALFLVASCLAVGGLIYSASLTAGSLADR |
| Ga0066397_101637352 | 3300004281 | Tropical Forest Soil | MSRRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLTAGSLADREL |
| Ga0062388_1025273611 | 3300004635 | Bog Forest Soil | MTRRIKSLQLRLTIELGVLFLVASGLAIAGLIYSASLTAGSVADRELD |
| Ga0066690_105537321 | 3300005177 | Soil | MNRRIKSLQLRLTVELAALFFVASCLAVGGLIYSAALTAGSVAD |
| Ga0066707_104951862 | 3300005556 | Soil | MSRRIKSLQLRLTIELAALFLVASCLAIGGLIYGASLTAGSLA |
| Ga0066903_1084408452 | 3300005764 | Tropical Forest Soil | MSRRIKSLQLRLTVELAVLFLVASCLAVGGLIYSASL |
| Ga0070712_1008076021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRRIKSLQLRLTIELGALFLVASCLAMGGLIYSASLTAGSVANRELE |
| Ga0079221_102787861 | 3300006804 | Agricultural Soil | MRRRIKSLQLRLTVELGALFLVASCLAMGGLIYSASLTAGSVAD |
| Ga0079221_117278602 | 3300006804 | Agricultural Soil | MSRRIKSLQLRLMVELAALFFVASCLAVGGLIYSASLTAGSLANRE |
| Ga0075425_1028052541 | 3300006854 | Populus Rhizosphere | MSGRIKSLQFRLTVELAALFFVASCLAVGGLIYSASLTAGSLADRELGLRAE |
| Ga0073928_104561371 | 3300006893 | Iron-Sulfur Acid Spring | MSRRVKSLQLRLTLELAALFFVASCLAVGGLIYSASLTA |
| Ga0075424_1020094251 | 3300006904 | Populus Rhizosphere | MSGRIKSLQFRLTVELAALFFVASCLAVGGLIYSAS |
| Ga0099830_115983542 | 3300009088 | Vadose Zone Soil | VRLRLKSLQLRLTVELAALFLVASCLAVGGLLYSASLTA |
| Ga0099792_108551791 | 3300009143 | Vadose Zone Soil | VSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSVA |
| Ga0126373_127145531 | 3300010048 | Tropical Forest Soil | VSRRIKSLQLRLTLELTALFLVASCLAVGGLLYSASLTAGSLADREL |
| Ga0126376_124141891 | 3300010359 | Tropical Forest Soil | MSRRIKSLQLRLTIELAALFLVASCLAVGGLIYSASLAAGS |
| Ga0126378_122669901 | 3300010361 | Tropical Forest Soil | MSRRVKSLQLRLTLELGALFLMASCLAMGGLIYSASLTAGSVAD |
| Ga0134128_129517201 | 3300010373 | Terrestrial Soil | MSGRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTAGSL |
| Ga0126381_1025159571 | 3300010376 | Tropical Forest Soil | MSRRIKSLQLRLTVELGALFLAASCLAMGGLIYSASLTAG |
| Ga0126381_1028112462 | 3300010376 | Tropical Forest Soil | MSRRIKSLQLRLTIELAALFFVASCLAVGGLIYSASL |
| Ga0126381_1040841152 | 3300010376 | Tropical Forest Soil | MSRRVKSLQLRLTIELGALFFVASCLAMGGLIYSA |
| Ga0126383_117942241 | 3300010398 | Tropical Forest Soil | MSRRIKSLQLRLTVELAVLFLVASCLALGGLIYSA |
| Ga0126383_127114922 | 3300010398 | Tropical Forest Soil | VRHRFKSLQLRLTAELAALFLVASCLALGGLFYSASLT |
| Ga0137392_101275412 | 3300011269 | Vadose Zone Soil | VSRRIKSLQLGLTIELGAFFLVASCLAIGGLIYSASLTADLYVSLQ* |
