| Basic Information | |
|---|---|
| Family ID | F059204 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GVKHASYAEIPSDLGHRAWRAAPETPEGHFIDQQIRAFLAKVE |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.79 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.866 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.284 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.761 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF09361 | Phasin_2 | 73.13 |
| PF01957 | NfeD | 14.93 |
| PF00768 | Peptidase_S11 | 3.73 |
| PF01145 | Band_7 | 2.99 |
| PF16200 | Band_7_C | 1.49 |
| PF02880 | PGM_PMM_III | 1.49 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 3.73 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.49 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 1.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.87 % |
| Unclassified | root | N/A | 23.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101CTJ6F | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300005176|Ga0066679_10850578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300005187|Ga0066675_11399426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300005561|Ga0066699_10552735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300006032|Ga0066696_10602113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
| 3300006175|Ga0070712_101023858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300006806|Ga0079220_12101529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300009012|Ga0066710_104582214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300009088|Ga0099830_11363331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300009089|Ga0099828_10238195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1629 | Open in IMG/M |
| 3300009089|Ga0099828_11940538 | Not Available | 516 | Open in IMG/M |
| 3300009137|Ga0066709_101302364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1065 | Open in IMG/M |
| 3300009143|Ga0099792_10884402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300010043|Ga0126380_10192961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1355 | Open in IMG/M |
| 3300010047|Ga0126382_12051007 | Not Available | 546 | Open in IMG/M |
| 3300010048|Ga0126373_10625133 | Not Available | 1131 | Open in IMG/M |
| 3300010048|Ga0126373_12651037 | Not Available | 559 | Open in IMG/M |
| 3300010167|Ga0123353_12412070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300010333|Ga0134080_10393299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300010359|Ga0126376_10655751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1002 | Open in IMG/M |
| 3300010361|Ga0126378_11313098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300010361|Ga0126378_13273770 | Not Available | 515 | Open in IMG/M |
| 3300010376|Ga0126381_100238098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2458 | Open in IMG/M |
| 3300010376|Ga0126381_101309383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300010398|Ga0126383_11421241 | Not Available | 783 | Open in IMG/M |
| 3300010398|Ga0126383_12242280 | Not Available | 632 | Open in IMG/M |
| 3300010398|Ga0126383_12521875 | Not Available | 598 | Open in IMG/M |
