| Basic Information | |
|---|---|
| Family ID | F059201 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTTRTLFFIFAFLLVVSLAHAGDERSIKDLAKALTGLASDVDPAEAQ |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.79 % |
| % of genes near scaffold ends (potentially truncated) | 97.01 % |
| % of genes from short scaffolds (< 2000 bps) | 97.01 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.403 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.582 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.269 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.33% β-sheet: 0.00% Coil/Unstructured: 46.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF10988 | DUF2807 | 35.07 |
| PF05872 | HerA_C | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101916671 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300004479|Ga0062595_102563393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300005187|Ga0066675_10523913 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005187|Ga0066675_10609342 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 820 | Open in IMG/M |
| 3300005187|Ga0066675_11456258 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005332|Ga0066388_100522147 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005332|Ga0066388_106062664 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 610 | Open in IMG/M |
| 3300005344|Ga0070661_101664719 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300005354|Ga0070675_102177277 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005434|Ga0070709_11410076 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005435|Ga0070714_102225107 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005454|Ga0066687_10040018 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300005548|Ga0070665_101672723 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005587|Ga0066654_10301110 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005587|Ga0066654_10839662 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005616|Ga0068852_102090452 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300005617|Ga0068859_101797505 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005764|Ga0066903_105882648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
| 3300005764|Ga0066903_106530169 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 608 | Open in IMG/M |
| 3300006034|Ga0066656_10865259 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006175|Ga0070712_101118985 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006237|Ga0097621_100436723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1177 | Open in IMG/M |
| 3300006791|Ga0066653_10601095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 559 | Open in IMG/M |
| 3300006796|Ga0066665_11394929 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006881|Ga0068865_101743459 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300007258|Ga0099793_10335225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 738 | Open in IMG/M |
| 3300009101|Ga0105247_10249622 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1212 | Open in IMG/M |
| 3300009176|Ga0105242_10766726 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300009545|Ga0105237_12517958 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009553|Ga0105249_13045623 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010042|Ga0126314_10944874 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010301|Ga0134070_10294140 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010304|Ga0134088_10173663 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300010321|Ga0134067_10187885 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010333|Ga0134080_10232299 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300010362|Ga0126377_10144813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2226 | Open in IMG/M |
