NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059199

Metagenome Family F059199

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059199
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 52 residues
Representative Sequence MSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIE
Number of Associated Samples 105
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.74 %
% of genes near scaffold ends (potentially truncated) 94.78 %
% of genes from short scaffolds (< 2000 bps) 94.03 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.76

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.284 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.836 % of family members)
Environment Ontology (ENVO) Unclassified
(49.254 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.045 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.65%    β-sheet: 0.00%    Coil/Unstructured: 49.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.76
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.25.1.1: Ferritind4iwka_4iwk0.9102
a.24.16.0: automated matchesd1wola_1wol0.90697
a.25.1.1: Ferritind1z6om11z6o0.89958
a.25.1.0: automated matchesd6sooa_6soo0.89764
a.25.1.1: Ferritind6txia_6txi0.89295


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF04392ABC_sub_bind 5.97
PF00162PGK 5.22
PF01717Meth_synt_2 1.49
PF03401TctC 0.75
PF00042Globin 0.75
PF13546DDE_5 0.75
PF02371Transposase_20 0.75
PF13604AAA_30 0.75
PF13333rve_2 0.75
PF00872Transposase_mut 0.75
PF05598DUF772 0.75
PF13936HTH_38 0.75
PF09361Phasin_2 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.97
COG01263-phosphoglycerate kinaseCarbohydrate transport and metabolism [G] 5.22
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.49
COG1017Hemoglobin-like flavoproteinEnergy production and conversion [C] 0.75
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.75
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.75
COG3547TransposaseMobilome: prophages, transposons [X] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.28 %
UnclassifiedrootN/A6.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0457797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales889Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10104329All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005174|Ga0066680_10111454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1683Open in IMG/M
3300005181|Ga0066678_10148071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1466Open in IMG/M
3300005186|Ga0066676_10972333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300005187|Ga0066675_10816549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300005332|Ga0066388_102971643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium866Open in IMG/M
3300005332|Ga0066388_108170996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300005332|Ga0066388_108760360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300005576|Ga0066708_10649948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300005764|Ga0066903_104729773All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium724Open in IMG/M
3300005764|Ga0066903_106284504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300006028|Ga0070717_10301399All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300006032|Ga0066696_10418421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium875Open in IMG/M
3300006032|Ga0066696_10582968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300006032|Ga0066696_10605076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria711Open in IMG/M
3300006046|Ga0066652_101860920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300006049|Ga0075417_10696445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300006175|Ga0070712_101257801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300006175|Ga0070712_101850726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300006845|Ga0075421_101633302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300006847|Ga0075431_101722668All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Raoultella → Raoultella terrigena583Open in IMG/M
3300006847|Ga0075431_102121792All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300006904|Ga0075424_100443259All Organisms → cellular organisms → Bacteria → Proteobacteria1385Open in IMG/M
3300006914|Ga0075436_101035493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300007076|Ga0075435_101070505Not Available705Open in IMG/M
3300009094|Ga0111539_11813733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium707Open in IMG/M