| 3300010854|Ga0126360_1014080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300010862|Ga0126348_1008879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300011120|Ga0150983_12953505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300012202|Ga0137363_10711381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300012285|Ga0137370_10958390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012363|Ga0137390_11593524 | Not Available | 591 | Open in IMG/M |
| 3300012391|Ga0134035_1156782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300012405|Ga0134041_1160445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300012918|Ga0137396_10327690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1133 | Open in IMG/M |
| 3300012971|Ga0126369_10366396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1468 | Open in IMG/M |
| 3300016319|Ga0182033_10338472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1254 | Open in IMG/M |
| 3300016319|Ga0182033_12165391 | Not Available | 507 | Open in IMG/M |
| 3300016357|Ga0182032_12034039 | Not Available | 504 | Open in IMG/M |
| 3300016357|Ga0182032_12035837 | Not Available | 504 | Open in IMG/M |
| 3300016387|Ga0182040_10366318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1122 | Open in IMG/M |
| 3300016404|Ga0182037_10837273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300016422|Ga0182039_10163019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1741 | Open in IMG/M |
| 3300016422|Ga0182039_10468560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300016445|Ga0182038_11006372 | Not Available | 738 | Open in IMG/M |
| 3300018482|Ga0066669_10448029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1107 | Open in IMG/M |
| 3300020583|Ga0210401_10469080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300021168|Ga0210406_11219343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300021168|Ga0210406_11248933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300021358|Ga0213873_10321980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300021405|Ga0210387_10849428 | Not Available | 805 | Open in IMG/M |
| 3300021406|Ga0210386_10129266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2095 | Open in IMG/M |
| 3300021441|Ga0213871_10061328 | Not Available | 1048 | Open in IMG/M |
| 3300021476|Ga0187846_10492437 | Not Available | 501 | Open in IMG/M |
| 3300021560|Ga0126371_10673681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1183 | Open in IMG/M |
| 3300021560|Ga0126371_10704110 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300021560|Ga0126371_11357117 | Not Available | 843 | Open in IMG/M |
| 3300021560|Ga0126371_11599523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300021560|Ga0126371_12825814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300022510|Ga0242652_1043663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300022525|Ga0242656_1016844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300022525|Ga0242656_1130300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300022530|Ga0242658_1145460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300022533|Ga0242662_10151962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300022708|Ga0242670_1023896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300022708|Ga0242670_1037008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300022726|Ga0242654_10075530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1011 | Open in IMG/M |