| Ga0137361_103319833 | 3300012362 | Vadose Zone Soil | MSRRIKSLQLRLILELAALFFVASCLAVAGLIYSASRTAGSLMDR |
| Ga0137359_110908851 | 3300012923 | Vadose Zone Soil | MRRRLKSLQLRLTLELAALFLVASCLAVAGLIYNASLTAGS |
| Ga0137413_107876201 | 3300012924 | Vadose Zone Soil | MSRRIKSLQLRLTIELAALFLVASFLAIGGLIYGASLTAGSLADR |
| Ga0137416_102935733 | 3300012927 | Vadose Zone Soil | MSRRIKSLQLRLILELAALFFVASCLAVAGLIYSASRTAGSLMD |
| Ga0137412_105442402 | 3300015242 | Vadose Zone Soil | MSRRIKSLQLRLTIELAALFLVASFLAIGGLIYGAS |
| Ga0132258_112890901 | 3300015371 | Arabidopsis Rhizosphere | MRRRIKSLQLRLTVELGALFLVTSCLAMGGLIYSASLTAGSVADR |
| Ga0182036_116059151 | 3300016270 | Soil | MSRHIKSLQLRLTLELALLFLVASCLAVGGLIYSASLTAGSLADR |
| Ga0182041_110112122 | 3300016294 | Soil | MSRRIKSLQLRLTVELAALIFVASCFAVGGLIYSASLTAGSLADR |
| Ga0182041_112778672 | 3300016294 | Soil | MSRRIKSLQLRLTVELGLLFLVASFLAVGGLIYSASLTAGSLADR |
| Ga0182033_103198524 | 3300016319 | Soil | MSRVTKSLQRRLTVELAALFLLASGLAVGGLIYSASLTADSLADRELGL |
| Ga0182033_120115501 | 3300016319 | Soil | MSRRIKSLQIRLTVELAALFFVASCLAVGGLIYSASLTA |
| Ga0182032_114450842 | 3300016357 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSL |
| Ga0182034_101954731 | 3300016371 | Soil | MNYRIKSLQLRLTLELAALFFVASCLAVVGLIYSASLTAGSLAD |
| Ga0182034_110946812 | 3300016371 | Soil | MSRRIKSLQLRLTVELAALFFVASFLAVGGLIYSASL |
| Ga0182037_103690181 | 3300016404 | Soil | MTRWVKSLQLRLTVELAALFFVASCLAVGGLIYSAAMT |
| Ga0182039_103034721 | 3300016422 | Soil | MSRRRKSLQLRLTIELAALFFVASCLAVGGLIYSASLTAGS |
| Ga0182039_105287882 | 3300016422 | Soil | MSRRIKSLQLRLTVELAALFFVASFLAVGGLIYSASLTAGSLADR |
| Ga0182038_105543471 | 3300016445 | Soil | MSRRIKSLQLRLTVELAALFFVASFLAVGGLIYSAS |
| Ga0182038_119516961 | 3300016445 | Soil | MSRRIKSLQLRLTVELAALFLAASCLAVGGLIYSASL |
| Ga0210399_104036324 | 3300020581 | Soil | MSRRIKSLQLRLTIELGALFLVASCLAMGGLIYSASLTAGSLANRE |
| Ga0210401_113267081 | 3300020583 | Soil | MRRHIKSLQLRLTLELAALFFVASCLAVGGLVYSASRTAGSLVDREL |
| Ga0210406_111549962 | 3300021168 | Soil | VTGRIRSLQLRLTLELTALFVISSALALGGLIYNASLTADSLADRDLG |
| Ga0210400_112210231 | 3300021170 | Soil | VRLQNKSLQLRLTLELAALFFVASCLAVGGLMYSAAVTADS |
| Ga0213873_102265402 | 3300021358 | Rhizosphere | MTRWIKSLQLRLTIELGALFLVASGLAMAGLIYSASLRTLAKIT |
| Ga0210384_112842841 | 3300021432 | Soil | VTRRIKSLQLRLTIELAALFFVASCLAVGGLIYSASLTAGSVANRELGL |
| Ga0210402_110143162 | 3300021478 | Soil | MSRRIKSLQLRLTVELGGLFLVASCLAMGGLIYSASLT |
| Ga0242664_10030633 | 3300022527 | Soil | LRLTIELAALFFVASCLAVGGLVYSASRTAGPLVDRELGLRASNPG |
| Ga0137417_10710631 | 3300024330 | Vadose Zone Soil | MSRRIKSLQLRLTIELAALFLVASCLALGGLIYGASLTAGS |