3300009137|Ga0066709_101742155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300009147|Ga0114129_11592746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium800Open in IMG/M
3300009147|Ga0114129_12857575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300009156|Ga0111538_13443157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300010303|Ga0134082_10389660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300010366|Ga0126379_10735415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1082Open in IMG/M
3300010366|Ga0126379_12799484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300010396|Ga0134126_12833770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300012199|Ga0137383_10431611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria965Open in IMG/M
3300012199|Ga0137383_10573372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300012199|Ga0137383_10872905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300012200|Ga0137382_10332192All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300012202|Ga0137363_10188983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1645Open in IMG/M
3300012357|Ga0137384_11037829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300012361|Ga0137360_10228760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1518Open in IMG/M
3300012496|Ga0157353_1050923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300012517|Ga0157354_1049424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300012532|Ga0137373_11009734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300012917|Ga0137395_10908083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300012958|Ga0164299_10982055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300015371|Ga0132258_10175347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5173Open in IMG/M
3300015371|Ga0132258_11131548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1979Open in IMG/M
3300015372|Ga0132256_100110126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2698Open in IMG/M
3300015373|Ga0132257_100146721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2760Open in IMG/M
3300016270|Ga0182036_10295714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1229Open in IMG/M
3300016294|Ga0182041_11212534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium688Open in IMG/M
3300016341|Ga0182035_10369175All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300016341|Ga0182035_12140668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300016357|Ga0182032_10966907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300016357|Ga0182032_11622237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300016371|Ga0182034_10668221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium881Open in IMG/M
3300016404|Ga0182037_10504579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1015Open in IMG/M
3300016422|Ga0182039_10274776All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300016445|Ga0182038_10735036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium861Open in IMG/M
3300016445|Ga0182038_10774115All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300016445|Ga0182038_11458217All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300018433|Ga0066667_10877175Not Available770Open in IMG/M
3300018468|Ga0066662_10281493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1383Open in IMG/M
3300021432|Ga0210384_10529133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1061Open in IMG/M
3300021475|Ga0210392_11046430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300021560|Ga0126371_13763995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300024288|Ga0179589_10409515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300025916|Ga0207663_10905872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300025928|Ga0207700_11684660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300026538|Ga0209056_10375201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium907Open in IMG/M
3300026550|Ga0209474_10551960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300026555|Ga0179593_1178860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2797Open in IMG/M
3300027548|Ga0209523_1012150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNJC394B001609Open in IMG/M
3300027909|Ga0209382_11573020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300028828|Ga0307312_11142150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031474|Ga0170818_101800593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300031543|Ga0318516_10294665Not Available937Open in IMG/M