| 3300025910|Ga0207684_10295825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
| 3300025929|Ga0207664_10866705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 811 | Open in IMG/M |
| 3300026494|Ga0257159_1090960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300027783|Ga0209448_10011517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2843 | Open in IMG/M |
| 3300027903|Ga0209488_10201845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1498 | Open in IMG/M |
| 3300028047|Ga0209526_10025835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4119 | Open in IMG/M |
| 3300028536|Ga0137415_11490861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300030730|Ga0307482_1130230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300030730|Ga0307482_1189792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300030763|Ga0265763_1051848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300030839|Ga0073999_11110302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300030937|Ga0138302_1408800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300030969|Ga0075394_11882718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300031057|Ga0170834_112838244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1645 | Open in IMG/M |
| 3300031446|Ga0170820_12488340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1000 | Open in IMG/M |
| 3300031543|Ga0318516_10069343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella → Stella humosa | 1952 | Open in IMG/M |
| 3300031543|Ga0318516_10376147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300031545|Ga0318541_10332787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300031549|Ga0318571_10189153 | Not Available | 731 | Open in IMG/M |
| 3300031564|Ga0318573_10214065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
| 3300031573|Ga0310915_10352549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300031640|Ga0318555_10195369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
| 3300031677|Ga0307480_1015151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031680|Ga0318574_10124752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
| 3300031680|Ga0318574_10280896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
| 3300031747|Ga0318502_10238175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300031753|Ga0307477_10865662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300031771|Ga0318546_10300964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
| 3300031777|Ga0318543_10468170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031778|Ga0318498_10456009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031781|Ga0318547_10862661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031782|Ga0318552_10326940 | Not Available | 780 | Open in IMG/M |
| 3300031782|Ga0318552_10563409 | Not Available | 581 | Open in IMG/M |
| 3300031793|Ga0318548_10439004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300031797|Ga0318550_10309937 | Not Available | 766 | Open in IMG/M |
| 3300031797|Ga0318550_10381130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300031799|Ga0318565_10289059 | Not Available | 797 | Open in IMG/M |