| Ga0170834_1126588781 | 3300031057 | Forest Soil | MSRRIKSLQSRLTIELGALFLVASCLAVGGLIYSASLTAGS |
| Ga0170824_1188470772 | 3300031231 | Forest Soil | MSRRIKSLQLRLTIELTALFLLASGLAVGGLIYSAW |
| Ga0170820_148182393 | 3300031446 | Forest Soil | MSRRIESLQLRLTIELAALFFVASCLAVGGLIYSASLTSGSLAD |
| Ga0318534_101824023 | 3300031544 | Soil | MSRRIKSLQLRLTLELALLFLVASCLAVGGLIYSASLTA |
| Ga0318541_101540541 | 3300031545 | Soil | MSRVTKSLQRRLTVELAALFLLASGLAVGGLIYSASLTADSLADRELG |
| Ga0318541_104587522 | 3300031545 | Soil | MSRRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLTAGSLAD |
| Ga0318528_103233752 | 3300031561 | Soil | MSRRLKSLQLRLTLELAALFFVASCLGVGGLIYSASL |
| Ga0310915_100495365 | 3300031573 | Soil | MSRRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLT |
| Ga0310915_101392204 | 3300031573 | Soil | MSRRIRSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSLADRE |
| Ga0310915_101618443 | 3300031573 | Soil | MSRVTKSLQRRLTVELAALFLLASGLAVGGLIYSASLTAD |
| Ga0310915_101716351 | 3300031573 | Soil | MSRRIKSLQIRLTVELAALFFVASCLAVGGLIYSASL |
| Ga0310915_108038282 | 3300031573 | Soil | MSRRIKSLQFRLTLELATLFFVASCLAVGGLIYSASLT |
| Ga0318561_107652592 | 3300031679 | Soil | MSRRIKSLQLRLTIELAALFLIASCLAVGGLIYSASL |
| Ga0318574_103226761 | 3300031680 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSV |
| Ga0318574_108368621 | 3300031680 | Soil | MSRRIKSLQLRLTLELAGLFFVASCLAVGGLIYSASLTGGS |
| Ga0318496_106155051 | 3300031713 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSAS |
| Ga0306917_108296252 | 3300031719 | Soil | MSRRIKSLQLRLTIELAVLFLVASCLALGGLIYSASLTAGSV |
| Ga0318493_108200371 | 3300031723 | Soil | MSRRIKSLQLRLTVELGALFLVASCLAVGGLIYSASSTAGS |
| Ga0318500_100766863 | 3300031724 | Soil | MTRWVKSLQLRLTVELAALFFVASCLAVGGLIYSAAMTAGSLADREL |
| Ga0306918_102569293 | 3300031744 | Soil | MSRRIKSLQIRLTVELAALFFVASCLAVGGLIYSASLT |
| Ga0318502_102540672 | 3300031747 | Soil | MSGRIKSLQLRLTIELAALFLLASGLAVGGLVYSASLTADS |
| Ga0318502_104760321 | 3300031747 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGS |
| Ga0307477_103503422 | 3300031753 | Hardwood Forest Soil | MSRRIKSLQLRLTIELGALFLVASCLAVGGLIYSASLTTGSVANRELELRAE |
| Ga0307475_102894053 | 3300031754 | Hardwood Forest Soil | MSRRIKSLQLRLTLELALLFLVASCLAVGGLIYSASLTAGSLADCELGLRA |
| Ga0318537_102955561 | 3300031763 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSVADRKHRLLS |
| Ga0318554_104942981 | 3300031765 | Soil | MSRRLKSLQLRLTLELAALFFVASCLGVGGLIYSASLT |