3300031545|Ga0318541_10061369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1952Open in IMG/M
3300031549|Ga0318571_10325329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300031561|Ga0318528_10724853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031572|Ga0318515_10400951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Mameliella → Mameliella alba734Open in IMG/M
3300031572|Ga0318515_10584371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium594Open in IMG/M
3300031573|Ga0310915_10206300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1375Open in IMG/M
3300031573|Ga0310915_10605711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium776Open in IMG/M
3300031573|Ga0310915_10853603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300031668|Ga0318542_10415640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300031679|Ga0318561_10557930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300031680|Ga0318574_10132425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1406Open in IMG/M
3300031682|Ga0318560_10408977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300031719|Ga0306917_11258514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300031740|Ga0307468_101173210All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300031744|Ga0306918_10234969All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300031744|Ga0306918_10526285All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium926Open in IMG/M
3300031747|Ga0318502_10722946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium602Open in IMG/M
3300031751|Ga0318494_10587297Not Available651Open in IMG/M
3300031751|Ga0318494_10604287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300031764|Ga0318535_10253361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium788Open in IMG/M
3300031781|Ga0318547_10715621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300031793|Ga0318548_10088710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1469Open in IMG/M
3300031805|Ga0318497_10441717Not Available728Open in IMG/M
3300031805|Ga0318497_10698193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300031846|Ga0318512_10748095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300031860|Ga0318495_10542042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031880|Ga0318544_10121098All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300031890|Ga0306925_11231407Not Available748Open in IMG/M
3300031910|Ga0306923_11088210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium862Open in IMG/M
3300031912|Ga0306921_10637605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1229Open in IMG/M
3300031912|Ga0306921_11431668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300031942|Ga0310916_10208801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1636Open in IMG/M
3300031947|Ga0310909_10051553All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3164Open in IMG/M
3300031947|Ga0310909_10313855Not Available1314Open in IMG/M
3300031954|Ga0306926_11101656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria939Open in IMG/M
3300031959|Ga0318530_10289109Not Available677Open in IMG/M
3300031959|Ga0318530_10415522All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300032001|Ga0306922_11052937All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300032001|Ga0306922_11456891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300032010|Ga0318569_10209971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium902Open in IMG/M
3300032025|Ga0318507_10178809All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300032035|Ga0310911_10024371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2956Open in IMG/M
3300032035|Ga0310911_10409442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium785Open in IMG/M
3300032035|Ga0310911_10758584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300032041|Ga0318549_10478376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300032043|Ga0318556_10518059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300032051|Ga0318532_10068585All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300032059|Ga0318533_10358398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1062Open in IMG/M
3300032063|Ga0318504_10026557All Organisms → cellular organisms → Bacteria2257Open in IMG/M
3300032076|Ga0306924_11571476All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300032089|Ga0318525_10638810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300032094|Ga0318540_10511387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300032261|Ga0306920_100560211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1693Open in IMG/M