| 3300031833|Ga0310917_10286062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
| 3300031845|Ga0318511_10381288 | Not Available | 644 | Open in IMG/M |
| 3300031859|Ga0318527_10531847 | Not Available | 502 | Open in IMG/M |
| 3300031890|Ga0306925_11709240 | Not Available | 607 | Open in IMG/M |
| 3300031893|Ga0318536_10625737 | Not Available | 537 | Open in IMG/M |
| 3300031894|Ga0318522_10039983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1626 | Open in IMG/M |
| 3300031897|Ga0318520_10235262 | Not Available | 1089 | Open in IMG/M |
| 3300031897|Ga0318520_11034032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300031910|Ga0306923_10212099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2214 | Open in IMG/M |
| 3300031912|Ga0306921_10244454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2102 | Open in IMG/M |
| 3300031942|Ga0310916_10019298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4785 | Open in IMG/M |
| 3300031942|Ga0310916_11762067 | Not Available | 500 | Open in IMG/M |
| 3300032009|Ga0318563_10638417 | Not Available | 573 | Open in IMG/M |
| 3300032025|Ga0318507_10165544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300032039|Ga0318559_10267121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300032043|Ga0318556_10003154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 5981 | Open in IMG/M |
| 3300032059|Ga0318533_10026577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3715 | Open in IMG/M |
| 3300032059|Ga0318533_10311713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
| 3300032059|Ga0318533_10607958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300032059|Ga0318533_11159569 | Not Available | 566 | Open in IMG/M |
| 3300032068|Ga0318553_10202446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1035 | Open in IMG/M |
| 3300032180|Ga0307471_101287771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 893 | Open in IMG/M |
| 3300032261|Ga0306920_100500668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
| 3300032515|Ga0348332_13002951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300032515|Ga0348332_13874812 | Not Available | 863 | Open in IMG/M |
| 3300033289|Ga0310914_10068309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2982 | Open in IMG/M |
| 3300033289|Ga0310914_10077506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2813 | Open in IMG/M |
| 3300033290|Ga0318519_10852259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300034672|Ga0314797_132339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.49% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.75% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010854 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030839 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_07004950 | 2189573001 | Grass Soil | KQALYAEIPSDLGHRAARPAPETPEGEFIDCQIRAFLAKLE |
| Ga0066679_108505782 | 3300005176 | Soil | KQASYAEIPSSLGHRAARPAPGTTEGEFVDRQIRIFLTKVE* |
| Ga0066675_113994261 | 3300005187 | Soil | ARRIRDGVKQTSYAEIPSDLGHRAARPIPGSPETDFIDQQIRTFLARTE* |
| Ga0066699_105527352 | 3300005561 | Soil | VKQASYAEIPSSLGHRAARPAPGTPEGEFVDRQIRIFLTKVE* |
| Ga0066696_106021131 | 3300006032 | Soil | ARKIRDGVKQASYAEIPSSLGHRAARPAPGTPEGEFVDRQIRIFLTKVE* |