| Ga0318509_105171421 | 3300031768 | Soil | MSRRIKSLQLRLTVELGLLFFVASCLAVGGLIYSASL |
| Ga0318546_109221721 | 3300031771 | Soil | MSRRIKSLQLRLTVELGALFLVASCLALGGLIYSASLTAGS |
| Ga0318543_100409923 | 3300031777 | Soil | MSRRIKSLQLRLTVELGALFLVASCLAVGGLIYSASLTAGSLADREL |
| Ga0318547_103733571 | 3300031781 | Soil | MSRRIKSLQIRLTVELAALFFVASCLAVGGLIYSASLTAR |
| Ga0318547_108980941 | 3300031781 | Soil | MSRRIKSLQLRLTLELAGLFFVASCLAVGGLIYSASLTAGSLADRE |
| Ga0318503_100756582 | 3300031794 | Soil | MNYRIKSLQLRLTLELAALFFVASCLAVVGLIYSASLTAGSLADRELGL |
| Ga0318557_103195393 | 3300031795 | Soil | MTRRIKSLQLRLTVELAALFFVASCLAVGGLIYSAAMTAGS |
| Ga0318576_103689332 | 3300031796 | Soil | MSRRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLTAG |
| Ga0318550_105489811 | 3300031797 | Soil | MSRRIKSLQLRLTVELGALFLVASCLAVGGLIYSASLTAGSL |
| Ga0318523_105486591 | 3300031798 | Soil | MSGRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLT |
| Ga0318568_106722561 | 3300031819 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLT |
| Ga0318567_107097962 | 3300031821 | Soil | MSRRIKSLQLRLTLELAALFFIASCLAVGGLIYSASLTAG |
| Ga0310917_110755742 | 3300031833 | Soil | MSRRIKSLQLRLTVELAALFFVASFLAVGGLIYSASLT |
| Ga0318512_106639901 | 3300031846 | Soil | MSRRIKSLQLRLTVELGALFLVASCLAVGGLIYSASLT |
| Ga0318527_103552422 | 3300031859 | Soil | MSRRIKSLQLRLTLELAALFFVASCLAVGGLIYSASLTAGSLADRELGL |
| Ga0318527_104986701 | 3300031859 | Soil | MSRHIKSLQLRLTLELALLFLVASSLAVGGLIYSASLTAGSLADR |
| Ga0306919_100924282 | 3300031879 | Soil | MSRRIKSLQLRLTVELAALFFVASCFAVGVSFTAHR |
| Ga0306919_110525501 | 3300031879 | Soil | MSRRIKSLQLRLTLELAALFFVASCLAVGGLIYSASL |
| Ga0318544_101374152 | 3300031880 | Soil | MSRRIKSLQLRLTIELAALFLVASCLAVGGLIYSASL |
| Ga0306925_119145412 | 3300031890 | Soil | MSGRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTAGSLADRELG |
| Ga0318536_102463822 | 3300031893 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTAGSLADR |
| Ga0318536_106162452 | 3300031893 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSLA |
| Ga0318551_106715031 | 3300031896 | Soil | MSRRIKSLQIRLTVELAALFFVASCLAVGGLIYSASLTAGSLADRELGLRAEDL |
| Ga0306921_106165933 | 3300031912 | Soil | MSHRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLTAGSL |
| Ga0306921_108973321 | 3300031912 | Soil | MSRRIKSLQLRLTLELAALFFIASCLAMGGLIYSASL |
| Ga0306921_118714612 | 3300031912 | Soil | MSRRIKSLQLRLTIELAALFFVASCLAVGGLIYSASLTAGSLAD |
| Ga0310912_106146251 | 3300031941 | Soil | MSRQIKSLQLRLTLELAALFFLASCLAVGGLTYSASLTAGSLADRELGLR |