| 3300010362|Ga0126377_10851459 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 972 | Open in IMG/M |
| 3300010366|Ga0126379_11058989 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300010376|Ga0126381_100788246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1364 | Open in IMG/M |
| 3300010376|Ga0126381_102231917 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 787 | Open in IMG/M |
| 3300010398|Ga0126383_11366365 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300010399|Ga0134127_12100189 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010403|Ga0134123_12025335 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 634 | Open in IMG/M |
| 3300012096|Ga0137389_10784586 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 818 | Open in IMG/M |
| 3300012198|Ga0137364_10419436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1002 | Open in IMG/M |
| 3300012200|Ga0137382_10930276 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012208|Ga0137376_11167699 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012582|Ga0137358_10057149 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2606 | Open in IMG/M |
| 3300012685|Ga0137397_10250638 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1319 | Open in IMG/M |
| 3300012882|Ga0157304_1067289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 589 | Open in IMG/M |
| 3300012884|Ga0157300_1119291 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012914|Ga0157297_10434012 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 535 | Open in IMG/M |
| 3300012948|Ga0126375_10444944 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 950 | Open in IMG/M |
| 3300012948|Ga0126375_11070986 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 662 | Open in IMG/M |
| 3300012948|Ga0126375_11483797 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012948|Ga0126375_11514014 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012961|Ga0164302_10698734 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012971|Ga0126369_13372028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300012984|Ga0164309_11045245 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012985|Ga0164308_11839241 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012985|Ga0164308_11901157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 555 | Open in IMG/M |
| 3300012985|Ga0164308_11983273 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012986|Ga0164304_11475572 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300013296|Ga0157374_12748382 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300014166|Ga0134079_10597178 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300014745|Ga0157377_11396978 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300014968|Ga0157379_10690824 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 957 | Open in IMG/M |
| 3300014968|Ga0157379_12287217 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300015077|Ga0173483_10907079 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300015200|Ga0173480_10081446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1530 | Open in IMG/M |
| 3300015356|Ga0134073_10336772 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300015372|Ga0132256_100517651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1304 | Open in IMG/M |
| 3300015372|Ga0132256_101599602 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300015372|Ga0132256_102028010 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300015374|Ga0132255_100880973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1338 | Open in IMG/M |
| 3300016270|Ga0182036_11693811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 534 | Open in IMG/M |
| 3300016387|Ga0182040_10244723 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1344 | Open in IMG/M |