| Ga0070712_1010238582 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RDGVKQARYAEIPSDLGHRAARVTPGTPEADFIDRQIRAFLAKVE* |
| Ga0079220_121015292 | 3300006806 | Agricultural Soil | KQARYAEIPSDLGHRAARPAPGTPEGDFIDRQIRALLAKVE* |
| Ga0066710_1045822141 | 3300009012 | Grasslands Soil | GIRQTTYAEIPSDLGHRAVRALPGTPEGNFIDRQIRGFLATSMNRAGN |
| Ga0099830_113633312 | 3300009088 | Vadose Zone Soil | RDGIRQATYAEIPSDLGHRAVRAPPGTPEGNFIDRQIRGFLATLMNRAGN* |
| Ga0099828_102381951 | 3300009089 | Vadose Zone Soil | VYVEIPTDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE* |
| Ga0099828_119405381 | 3300009089 | Vadose Zone Soil | GARRIRDGIPQATYAEIPFDLGHRAVRGLPGTPEGDFIDRQVRGFLVTLTGSPAD* |
| Ga0066709_1013023641 | 3300009137 | Grasslands Soil | KHASYAEIPSDLGHRAARAAEGTPERDFIDHQIRAFLASIE* |
| Ga0099792_108844021 | 3300009143 | Vadose Zone Soil | QIRDGVKQASYAEISSDLGHRATRPAPGTPEGEFIDHQIRALLAKVE* |
| Ga0126380_101929611 | 3300010043 | Tropical Forest Soil | LGVEGARRIRDGVKQASYAEIPSDLGHRAGRAAPDTPEGHFVDQQIRSFLAKIE* |
| Ga0126382_120510071 | 3300010047 | Tropical Forest Soil | DGGKQASYTEIPSDLGHRAARAVPETPEGEFIDAKIRAFLAKIE* |
| Ga0126373_106251331 | 3300010048 | Tropical Forest Soil | LGLDGARRIRDGVKHASYAEIPSDLGHRAGDAAPETPEGRFIDQQIRAFLAKIE* |
| Ga0126373_126510372 | 3300010048 | Tropical Forest Soil | YAEIPSDLGHRAARAVPGTPEGEFIDAQIRAFLAKIE* |
| Ga0123353_124120702 | 3300010167 | Termite Gut | SYAEIPSDLGHRAARAPPGTPEGDFVDRKIREFLAKVE* |
| Ga0134080_103932992 | 3300010333 | Grasslands Soil | VRHATYAEIPTDLGHRAGRAAPETPEGDFIDQQVRALLAKVE* |
| Ga0126376_106557513 | 3300010359 | Tropical Forest Soil | ARRLREGVKQASYAEIPSDLGHRAARAVPGTPEGEFIDAEIRAFLAKIE* |
| Ga0126378_113130983 | 3300010361 | Tropical Forest Soil | SSYAEIPSDLGHRAGRAAPETPEGHFVDQQIRTFLAKIE* |
| Ga0126378_132737701 | 3300010361 | Tropical Forest Soil | AEIPSDLGHRAGRATPDTPEGRFIDQQIRTFLAKVE* |
| Ga0126381_1002380981 | 3300010376 | Tropical Forest Soil | KHASYAEIPSDLGHRAGDAAPDTPEGRFIDQQIRAFLAKIE* |
| Ga0126381_1013093831 | 3300010376 | Tropical Forest Soil | ATYAEIPTDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE* |
| Ga0126383_114212412 | 3300010398 | Tropical Forest Soil | EIPTDLGNRAGRAAPETAEGHFVDRQIRSFLAKIE* |
| Ga0126383_122422802 | 3300010398 | Tropical Forest Soil | DGARRIRDRVKQASYAEIPSNLGHRAARLALGTLEGEFIDRQIRAFLGKVE* |
| Ga0126383_125218752 | 3300010398 | Tropical Forest Soil | GLDGARRIRDGIKQPTYAEIPSDLGHRAGRSAAETPEGDFIDQQIRAFLAKVE* |
| Ga0126360_10140801 | 3300010854 | Boreal Forest Soil | RDEAKQVSYAEIPSDLGHRAARLAPGIPETDFVDRQIRAFLTKVE* |
| Ga0126348_10088792 | 3300010862 | Boreal Forest Soil | DGVKQASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRALLAKVE* |
| Ga0150983_129535052 | 3300011120 | Forest Soil | GVKQASYAEIPSDLGHRAARAAPGTPEGEFIDRQIRALLAKVE* |
| Ga0137363_107113812 | 3300012202 | Vadose Zone Soil | IRDGVKHAAYAEIPTDLGHRAGTAAPETPEGDFIDHQIRAFLAKVE* |
| Ga0137370_109583901 | 3300012285 | Vadose Zone Soil | DGARRIRDGVKHATYAEIPSDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE* |
| Ga0137390_115935241 | 3300012363 | Vadose Zone Soil | GIPQATYAEIPSDLGHRAVRGMPGTPEGDFIDRQVRGFLAILTGSPAD* |
| Ga0134035_11567821 | 3300012391 | Grasslands Soil | EIPSDLGHRSARPAPGTPEGEFIGRQIRALLAKVE* |
| Ga0134041_11604451 | 3300012405 | Grasslands Soil | KQASYAEIPSDLGHRAARPAPGTPEGEFIDREIRALLAKIE* |