| Ga0310916_105216034 | 3300031942 | Soil | MSQRIKSLQLRLTVELGALFLVASCLAVGGLIYSAS |
| Ga0310916_107248062 | 3300031942 | Soil | MTRRIKSLQLRLTVELAALFVVASCLAVGGLIYSASLTA |
| Ga0310916_116043131 | 3300031942 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTAGSL |
| Ga0306926_101802241 | 3300031954 | Soil | MSRRIKSLQLRLTVELGLLFFVASCLAVGGLIYSASLTAGSLADRELG |
| Ga0307479_106846583 | 3300031962 | Hardwood Forest Soil | MSRRIKSLQLRLTLELALLFLVASSLAVGGLIYSASLTAGSLA |
| Ga0306922_116787692 | 3300032001 | Soil | VSRRIKSLQLRLTLELAALFFIASCLAVGGLIYSASLTAGSLAD |
| Ga0318507_103617332 | 3300032025 | Soil | MTRRIKSLQLRLTVELAALFVVASCLAVGGLIYSAS |
| Ga0318549_100601401 | 3300032041 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTAGSLA |
| Ga0318545_102642331 | 3300032042 | Soil | MSRRIKSLQLRLTVELGALFLVASCLALGGLIYSASLTAGSVANRELE |
| Ga0318545_102739261 | 3300032042 | Soil | MSRRIKSLQLRLTIELAALFLVASCLAVGGLIYSASLAAGSLADREL |
| Ga0318532_103166561 | 3300032051 | Soil | MSHRIKSLQLRLTLELAALFLVASCLAVGGLIYSASLTAGSLAD |
| Ga0318570_104447102 | 3300032054 | Soil | MNYRIKSLQLRLTLELAALFFVASCLAVVGLIYSASLTAG |
| Ga0318575_105132931 | 3300032055 | Soil | VSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSAAMTAGSL |
| Ga0318575_105617811 | 3300032055 | Soil | MSRRIKSLQLRLTLELAALFFVASCLAVGGLIYSASLTAGS |
| Ga0318533_104123772 | 3300032059 | Soil | MSRRIKSLQLRLTVELAALFLVASCLAVGGLIYSASLTAGSVADRELD |
| Ga0318533_108970692 | 3300032059 | Soil | MTRRIKSLQLRLTVELAALFVVASCLAVGGLIYSASLTAGSLT |
| Ga0318533_113243911 | 3300032059 | Soil | MSRRIKSLQLRLTLELAALFFIASCLAVGGLIYSASLTAGS |
| Ga0318505_104859761 | 3300032060 | Soil | MSRRIKSLQLRLTLELAGLFFVASCLAVGGLIYSASLTAGSLA |
| Ga0318504_104459841 | 3300032063 | Soil | MSRRIKSLQLRLTIELAALFLVASCLAVGGLIYSASLAAGSLAD |
| Ga0318510_105109301 | 3300032064 | Soil | MSRRIKSLQLRLTVELAALFFVASCLAVGGLIYSASLTA |
| Ga0306924_102694784 | 3300032076 | Soil | MSRRIKSLQLRLTVELGALFLVASCLAVGGLIYSASLTA |
| Ga0318540_100919411 | 3300032094 | Soil | MSRRIKSLQLRLTVEFGLLFFVASCLAVGGLIYSASLTAG |
| Ga0306920_1003126484 | 3300032261 | Soil | MSRRIKSLQLRLTVELAALFFVASCFAVGGLIYSAS |
| Ga0306920_1018696861 | 3300032261 | Soil | VRLPVKSLQLRLTLELTALFIVAGGLAVGGLVYSAMLTANSLSDRDLSLRAL |
| Ga0306920_1029702341 | 3300032261 | Soil | MSGRIKSLQLRLTAELGVLFLLASALAVGGLTYSASLTADSLADR |
| Ga0310914_106958241 | 3300033289 | Soil | MSRRIKSLQLRLTLELAALFFVASCLAVGGLIYSASLT |
| Ga0318519_108121732 | 3300033290 | Soil | MSRRIKSLQLRLTVELAALIFVASCFAVGGLIYSAS |
| Ga0318519_108137292 | 3300033290 | Soil | MSRRIKSLQLRLTLELAALFLVSSCLAVGGLIYSASLTAGS |
| ⦗Top⦘ |