3300033289|Ga0310914_10561711All Organisms → cellular organisms → Bacteria1030Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.73%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.49%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.49%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.49%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.75%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.75%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_045779723300000156Sugar Cane Bagasse Incubating BioreactorMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWLSDAES
AF_2010_repII_A1DRAFT_1010432913300000597Forest SoilMSETHEYRQFANDCIVWARMTTSDDMRARLLELAKKWS
Ga0066680_1011145423300005174SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDRA*
Ga0066678_1014807113300005181SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQ
Ga0066676_1097233313300005186SoilMSKTDEYRQIANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIELRPNNAAKASEMA
Ga0066675_1081654923300005187SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQRIELRPTEAAKASEMAGEVIDRL
Ga0066388_10297164313300005332Tropical Forest SoilSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAR*
Ga0066388_10817099613300005332Tropical Forest SoilMSKADEYRQLADDCIAWARIAISDDQRDQFLELAKKWMQDA
Ga0066388_10876036013300005332Tropical Forest SoilMPCLTIEEGRLSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQD
Ga0066708_1064994823300005576SoilMSKTHEYRQVANDCIVWARIATSDDQREQFLELAKKWMSDAESIDRGTELQPNEAVKASEMAGEEIDRLGDP
Ga0066903_10472977333300005764Tropical Forest SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAARAS
Ga0066903_10628450423300005764Tropical Forest SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKW
Ga0070717_1030139943300006028Corn, Switchgrass And Miscanthus RhizosphereMSKNAEYRQLADGCIAWARLAISDDQREQFLELAK
Ga0066696_1041842133300006032SoilMSKADEYRQFANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIE
Ga0066696_1058296823300006032SoilMSKTAEYRQLADGCIAWACLAISDDQREQFLELAKQWRSDAESIDQGIELRRAKASEMAGEEIDRLGDPL
Ga0066696_1060507613300006032SoilMSKTDEYRQIANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIE
Ga0066652_10186092013300006046SoilMSKTDEYRQFANDCIVWARIATSDDQREQFLELAKKWM
Ga0075417_1069644513300006049Populus RhizosphereMSKTDEYRQLADGCIAWARLAISDDQREQFLELAKKWLSDAESIDQDIIELRRAKASEMAGEEIDRL
Ga0070712_10125780123300006175Corn, Switchgrass And Miscanthus RhizosphereMSKTDEYRQFANDCIVWARRATSDDQREQFLELAKKWVSDAESIDQGIELRPKEAAKASEMAGEEIDRLGDPLA
Ga0070712_10185072613300006175Corn, Switchgrass And Miscanthus RhizosphereMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKW
Ga0075421_10163330223300006845Populus RhizosphereMSKTAEYRQLADDCITWARIATSDDQREQFLELAKKWMSDAESIDQGIE
Ga0075431_10172266813300006847Populus RhizosphereMSKTDEYRQLADDCIVWARATSDDQREQFLELANKWMSD
Ga0075431_10212179213300006847Populus RhizosphereMSKTDEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQGIELRRAKAS
Ga0075424_10044325923300006904Populus RhizosphereMSKTADYRRLAEGCIAWAGLAISGDQREQFLELAKKWMSDAESIDQGIELRRAKASEMAGEEIDRLG
Ga0075436_10103549313300006914Populus RhizosphereMSKTDEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQ
Ga0075435_10107050523300007076Populus RhizosphereMSKTADYRRLAEGCIAWAGLAISGDQREQFLELAKKWMSD
Ga0111539_1181373313300009094Populus RhizosphereMSKKDEYRQLADGCIAWARLAISDDQREQFLELAKKWLSDAESIDQ
Ga0066709_10174215523300009137Grasslands SoilMSKTDEYRQIANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIELRP
Ga0114129_1159274633300009147Populus RhizosphereMSKTDEYRQFANDCIVWARIATSDDQREQFLELAKKWMS
Ga0114129_1285757523300009147Populus RhizosphereMSKSDEYRQFADDCIVWARIATSDDQREQFLELAKKWLSDAESIDQGIELRRAKAS
Ga0111538_1344315713300009156Populus RhizosphereMSKTDEYRQFANDCIVWARIATSDDQREQFLEVAKKWMSEAESIDQGIELRPAKASEMAG
Ga0134082_1007338543300010303Grasslands SoilRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQRIELRPTEAAKASEMAGEVIVS*
Ga0134082_1038966013300010303Grasslands SoilMSKTDEYRQIANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIELRPNNAAKASEMAGEEI
Ga0126379_1073541523300010366Tropical Forest SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIEVRANKAS
Ga0126379_1279948413300010366Tropical Forest SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAAR
Ga0134126_1283377023300010396Terrestrial SoilMSKNAEYRQLADGCIAWARLAISDDQREQFLELAKKWMSDAESIDQRMGLAAKASEM
Ga0137383_1043161123300012199Vadose Zone SoilMSKADKYRQFANDCIVWARIATSDDQREQFLELAKKWRSDAESIDQGIELRDA*