| 3300017657|Ga0134074_1290504 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300018073|Ga0184624_10293165 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018078|Ga0184612_10060847 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1968 | Open in IMG/M |
| 3300018082|Ga0184639_10546954 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300019872|Ga0193754_1007568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1103 | Open in IMG/M |
| 3300019873|Ga0193700_1006015 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1879 | Open in IMG/M |
| 3300019877|Ga0193722_1013351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2100 | Open in IMG/M |
| 3300019882|Ga0193713_1151303 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300020001|Ga0193731_1057158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1025 | Open in IMG/M |
| 3300020004|Ga0193755_1213228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300021080|Ga0210382_10197062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 874 | Open in IMG/M |
| 3300021086|Ga0179596_10612394 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021560|Ga0126371_13500860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 530 | Open in IMG/M |
| 3300023058|Ga0193714_1006658 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1811 | Open in IMG/M |
| 3300023064|Ga0247801_1084734 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300024279|Ga0247692_1023005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 952 | Open in IMG/M |
| 3300024279|Ga0247692_1028266 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300025290|Ga0207673_1025672 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 807 | Open in IMG/M |
| 3300025898|Ga0207692_10133240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1406 | Open in IMG/M |
| 3300025900|Ga0207710_10456301 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 660 | Open in IMG/M |
| 3300025901|Ga0207688_10609767 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300025915|Ga0207693_10806681 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025925|Ga0207650_11031450 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300025927|Ga0207687_11341806 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300025930|Ga0207701_11129923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 648 | Open in IMG/M |
| 3300025938|Ga0207704_10711859 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300025938|Ga0207704_11517443 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025961|Ga0207712_11019688 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300025981|Ga0207640_10937401 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025986|Ga0207658_11112870 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300026075|Ga0207708_10718220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 855 | Open in IMG/M |
| 3300026078|Ga0207702_11916959 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026316|Ga0209155_1258735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300026323|Ga0209472_1148880 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300026329|Ga0209375_1270682 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026330|Ga0209473_1266750 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026523|Ga0209808_1102146 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1208 | Open in IMG/M |
| 3300027882|Ga0209590_10075247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1955 | Open in IMG/M |
| 3300028065|Ga0247685_1016463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 875 | Open in IMG/M |
| 3300028755|Ga0307316_10312451 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300028796|Ga0307287_10101679 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1085 | Open in IMG/M |
| 3300028819|Ga0307296_10375083 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300030916|Ga0075386_10036529 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1096 | Open in IMG/M |