| Ga0137396_103276903 | 3300012918 | Vadose Zone Soil | GVKHATYAEIPTDLGHRAGTAAPETPEGDFIDHQIRAFLAKVE* |
| Ga0126369_103663961 | 3300012971 | Tropical Forest Soil | DVVTHASYAEIPSDLGHRAGRAAPETSEGRFIDQQIRTFLSKVE* |
| Ga0182033_103384721 | 3300016319 | Soil | IYSEIPSNLGHRAARRGSGTTEGDFVDRQIRAFLAKTE |
| Ga0182033_121653911 | 3300016319 | Soil | DGVKHASYTEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0182032_120340391 | 3300016357 | Soil | LLSLEGAGRIRDGLKHASYAEIPTDLGHRAARSTPDTPEWHFVDQQVRLFLAKIE |
| Ga0182032_120358372 | 3300016357 | Soil | VTHASYAEIPSDLGHRAGRPAPETPEGRFIDQQIRTFLSKVE |
| Ga0182040_103663184 | 3300016387 | Soil | YAEIPSDLGHSAGHAAPETLEGHFIEQQIRAFLAKIE |
| Ga0182037_108372732 | 3300016404 | Soil | DGARRIRDGVKQASYAEIPSDLGHRAARPTPGTPEGEFIDRQIRALLAKVE |
| Ga0182039_101630191 | 3300016422 | Soil | GVKHASYAEIPSDLGHRAGEAAPDTSEGRFTDQQIRAFLAKIE |
| Ga0182039_104685601 | 3300016422 | Soil | KHASYAEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0182038_110063722 | 3300016445 | Soil | LEGAGRIRDGLKHASYAEIPTDLGHRAARSTPDTPEWHFVDLQVRLFLAKIE |
| Ga0066669_104480291 | 3300018482 | Grasslands Soil | DGARRIRDGIKQASYAEIPSDLGHRAARPAPGTPEGEFIDREIRALLAKIE |
| Ga0210401_104690803 | 3300020583 | Soil | DGVKQASYAEIPSDLGHRAARAAPGTPEGEFIDRQIRALLAKVE |
| Ga0210406_112193432 | 3300021168 | Soil | RASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRAFLAKIE |
| Ga0210406_112489331 | 3300021168 | Soil | GLNGARRIRDEVKQASYAEIPSDLGHRAARPVPGTPETDFVDRQIRAFLAKVE |
| Ga0213873_103219801 | 3300021358 | Rhizosphere | AEIPSDLGHRAARPAPGTPEGEFIDRQIRALLAKVE |
| Ga0210387_108494281 | 3300021405 | Soil | RIRDGVKQASYAEIPSELGHRAPRAAPGTPEGAFIDRQIRALLVKVE |
| Ga0210386_101292661 | 3300021406 | Soil | GARRIRDSVKQASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRAFLAKIE |
| Ga0213871_100613283 | 3300021441 | Rhizosphere | KQPTYAEIQSDLGHRAARAAPATPEWRFIDGQIRTFLAKIE |
| Ga0187846_104924371 | 3300021476 | Biofilm | EIPSDLGHRAGDAAPDTSEGRFIDQQIRAFLAKIE |
| Ga0126371_106736811 | 3300021560 | Tropical Forest Soil | SYAEIPSDLGHRAARAVPGTSEGEFIDAKIRAFLSKIE |
| Ga0126371_107041102 | 3300021560 | Tropical Forest Soil | SYAEIPSDLGHRAGDAAPETPEGRFIDQQIRAFLAKIE |
| Ga0126371_113571171 | 3300021560 | Tropical Forest Soil | RRIRDGVKQVTYAEIPSDLGHRAARTEPGTAEAGFIAGQIRGFLAKVE |
| Ga0126371_115995232 | 3300021560 | Tropical Forest Soil | ARRIRDGVKHSSYAEIPSDLGHRAGRAAPETPEGHFVDRQIRSFLAKIE |
| Ga0126371_128258143 | 3300021560 | Tropical Forest Soil | FGLDSARRIRDGVTHAVYAEIPTELGHRAGRVVPETPEGNFVDQQIRAFLAKVE |
| Ga0242652_10436632 | 3300022510 | Soil | GARRIRDGVKHAAYAEIPTDLGHHAGRAAPETPEGDFIDHQIRAFLAKVE |
| Ga0242656_10168441 | 3300022525 | Soil | QIRDGVKQASYAEISSDLGHRAARPAPRTPEGEFIDHQIRALLAKVE |
| Ga0242656_11303001 | 3300022525 | Soil | AARRIRDGVKHATYAEIPTDLGHRAGTAAPETPEGDFIDHQIRAFLAKVE |
| Ga0242658_11454601 | 3300022530 | Soil | ARRIRDEAKQVSYAEIPSDLGHRAARLAPGTPETDFVDRQIRAFLTKVE |
| Ga0242662_101519621 | 3300022533 | Soil | DEVKQASYAEIPSDLGHRAARPAPGTPETDFVDRQIRAFLAKVE |
| Ga0242670_10238962 | 3300022708 | Soil | VKQASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRAFLAKIE |
| Ga0242670_10370082 | 3300022708 | Soil | GARRIRDGVKHATYAEIPTDLGHRAGTAAPETPEGDFIDHQIRAFLVKVE |