Ga0137383_1057337213300012199Vadose Zone SoilMSKTDEYRQFASDCIVWARIATSDDQREQFLELAKKWMSDAESIDRGTEL
Ga0137383_1087290513300012199Vadose Zone SoilMSKTDEFRQLANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIELRPNNAAKASEMAGEEIDRL
Ga0137382_1033219233300012200Vadose Zone SoilMSDADEYRSFANDCIVWARIATSDDQREQFLQLAKKWMSDAESIDQGIELRPNEAAKASEMAG
Ga0137363_1018898313300012202Vadose Zone SoilDEYRQFANDCIAWARIAISDHQREQFLELAKKWTQDAEKIDSGHRGAH*
Ga0137384_1103782913300012357Vadose Zone SoilMSKADQYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAQSKEEDAKASQMAGEEI
Ga0137360_1022876013300012361Vadose Zone SoilMSKTDEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESID
Ga0157353_105092313300012496Unplanted SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDKGIDPRSNKAAKASEMAGEEIDHLG
Ga0157354_104942413300012517Unplanted SoilMSKTADYRRLAEGCIAWARLAISDDQREQFLELAKKWLSDAESIDDQDIELRRAKASEMAGEEIDRL
Ga0137373_1100973413300012532Vadose Zone SoilMSKTDEYRQLANDCIVWARIATSDDQREQFLELAEKWMS
Ga0137395_1090808313300012917Vadose Zone SoilMSEADEYRQFASDCIVWARIATSDDQREQFLELAKKWMSDAESIDQ
Ga0164299_1098205513300012958SoilMAEEGSMSKTAEYRQLADDCIAWARLATSDDQREQFLELAKK
Ga0132258_1017534713300015371Arabidopsis RhizosphereMSKTDEYRQLADGCIAWARLAISDEQREQFLELAKKWLSDAESIDDQDIELRRAKASEMAGEEIDRL
Ga0132258_1113154813300015371Arabidopsis RhizosphereMSKTDEYRQLADGCIAWARLAISDEQHEQFLELAKKWLSDAESIDDQDIELRRAKASEMAGEEIDRL
Ga0132256_10011012613300015372Arabidopsis RhizosphereMSKKDEYRQLADGCIAWARLAISDDQREQFLELAKKWLSDAESIDQDI
Ga0132257_10014672173300015373Arabidopsis RhizosphereMSKKDEYRQLADGCIAWARLAISDDQHEQFLELAKKWLSDAESIDHQD
Ga0182036_1029571423300016270SoilMPDHRGGPDEYRQFADDCIAWARIAISDGQRDQFLELAKKWMQEAEMIDQNIKVLRANKA
Ga0182041_1121253423300016294SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRAN
Ga0182035_1036917543300016341SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKK
Ga0182035_1214066813300016341SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANK
Ga0182032_1096690713300016357SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEM
Ga0182032_1162223723300016357SoilMSKADEYRQFADDCIAWARIAISDHQRDQFLELAKKWMQEAEMIDQNIKVLRANK
Ga0182034_1066822113300016371SoilMFKADEYRQFADDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIERANKASEMAGREIDLL
Ga0182037_1050457913300016404SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAAR
Ga0182039_1027477623300016422SoilMSKADEYREFANDCIVWARIAISDDQREQFLELAKK
Ga0182038_1073503623300016445SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRT
Ga0182038_1077411523300016445SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAA
Ga0182038_1145821713300016445SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAA
Ga0066667_1087717513300018433Grasslands SoilMSKTAEYRQLADGCIAWACLAISDDQREQFLELAKQWRSEAESLDPGN
Ga0066662_1028149333300018468Grasslands SoilMSKTDEYRQIANDCIVWARIATSDDQRDQFLELAKKWMSDAESIDQGIEL
Ga0210384_1052913323300021432SoilMSRADEYCQFANDCIVWARIATSGDQREQFLELATKWMSDAESIDQGIELRAKETAKASE
Ga0210392_1104643013300021475SoilMSKTDEYRRLADGCIAWARLAISDDQREQFLELAKKWLSDAESFEGIELRRAKASEMAGEEIDRL
Ga0126371_1376399513300021560Tropical Forest SoilMSKKDEYRQLADGCMAWARLAISDDQREQFLELAKKWLSDAESIDQDIIELRR
Ga0179589_1040951513300024288Vadose Zone SoilMSKTDEYRQIANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQGIELRPTEAAKAIE
Ga0207663_1090587213300025916Corn, Switchgrass And Miscanthus RhizosphereMPDAHEYRQVANDCIVWARIATSDDQRARLVELAKQWEAG
Ga0207700_1168466013300025928Corn, Switchgrass And Miscanthus RhizosphereMSKTDQYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQDIE
Ga0209056_1037520133300026538SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAKKWMSDAESI
Ga0209474_1055196013300026550SoilMTEADEYRQFANDCIVWARIATSDNQRARLVELAKQWEAGAK
Ga0179593_117886043300026555Vadose Zone SoilVSKADEYRQFANDCIVLARTTSDDQREQFLELAKKWRSDAESSDRGTELRPKEAAKASEMAAEE
Ga0209523_101215013300027548Forest SoilMSKADEYRQFANDCIVWARIATSDDQREQFLELAEKW
Ga0209382_1157302013300027909Populus RhizosphereMSKTAEYRQLADDCITWARIATSDDQREQFLELAKKWMS
Ga0307312_1114215013300028828SoilMPKTDEYRRLADGCIAWARLAISDDQREQFLELAKRW
Ga0170818_10180059313300031474Forest SoilMSKTDEYRRLANDCIVWARIATSDDQREQFLELAKKWMSDAESIDQGIELRPKGAAKASEMAGEEIDRVGDPLA
Ga0318516_1029466513300031543SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWMQDAEMIDQGIEVRAN
Ga0318541_1006136933300031545SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKV
Ga0318571_1032532923300031549SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQ
Ga0318528_1072485323300031561SoilMSKADEYRQFANDCIAWARIAISDDQREQFLEHRVCT
Ga0318515_1040095113300031572SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAK
Ga0318515_1058437123300031572SoilMSKADEYRQFADDCIAWARIAISDHQRDQFLELAKKWMQEAEMIDQNIKVLRANKATEMA
Ga0310915_1020630013300031573SoilMSKADEYRQFADDCIAWARIAISDHQRDQFLELAKKW
Ga0310915_1060571113300031573SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAARASEMAGREIDLLGDPSATD
Ga0310915_1085360323300031573SoilMSKADEYRQFASDCIVWARIATSGDQREQFLELAKKWMSD
Ga0318542_1041564023300031668SoilMPDHRGGPDEYRQFADDCIAWARIAISDGQRDQFLELAKKWMQEAEMIDQNIKVLRANKAKASE
Ga0318561_1055793013300031679SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRTKAVKASEMAGREI
Ga0318574_1013242533300031680SoilMSKADEYRQLANDCIAWARIAISHDQREQFLELAKKWTQDAE
Ga0318560_1040897713300031682SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIERANKASE
Ga0306917_1125851413300031719SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGI
Ga0307468_10117321013300031740Hardwood Forest SoilMSKTDEYRQLADGCIAWARLAISDDQREQFLELAKKWLSDAE
Ga0306918_1023496923300031744SoilMSKADEYREFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIER
Ga0306918_1052628513300031744SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDA
Ga0318502_1072294613300031747SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIE
Ga0318494_1058729723300031751SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWMQDAEMIDQGIE
Ga0318494_1060428713300031751SoilMSEAHEYRQFANDCIVWARMTTSDDMRARLLELAKKWSSDAE
Ga0318535_1025336113300031764SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIERANKA
Ga0318547_1071562123300031781SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIERANKAS
Ga0318548_1008871023300031793SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIEVRASKASE
Ga0318497_1044171713300031805SoilMSKADEYRQFANDCIAWARIAISHDQREQFLELAKKWMQDAEMIDQGIEVRANKASEM
Ga0318497_1069819313300031805SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRTKAVKAS
Ga0318512_1074809523300031846SoilMSKADEYRQFANDCIAWARIAISHDQREQFLELAKKWMQDAKMIDQGI
Ga0318495_1054204213300031860SoilMSKADEYRQLANDCIAWARIAISHDQREQFLELAKKWMQDAEMIDQGIERANKASEMAGREIDLL
Ga0318544_1012109813300031880SoilMSKADEYRQFANDCIAWARIAISDDQRQQFLELAKKWTQDAEMIDQGIEVRTNNAAKASEMAGREID
Ga0306925_1123140713300031890SoilMSKTDEYRQFANDCIVWARIATSGDQREQFLELAKKWM
Ga0306923_1108821023300031910SoilMTMQNDNKRHACSMSKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRAN
Ga0306921_1063760523300031912SoilMSKADEYREFANDCIVWARIAISDDQREQFLELAKKWMQDA
Ga0306921_1143166823300031912SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRTNQ
Ga0310916_1020880113300031942SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKAARA
Ga0310909_1005155313300031947SoilMSKADEYRQFANDCIAWARIAISDDQRQQFLELAKK
Ga0310909_1031385543300031947SoilMSKADEYRQLANDCIAWARIAISHDQREQFLELAKKWTQDAEMIDQGIEVRANKAS
Ga0306926_1110165623300031954SoilMSKTDEYRQFASDCIVWARIATSDDQREQFLELAKKWLSDAESIDQGIELRTKEAAKAS
Ga0318530_1028910923300031959SoilMSKADEYRQFANDCIAWARIAISHDQREQFLELAKKWMQDAEMIDQGIEVRANKASE
Ga0318530_1041552213300031959SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWMQDAEMIDQGIERANKASEM
Ga0306922_1105293713300032001SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWMQDAEMIDQGIEVRANKASEM
Ga0306922_1145689113300032001SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAEMIDQGIKVRANKA
Ga0318569_1020997113300032010SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIEVRANKASE
Ga0318507_1017880913300032025SoilMSETHEYRQFANDCIVWARMTTSDDMRARLLELAKKWSSDAEKLG
Ga0310911_1002437133300032035SoilMSKADEYRQFADDCIAWARIAISDDQRDQFLELAKKWMQDAEMIDQGIK
Ga0310911_1040944213300032035SoilMSEAHEYRQFANDCIVWARMTTSDDMRARLLELAKKWSSDAEKLG
Ga0310911_1075858413300032035SoilMTMQNDNKRHACSMSKADEYRQFADDCIVWARIAISDDQRDQFLELAKKWMQDAE
Ga0318549_1047837623300032041SoilMSKADEYRQFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIERA
Ga0318556_1051805913300032043SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRTN
Ga0318532_1006858513300032051SoilMSKADEYRQFANDCIAWARIAISDDQRQQFLELAKKWTQDAEMIDQGIEVRANKASEMAG
Ga0318533_1035839833300032059SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGAQVRTNQAVKASEMAGREIDLL
Ga0318504_1002655743300032063SoilMSKADEYRQFANDCIAWARIAISDDQREQFLELAKKWMQDAEMID
Ga0306924_1157147623300032076SoilMFKADEYRQFADDCIVWARIAISDDQRDQFLELAKKW
Ga0318525_1063881023300032089SoilMSKADEYREFANDCIVWARIAISDDQREQFLELAKKWMQDAEMIDQGIE
Ga0318540_1051138713300032094SoilMSEAHEYRQFAKDCIVWARIATCDDQREQFLELAKKWMQDAEMIDQGA
Ga0306920_10056021113300032261SoilMSKADDYRQFANDCIVWARIAISDDQREQFLELAKKWRSDAETIDQGMELEA
Ga0310914_1056171123300033289SoilMSEAHEYRQFANDCIVWARMTTSDDMRARLLELAKKWRSDVEKLDVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.