| 3300031226|Ga0307497_10179630 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300031231|Ga0170824_105186105 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300031231|Ga0170824_113773009 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1139 | Open in IMG/M |
| 3300031716|Ga0310813_10416267 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1159 | Open in IMG/M |
| 3300031716|Ga0310813_10734661 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300031720|Ga0307469_12528235 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031847|Ga0310907_10492456 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300031942|Ga0310916_10859344 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031947|Ga0310909_11095296 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032017|Ga0310899_10445764 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300032035|Ga0310911_10309182 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300032211|Ga0310896_10360485 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300033412|Ga0310810_10507760 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1196 | Open in IMG/M |
| 3300033475|Ga0310811_10279046 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1947 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019166711 | 3300000364 | Soil | MIRRLFFIFAFLLLVSLAHASDEKSIKDLAKALTRLSPDVDPAE |
| Ga0062595_1025633932 | 3300004479 | Soil | MVRGVFFIFVLLLVVHTATAGDERSIKDLAKALTKLAADV |
| Ga0066675_105239133 | 3300005187 | Soil | MTTHTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLASDVDP |
| Ga0066675_106093422 | 3300005187 | Soil | MRTVTFAFLFLLLVHAATAGDERSIKDLANALTRLSSDVDPAEAQSLSAT |
| Ga0066675_114562582 | 3300005187 | Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLASDVDP |
| Ga0066388_1005221473 | 3300005332 | Tropical Forest Soil | MTTRTPFFIFAFLLAFSLAQAGDERSIKDLAKALTQLGADVDP |
| Ga0066388_1060626641 | 3300005332 | Tropical Forest Soil | VRNAEGLRRYMRIRALFFIFTSLLVVSLAHAGDERSIKDLAKALTGLGPDV |
| Ga0070661_1016647192 | 3300005344 | Corn Rhizosphere | MITRRFLFVFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEAQ |
| Ga0070675_1021772771 | 3300005354 | Miscanthus Rhizosphere | MRTLLFIFAFQLVVSLATAGDERSIKELAKALTGLSSDVDPAEAQAISYTAHTTAR |
| Ga0070709_114100762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRILPLIFGFLVVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQ |
| Ga0070714_1022251071 | 3300005435 | Agricultural Soil | MTTRTLFFIFAFQLAVSLAPAGDERSIKELAKALTGLSSDVDPAEAQALSY |
| Ga0066687_100400183 | 3300005454 | Soil | MMRRVFFIFALLLVIHTATASDERSIKDLAKALTALARDVDPAE |
| Ga0070665_1016727231 | 3300005548 | Switchgrass Rhizosphere | MTTRTVFFVFAFLVVVSLAHAGDERSIKDLAKALTGLSADVDPAEAQALSYTAHT |
| Ga0066654_103011102 | 3300005587 | Soil | MMRRVFFIFALLLVVHTATASDERSIKDLAKALTALARDVDPAEAQALSA |
| Ga0066654_108396621 | 3300005587 | Soil | MIKRTLLFVFAFLLVVSLAHGSDERSIRDLAKALTGLSADVDPAEAQALSYTAHTTA |
| Ga0068852_1020904522 | 3300005616 | Corn Rhizosphere | MTTRTLCFVFASLLVVNLADASDERSIKDLAKALTGLSSDVDPAEAQALSYT |
| Ga0068859_1017975052 | 3300005617 | Switchgrass Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTGLSSDVDPAEAQ |
| Ga0066903_1058826481 | 3300005764 | Tropical Forest Soil | MTTRTLFSILAFLLIVSLAHASDERSIKDLAKALTQL |
| Ga0066903_1065301691 | 3300005764 | Tropical Forest Soil | MTMRTLVFVFAFLLVASLAQAGDERSIKNLAKALAGLSSDVDPAEAQAISYTAHTTA |
| Ga0066656_108652591 | 3300006034 | Soil | MTTRTLFFVFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDP |
| Ga0070712_1011189851 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRILPLIFAFLVVVSLAHASDERSIKDLAKALTGLS |
| Ga0097621_1004367233 | 3300006237 | Miscanthus Rhizosphere | MTRRTLVFIFAFLLGISLAHASDERSIKDLAKALTGLSSDVDPAEAQALSYTA |
| Ga0066653_106010951 | 3300006791 | Soil | MMRTSSFIIAFLFLAHVATASDERSIKELTKALVALASDVDPAEAQSLSVTA |
| Ga0066665_113949291 | 3300006796 | Soil | MTTRTLFFIFAFLLVVSLAHAGDERSIKDLAKALT |