| Ga0242654_100755303 | 3300022726 | Soil | SYAEISSDLGHRAARPAPGTPEGEFIDHQIRALLAKVE |
| Ga0207684_102958253 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PDPRRVKQARYAEIPSDLGHRAARVTPGTPEADFIDRQIRAFLAKVE |
| Ga0207664_108667052 | 3300025929 | Agricultural Soil | ASYAEISSDLGHRAARPAPGTPEGEFIDHQIRALLAKVE |
| Ga0257159_10909601 | 3300026494 | Soil | GARRIRDEVKHASYAEIPSDLGHRAARPAPGTPETDFVDRQIRAFLAKVE |
| Ga0209448_100115175 | 3300027783 | Bog Forest Soil | HASYAEIPSDLGHRAGRAAAETPEGHFIDQQIRAFLAKVE |
| Ga0209488_102018454 | 3300027903 | Vadose Zone Soil | LDGARRIRDGVRHATYAEIPTDLGHRAGHAAPETPEGDFIDQQIRAFLAKVE |
| Ga0209526_100258356 | 3300028047 | Forest Soil | ATYAEIPTDLGHSAGRAGPETPEGDFIDHQIRAFLAKVE |
| Ga0137415_114908611 | 3300028536 | Vadose Zone Soil | IADGLKHSRYAEIPSDLGHRAMRAPPGTPEGDFIDRQIRGFLALPGAAGK |
| Ga0307482_11302302 | 3300030730 | Hardwood Forest Soil | RRLRDGLKHPVYAEIPTDLGHRAGRATPDTPEGDFIDERVRDFLATVK |
| Ga0307482_11897921 | 3300030730 | Hardwood Forest Soil | VGIAGARRIRDGIRQATYVEIPSDLGHRAVRALPGTAEGDFIDRQVRGFLASLSN |
| Ga0265763_10518482 | 3300030763 | Soil | QASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRALLAKVE |
| Ga0073999_111103021 | 3300030839 | Soil | RLDGARQIRVGVKQASYAEISSDLGHRAARPAPGTPEGEFIDHQIRALLAKVE |
| Ga0138302_14088002 | 3300030937 | Soil | IRDGVKHAAYAEIPTDLGHHAGRAAPETPEGDFIDHQIRAFLAKVE |
| Ga0075394_118827181 | 3300030969 | Soil | DGARRIRDGVKHATYAEIPTDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE |
| Ga0170834_1128382444 | 3300031057 | Forest Soil | IRDGVKQASYAEIPSDLGHRAARPAPGTPEGEFIDRQIRALLAKVE |
| Ga0170820_124883403 | 3300031446 | Forest Soil | YAEIPTDLGHHAGRAAPETPEGDLIDHQIRAFLAKVE |
| Ga0318516_100693431 | 3300031543 | Soil | EIPSDLGHRAGEAAPDTSEGRFTDQQIRAFLAKIE |
| Ga0318516_103761472 | 3300031543 | Soil | SYAEIPSDLGHRVGRAAPDTPEGRFIDQQIRTFLAKVE |
| Ga0318541_103327872 | 3300031545 | Soil | GVKRAIYAEIPSDLGHRAARPAPGSPETDFIDQQIRNFLAKIE |
| Ga0318571_101891532 | 3300031549 | Soil | ASYAEIPSDLGHRAGRTAPDTTEGRFIDRQIRAFLAEVE |
| Ga0318573_102140653 | 3300031564 | Soil | RIRDGVKHASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0310915_103525493 | 3300031573 | Soil | ARRIRDGVKHASYAEIPSDLGHSAGHAAEETPEGQFIEQQIRAFLAKIE |
| Ga0318555_101953693 | 3300031640 | Soil | ICDGVKHASYAEIPSDLGHSAGHAAPETPEGHFIDQQIREFLAKIE |
| Ga0307480_10151511 | 3300031677 | Hardwood Forest Soil | QLFGRDSARRIRDGINHPTYAEIPTDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE |
| Ga0318574_101247524 | 3300031680 | Soil | RDGVKHASYVEIPSDLGHRAWRAAPETPEGHFIDQQIRAFLAKVE |
| Ga0318574_102808963 | 3300031680 | Soil | RDGVKRAIYAEIPSDLGHRAARPAPGSPETDFIDQQIRNFLAKIE |
| Ga0318502_102381753 | 3300031747 | Soil | RRIRDGVKHASYAEIPSDLGHSAGHAAPETPEGHFIDQQIREFLAKIE |
| Ga0307477_108656621 | 3300031753 | Hardwood Forest Soil | QASYAEISSDLGHRAARPAPGTPEGEFIDHQIRALLAKVE |
| Ga0318546_103009643 | 3300031771 | Soil | LDEARRIRDGVKHASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318543_104681701 | 3300031777 | Soil | ASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318498_104560091 | 3300031778 | Soil | RIRDGIKQATYTEIPTDLGHRAARPAPGTPEGDLIDRQVRAFLAKVE |
| Ga0318547_108626612 | 3300031781 | Soil | RAIYAEIPSDLGHRAARPAPGSPETDFIDQQIRNFLAKIE |
| Ga0318552_103269401 | 3300031782 | Soil | GLDGARRIRDGVKHASYAEIPSDLGHSAGHAAPETPEGHFIDQQIREFLAKIE |