| Ga0068865_1017434592 | 3300006881 | Miscanthus Rhizosphere | MTRRTLVFIFAFLLGISLAHASDERSIKDLAKALTGLSSD |
| Ga0099793_103352251 | 3300007258 | Vadose Zone Soil | MRTSAFIFAFLLVIHAATAGDERSIKDLTKALSALATDVDPGEA |
| Ga0105247_102496222 | 3300009101 | Switchgrass Rhizosphere | MTRRTLLFGFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEA* |
| Ga0105242_107667261 | 3300009176 | Miscanthus Rhizosphere | MTRRTLVFIFAFLLGISLAHASDERSIKDLAKALTGL |
| Ga0105237_125179581 | 3300009545 | Corn Rhizosphere | MTRRTLVFIFAFLLGISLAHASDERSIKDLAKALTGLSSDVDPAEAQAISYTAHTT |
| Ga0105249_130456231 | 3300009553 | Switchgrass Rhizosphere | MTTRTLFFIFGSLLVVNLAHAGDKTSIKTLAKALTGLASDVDPAEAQAIS |
| Ga0126314_109448741 | 3300010042 | Serpentine Soil | MTTRILFFVFASLIVVSLADAGDERSIKDLAKALT |
| Ga0134070_102941401 | 3300010301 | Grasslands Soil | MTTRTLFFIFAFQLVVSLAYAGDERSIKDLAKALTGLSSDVDPA |
| Ga0134088_101736631 | 3300010304 | Grasslands Soil | MRRVFFIFALLLVIHTARATDERSIKDLAKALTALAHDVDPAEAQALSATA |
| Ga0134067_101878851 | 3300010321 | Grasslands Soil | MTTRTLFFIFAFMLVVNLAHASDERSIKELAKALTGLSSDVDPAEAQA |
| Ga0134080_102322993 | 3300010333 | Grasslands Soil | MTTRTLFFIFAFQLVVSLAYAGDERSIKDLTKALTG |
| Ga0126377_101448131 | 3300010362 | Tropical Forest Soil | MRIRTLLFVFAFLLVVSLANAGDERSIKNLAKALAGLSSD |
| Ga0126377_108514591 | 3300010362 | Tropical Forest Soil | MTTRTLFSILVFLLIISLAHASDERSIKDLAKALTQLSSNVDPAEAQAL |
| Ga0126379_110589891 | 3300010366 | Tropical Forest Soil | MTTRTLFFVFAFLLVVSLANASDERSIKNLAKALTGLS |
| Ga0126381_1007882461 | 3300010376 | Tropical Forest Soil | MRSLSLIFSFLLVVSLAHASDERSIKDLSKALTELASDVDPAEA |
| Ga0126381_1022319172 | 3300010376 | Tropical Forest Soil | MRTLVFIFAFPLVVSLANAGDERSIKNLAKALTGLSSDVD |
| Ga0126383_113663652 | 3300010398 | Tropical Forest Soil | MTTRRLFCIFAFLLVVSLAHAGDERSIKDLAKALTRLASDVDPAE |
| Ga0134127_121001892 | 3300010399 | Terrestrial Soil | MIKRTLLLVFGFLLVVSLVHGSDERSIKDLAKALTGLSS |
| Ga0134123_120253352 | 3300010403 | Terrestrial Soil | MITRRFLFVFAFLLVVSLANAGDERSIKNLAKALTGLSSDV |
| Ga0137389_107845862 | 3300012096 | Vadose Zone Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLSSDVDPAEAQALSYTAHTT |
| Ga0137364_104194363 | 3300012198 | Vadose Zone Soil | MTTRTLFFVFAFLLVVSLANAGDERSIKNLAKALTGLAADV |
| Ga0137382_109302762 | 3300012200 | Vadose Zone Soil | MTTRTLFFVFAFLLVVSLANAGDERSIKNLAKALTGLAADVDP |
| Ga0137376_111676992 | 3300012208 | Vadose Zone Soil | MTTRTLFFIFAFMLVVNLAHASDERSIKELAKALTGLSSDVDPAEAQAVSY |
| Ga0137358_100571491 | 3300012582 | Vadose Zone Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLAADVDPAEAQAL |
| Ga0137397_102506381 | 3300012685 | Vadose Zone Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLSSDVDPAEAQALSYT |
| Ga0157304_10672892 | 3300012882 | Soil | MTTRTLLFVFAFLLVVSLAHAGDERSIKNLAKALTGLSSDVDPAEAQALSYTAHTT |
| Ga0157300_11192911 | 3300012884 | Soil | MIKRTLLLVFGFLLVVSLAHGGDERSIKDLAKALTGLSSDVDPAEAQA |
| Ga0157297_104340121 | 3300012914 | Soil | MIKRTLLLVFGFLLVVSLAHGGDERSIKDLAKALTGLSSDVDPAEAQALSYTAHTTA |
| Ga0126375_104449443 | 3300012948 | Tropical Forest Soil | MTRRVPFFIFAFLLAFSLAHAGDERSIKDLAKALT |
| Ga0126375_110709861 | 3300012948 | Tropical Forest Soil | MRTRALFSISAFLLVVSLAHASDERSIKGLAKALTGLSS |
| Ga0126375_114837972 | 3300012948 | Tropical Forest Soil | MRSLSLIFSFLLVVSLAHASDERSIKDLSKALTELASDVDPAEAEALS |
| Ga0126375_115140141 | 3300012948 | Tropical Forest Soil | MTTRRLFCIFAFLLVVSLAHAGDERSIKDLAKALTRL |
| Ga0164302_106987342 | 3300012961 | Soil | MTTRTLFFVFAFLFVVSLAHASDERSIKDLAKALTGLSA |
| Ga0126369_133720282 | 3300012971 | Tropical Forest Soil | MTTRGLSFVLAFLLLVSRAHAGDERSIKDLAKALT |
| Ga0164309_110452452 | 3300012984 | Soil | MTTRSLFFIFAFLLVVSLANASDERSIKDLAKALTGLSSDVDPAEAQAISYTA |
| Ga0164308_118392412 | 3300012985 | Soil | MTTRTLFFVFAFLVVVSLAHAGDERSIKDLAKALTGLSADVDP |
| Ga0164308_119011572 | 3300012985 | Soil | MTTRTVFFVFAFLVVVSLAHAGDERSIKDLAKALTGLS |