| Ga0318552_105634092 | 3300031782 | Soil | IRDGVEHASYAEIPSDLGHSAGYAAPETPEGQFIDQKIRGFLAKIE |
| Ga0318548_104390041 | 3300031793 | Soil | RRIRDGVKHASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318550_103099372 | 3300031797 | Soil | TEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0318550_103811301 | 3300031797 | Soil | RDGVKHASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318565_102890591 | 3300031799 | Soil | GVKHASYAEIPSDLGHSAGHAAPETPEGHFIDQPIREFLAKIE |
| Ga0310917_102860623 | 3300031833 | Soil | DEARRIRDGVKHASYAEIPSDLGHCAAYAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318511_103812881 | 3300031845 | Soil | TYAEIPSDLGHSAGHAAPETLEGHFIEQQIRAFLAKIE |
| Ga0318527_105318471 | 3300031859 | Soil | GARRIRDGVKLASYAEIPSDLGHRAGDAAPDTTEGRFIDQQIRAFLAKIE |
| Ga0306925_117092402 | 3300031890 | Soil | RDVVTHASYAEIPSDLGHRAGRPAPETPEGRFIDQQIRTFLSKVE |
| Ga0318536_106257371 | 3300031893 | Soil | VDGARRIRDGVKHASYAEIPSDLGHSAGHAAEETPEGQFIEQQIRAFLAKIE |
| Ga0318522_100399831 | 3300031894 | Soil | RIRDGVKHASYAEIPSDLGHRAWRAAPETPEGHFIDQQIRAFLAKVE |
| Ga0318520_102352622 | 3300031897 | Soil | RDGVKHASYAEIPSDLGHRAGRAAPDTTEGRFIDRQIRAFLAEVE |
| Ga0318520_110340321 | 3300031897 | Soil | RQIRDGVKRASYAEIPSDLGHRAGRAAPDTPEGRFIDQQIRAFLAQVE |
| Ga0306923_102120994 | 3300031910 | Soil | KHASYAEIPSDLGHRAGEAAPDTSEGRFTDQQIRAFLAKIE |
| Ga0306921_102444541 | 3300031912 | Soil | GLDGARRLRDGIKQASYAEIPSDLGHRATQATPGTPEGDFVDHEIRAFLAKIE |
| Ga0310916_100192986 | 3300031942 | Soil | GVKHASYAEIPSDLGHRAWRAAPETPEGHFIDQQIRAFLAKVE |
| Ga0310916_117620672 | 3300031942 | Soil | EIPSDLGHRAGRAAPETSEGRFIDKQIRAFLGKVE |
| Ga0318563_106384171 | 3300032009 | Soil | VKLASYAEIPSDLGHRAGDAAPDTTEGRFIDQQIRAFLAKIE |
| Ga0318507_101655443 | 3300032025 | Soil | KHATYAEIPSDLGHSAGHAAPETLEGHFIEQQIRAFLAKIE |
| Ga0318559_102671212 | 3300032039 | Soil | VKHASYAEIPSDLGHCADRAAPDTPEGRFIDQQIRAFLAKIE |
| Ga0318556_100031547 | 3300032043 | Soil | SYAEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0318533_100265771 | 3300032059 | Soil | YTEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0318533_103117131 | 3300032059 | Soil | LDGARGIRDGVKHASYAEIPSDLGHRAGEAAPDTSEGRFTDQQIRAFLAKIE |
| Ga0318533_106079582 | 3300032059 | Soil | IRDGIKHVSYAEIPSDLGHRAARVAPETPEWHFIDQQIRAFLAKVE |
| Ga0318533_111595691 | 3300032059 | Soil | HASYAEIPSDLGHRAGRPAPETPEGRFIDQQIRTFLSKVE |
| Ga0318553_102024463 | 3300032068 | Soil | HRLRDGIKRASYSEIPSDLGHRAARAAPGTPEGDFIAHQIRAFLAKIE |
| Ga0307471_1012877711 | 3300032180 | Hardwood Forest Soil | ARRIRDGVKHATYAEIPTDLGHRAGRAAPETPEGDFIDQQIRAFLAKVE |
| Ga0306920_1005006681 | 3300032261 | Soil | RIRDGIKHVSYAEIPSDLGHRAARVAPETPEWHFIDQQIRAFLAKVE |
| Ga0348332_130029512 | 3300032515 | Plant Litter | GVKQASYAEIPSDVGHRAARPAPGTPEGEFIDRQIRALLAKVE |
| Ga0348332_138748122 | 3300032515 | Plant Litter | VKHASYAEIPSDLGHSAGHAAPETPEGQFIDQQIRAFLAKIE |
| Ga0310914_100683091 | 3300033289 | Soil | RDAIKLPSYAEIPSDLGHRAARAVPGTPEGEFIDAKIRAFLAKIE |
| Ga0310914_100775065 | 3300033289 | Soil | RIRDGVKHASYTEIPSDLGHRAGRAAPETPEGHFIDQQIREFLAKIE |
| Ga0318519_108522591 | 3300033290 | Soil | HASYAEIPSDLGHRAGEAAPDTSEGRFTDQQIRAFLAKIE |
| Ga0314797_132339_383_538 | 3300034672 | Soil | DGARRIRDGVKQASYAEIPSDLGHRAARPAPGTPESEFIDSHIRAFLSKVE |
| ⦗Top⦘ |