| Ga0164308_119832732 | 3300012985 | Soil | MIKRTLLLVFGFLLVVSLSRGSDERSIKDLAKALTGLSSDVDPAEAQALSYTAH |
| Ga0164304_114755722 | 3300012986 | Soil | MTTRTLFFVFAFLIVVSLAHAGDERSIKDLAKALTGLSADVDP |
| Ga0157374_127483822 | 3300013296 | Miscanthus Rhizosphere | MTTRTVFFVFAFLVVVSLAHAGDERSIKDLAKALTGLSADVDPAEAQALS* |
| Ga0134079_105971782 | 3300014166 | Grasslands Soil | MTKRTLFSIFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQALSYTA |
| Ga0157377_113969782 | 3300014745 | Miscanthus Rhizosphere | MTRRTLLFGFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEA |
| Ga0157379_106908241 | 3300014968 | Switchgrass Rhizosphere | MTTRTLCFIFASLLVVNLTDASHERSIKDLAKALTGLSSDVDPA |
| Ga0157379_122872171 | 3300014968 | Switchgrass Rhizosphere | MITRTLFSIFASLLVVSLAHAGDERSIKDLAKALTGLSSDVDPAEAQAISYTAHTTA |
| Ga0173483_109070792 | 3300015077 | Soil | MTTRTLFFIFASLLVVSPAHASDERSIKDLAKALTGLSADVDPAEAQALSY |
| Ga0173480_100814461 | 3300015200 | Soil | MIKRTLLFIFAFLLVISLARASDERSIKELAKALTGLSS |
| Ga0134073_103367721 | 3300015356 | Grasslands Soil | MTTRTLFFIFAFLLVVSLAHAGDERSIKDLAKALTGLASDVDPAEAQ |
| Ga0132256_1005176511 | 3300015372 | Arabidopsis Rhizosphere | MRIRKFFLIFASLLVVSLANAGDERSIKDLAKALTGLGRDVD |
| Ga0132256_1015996021 | 3300015372 | Arabidopsis Rhizosphere | MITRALFFVFAFLLVVTLAHASDERSIKDLAKALTGLSSD |
| Ga0132256_1020280102 | 3300015372 | Arabidopsis Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTGLSSDVDP |
| Ga0132255_1008809731 | 3300015374 | Arabidopsis Rhizosphere | MTTRTLFSILVFPLIVSLAHASDERSIKDLAKALTQLSSNVDPAEAQ |
| Ga0182036_116938111 | 3300016270 | Soil | MRIRAFFLLFASLLVVSLANAGDERSIKDLAKALTGLGPDVD |
| Ga0182040_102447233 | 3300016387 | Soil | MTTRTLFSILAFLLIVSLAHASDERSIKDLAKALTQLSSNVDPAEAQALSYTAHT |
| Ga0134074_12905041 | 3300017657 | Grasslands Soil | MTTRTLFFIFAFQLVVSLAYAGDERSIKDLAKALTGLSSDVDPAEAQAL |
| Ga0184624_102931651 | 3300018073 | Groundwater Sediment | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKTLTGLASDVDPTEAQ |
| Ga0184612_100608475 | 3300018078 | Groundwater Sediment | MTTRTLFFVFALLVVSLAHAGDERSIKDLAKALTGLASDVDPTEAQALS |
| Ga0184639_105469541 | 3300018082 | Groundwater Sediment | MTTRTLFFVFAFLLLVSLAHASDERSIKDLAKALTGLS |
| Ga0193754_10075683 | 3300019872 | Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLASDVDPAEAQ |
| Ga0193700_10060154 | 3300019873 | Soil | MRTSSFIIAFLFLIHAATAGDERSIKDLSKALTGLAADVDPAEAQSLSITAH |
| Ga0193722_10133511 | 3300019877 | Soil | MTTRTFPFIFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQAL |
| Ga0193713_11513031 | 3300019882 | Soil | MTTRTLFFIFAFLLVVSLANAGDERSIKNLAKALTGLAADVDPAEAQA |
| Ga0193731_10571583 | 3300020001 | Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLASDVDPTEAQALSYTAHTT |
| Ga0193755_12132282 | 3300020004 | Soil | MIRRLFFIFALLLLVSPAKAGDERSIKDLAKALVALGRDVDPA |
| Ga0210382_101970623 | 3300021080 | Groundwater Sediment | MTTRTLFFIFAFQLVVSLAPAGDERSIKELAKALTGLASD |
| Ga0179596_106123942 | 3300021086 | Vadose Zone Soil | MTTRALFFVFAFLLVVSLAHASDERSIKDLAKALT |
| Ga0126371_135008602 | 3300021560 | Tropical Forest Soil | MTTRTLFSILAFLLIVSLAHASDERSIKDLAKALTQLSSNVDPAEAQALSYTAHTTAR |
| Ga0193714_10066584 | 3300023058 | Soil | MQKPDKMTKRTLLFVFALLVVSLAHGSDERSINNLAKALTGLSSDVDPA |
| Ga0247801_10847342 | 3300023064 | Soil | MIKRTLLLVFGFLLVVSLSRGSDERSIKDLAKALTGLS |
| Ga0247692_10230052 | 3300024279 | Soil | MITRRFLFVFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEAQAISYTAHTT |
| Ga0247692_10282661 | 3300024279 | Soil | MITRRFLFVFAFLLVVSLANAGDERSIKNLAKALT |
| Ga0207673_10256722 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MITRRFLFVFAFLLVVSLANASDERSIKNLAKALTGLSSDVDPAEAQAISYT |
| Ga0207692_101332401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRILPLIFAFLVVVSLAHASDERSIKDLAKALTGLSS |
| Ga0207710_104563011 | 3300025900 | Switchgrass Rhizosphere | MTRRTLLFGFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDP |
| Ga0207688_106097672 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRRTLLFGFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEAQAISYTAHT |
| Ga0207693_108066812 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKRILPLIFAFLVVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQALSYTAHTTA |
| Ga0207650_110314501 | 3300025925 | Switchgrass Rhizosphere | MTTRTLFFVFAFLVVVSLAHAGDERSIKDLAKALTGLSAD |
| Ga0207687_113418061 | 3300025927 | Miscanthus Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTALSSDVD |
| Ga0207701_111299232 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRTLFFVYAFLLGISLAHAGDERSIKNLAKALTGLSSDVDPAEAQAISYTAHT |
| Ga0207704_107118591 | 3300025938 | Miscanthus Rhizosphere | MRSMITRTLPFVFAFLLVVSLAHAGDERSIKDLAKALTGLSSDVDPAEA |
| Ga0207704_115174431 | 3300025938 | Miscanthus Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTALSSDVDPAEA |
| Ga0207712_110196882 | 3300025961 | Switchgrass Rhizosphere | MTTRTLLFVFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQ |
| Ga0207640_109374011 | 3300025981 | Corn Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTGLSSDVDPAEAQALSY |
| Ga0207658_111128702 | 3300025986 | Switchgrass Rhizosphere | MTTRTLLFVFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQAIS |
| Ga0207708_107182201 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRTLCFVFASLLVVNLADASDERSIKDLAKALTGLS |
| Ga0207702_119169591 | 3300026078 | Corn Rhizosphere | MIKRTLLLVFGFLLVVSLAHGSDERSIKDLAKALTGLSSDVDPAEAQALSYT |
| Ga0209155_12587352 | 3300026316 | Soil | MRTVTFAFLFLLLVHAATASDERSIKDLANALTRLSSDVDPAEAQSLSV |
| Ga0209472_11488801 | 3300026323 | Soil | MRRVFFIFALLLVVHTARATDERSIKDLTKALTALAHDVDPAEAQALSATAHTK |
| Ga0209375_12706821 | 3300026329 | Soil | MTTRTLFFVFAFLLVVSLANAGDERSIKNLAKALTGLAAD |
| Ga0209473_12667501 | 3300026330 | Soil | MTTRTLFFIFAFQLVVSLAHAGDERSIKDLAKALTGLSSDVDPAEAQAL |
| Ga0209808_11021463 | 3300026523 | Soil | MTKRTLFSIFAFLLVVSLAQASDERSIKDLAKALTGLSSDVDPAE |
| Ga0209590_100752471 | 3300027882 | Vadose Zone Soil | MTTRTLFFIFAFQLVVSLAYAGDERSIKDLTKALTGLSSDVDPTEAQ |
| Ga0247685_10164632 | 3300028065 | Soil | MTTRTLLFVFAFLLVVSLANAGDERSIKNLAKALTGLSSDVDPAEAQAISYTAHTTA |
| Ga0307316_103124512 | 3300028755 | Soil | MTTRTLLFIFAFLLVVSLAHASDERSIKDLAKALTGLSSD |
| Ga0307287_101016794 | 3300028796 | Soil | MTTRTLFFIFAFQLVVSLAPAGDERSIKDLAKALTGLASDVDPT |
| Ga0307296_103750832 | 3300028819 | Soil | MTTRTLLFIFAFLLVVSLAHASDERSIKDLAKALTGLSSDVDPAEAQALSYTAHTTAR |
| Ga0075386_100365293 | 3300030916 | Soil | MTTRTLFFVFAFLLVVSLAHASDERSIKDLAKALTGLSAD |
| Ga0307497_101796301 | 3300031226 | Soil | MTTRSLFFIFAFLIVVSLANASDERSIKDLAKALTGLSSDVDPAEAQALSYTAHTTAR |
| Ga0170824_1051861053 | 3300031231 | Forest Soil | MIKRTLLLVFAFLVVVSLAHASDERSIKDLAKALTGLSSDVDP |
| Ga0170824_1137730093 | 3300031231 | Forest Soil | MIKRTLLLVFAFLIVVSLEHASDERSIKDLAKALTG |
| Ga0310813_104162673 | 3300031716 | Soil | MTRRTLLFGFAFLLVVSLANAGDERSIKNLAKALTGLSS |
| Ga0310813_107346613 | 3300031716 | Soil | MTTRTLFFVFAFLLVVSLVNAGDERSIKGLAKALTGLASDV |
| Ga0307469_125282351 | 3300031720 | Hardwood Forest Soil | MTTRTLLFIFAFLLVASLAHASDERSIKDLAKALTGLSSDVDPAEAQALSYTAHT |
| Ga0310907_104924562 | 3300031847 | Soil | MTTRTLFFVFAFLLVVSLAHAGDERSINNLAKALTKLSSDVDPAEAQALS |
| Ga0310916_108593442 | 3300031942 | Soil | MTTRTLFFIFAFLLVVSLAHASDERSIKDLSKALTALASDVDPT |
| Ga0310909_110952962 | 3300031947 | Soil | MTTRTLFFIFAFLLVVSLAHASDERSIKDLSKALTALASDVDPTEA |
| Ga0310899_104457642 | 3300032017 | Soil | MTTRTLFFVFAFLLVISLAHAGDERSIKNLAKALTGLSSDVDPAEAQA |
| Ga0310911_103091823 | 3300032035 | Soil | MTARALFFIVASLLVARLAHAGDERSIKDLAKALTQLGADVDPAEAQAISY |
| Ga0310896_103604852 | 3300032211 | Soil | MTTRTLFFVFAFLLVVSLAHAGDERSINNLAKALTKLSSDV |
| Ga0310810_105077601 | 3300033412 | Soil | MTKRTLLFVFAFLVVVSLTHASDERSIKDLAKALTGLSSDVDPAEAQA |
| Ga0310811_102790463 | 3300033475 | Soil | MIMRRFLFFFAFLLVASLAKAGDERSIKNLTKALTGLSSDVDPAEAEAISYTAHT |
| ⦗Top⦘ |