| Basic Information | |
|---|---|
| Family ID | F059198 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVENDGRVEFL |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 90.30 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.761 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.448 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.851 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.582 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 42.86% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF13531 | SBP_bac_11 | 18.66 |
| PF13343 | SBP_bac_6 | 17.16 |
| PF09084 | NMT1 | 6.72 |
| PF01177 | Asp_Glu_race | 4.48 |
| PF04909 | Amidohydro_2 | 3.73 |
| PF01977 | UbiD | 1.49 |
| PF00557 | Peptidase_M24 | 1.49 |
| PF12704 | MacB_PCD | 0.75 |
| PF13701 | DDE_Tnp_1_4 | 0.75 |
| PF02371 | Transposase_20 | 0.75 |
| PF14720 | NiFe_hyd_SSU_C | 0.75 |
| PF05145 | AbrB | 0.75 |
| PF02775 | TPP_enzyme_C | 0.75 |
| PF08378 | NERD | 0.75 |
| PF12838 | Fer4_7 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 6.72 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 6.72 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.49 |
| COG3180 | Uncharacterized membrane protein AbrB, regulator of aidB expression | General function prediction only [R] | 0.75 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.76 % |
| Unclassified | root | N/A | 2.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c1055952 | Not Available | 1898 | Open in IMG/M |
| 3300000574|JGI1357J11328_10111837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300003319|soilL2_10096254 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300004022|Ga0055432_10188298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300004463|Ga0063356_103298998 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300004779|Ga0062380_10196518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300005093|Ga0062594_102706381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300005174|Ga0066680_10686417 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005293|Ga0065715_10207498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1330 | Open in IMG/M |
| 3300005294|Ga0065705_10290802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300005454|Ga0066687_10467623 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005468|Ga0070707_101504282 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005530|Ga0070679_101919876 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005586|Ga0066691_10679134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300005618|Ga0068864_101348705 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005713|Ga0066905_102100788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300006175|Ga0070712_101260609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300006196|Ga0075422_10439301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300006844|Ga0075428_102435683 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006852|Ga0075433_10548766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
| 3300006854|Ga0075425_100181641 | All Organisms → cellular organisms → Bacteria | 2416 | Open in IMG/M |
| 3300006880|Ga0075429_100496066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1070 | Open in IMG/M |
| 3300006894|Ga0079215_10024102 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300006904|Ga0075424_101480336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300006914|Ga0075436_101370074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300006918|Ga0079216_10944071 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006969|Ga0075419_10240753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1207 | Open in IMG/M |
| 3300006969|Ga0075419_10873360 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300009094|Ga0111539_12327515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300009111|Ga0115026_11138612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300009147|Ga0114129_10509002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300009147|Ga0114129_12493548 | Not Available | 618 | Open in IMG/M |
| 3300009156|Ga0111538_10914515 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300009545|Ga0105237_11245828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300009553|Ga0105249_10509370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1250 | Open in IMG/M |
| 3300009610|Ga0105340_1348108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300010362|Ga0126377_10282707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1629 | Open in IMG/M |
| 3300010362|Ga0126377_11059979 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300010362|Ga0126377_12062928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300010376|Ga0126381_103799583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300010399|Ga0134127_12804914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 567 | Open in IMG/M |
| 3300010400|Ga0134122_10183487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1724 | Open in IMG/M |
| 3300010400|Ga0134122_10430391 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300010401|Ga0134121_11702373 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300011405|Ga0137340_1055126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300011409|Ga0137323_1005029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3232 | Open in IMG/M |
| 3300011416|Ga0137422_1085472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
| 3300012160|Ga0137349_1015812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1155 | Open in IMG/M |
| 3300012174|Ga0137338_1108182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300012198|Ga0137364_10220143 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300012231|Ga0137465_1167953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300012356|Ga0137371_10007073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8725 | Open in IMG/M |
| 3300012358|Ga0137368_10754629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300012361|Ga0137360_10659513 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012477|Ga0157336_1015522 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012897|Ga0157285_10025709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300012923|Ga0137359_10402784 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300012929|Ga0137404_12239545 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012955|Ga0164298_10002894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5702 | Open in IMG/M |
| 3300012957|Ga0164303_11006652 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012971|Ga0126369_12771509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300012989|Ga0164305_11989081 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300013297|Ga0157378_11338488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300013308|Ga0157375_11910029 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300014267|Ga0075313_1178505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300014320|Ga0075342_1017729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1598 | Open in IMG/M |
| 3300014876|Ga0180064_1116250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300015374|Ga0132255_104398900 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300017654|Ga0134069_1008645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2910 | Open in IMG/M |
| 3300017659|Ga0134083_10081356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1258 | Open in IMG/M |
| 3300018028|Ga0184608_10102900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1194 | Open in IMG/M |
| 3300018032|Ga0187788_10156844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300018054|Ga0184621_10051699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1374 | Open in IMG/M |
| 3300018054|Ga0184621_10062457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1267 | Open in IMG/M |
| 3300018066|Ga0184617_1087261 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300018075|Ga0184632_10039549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2026 | Open in IMG/M |
| 3300018429|Ga0190272_10253478 | Not Available | 1323 | Open in IMG/M |
| 3300018429|Ga0190272_10399783 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300018469|Ga0190270_11133855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300019356|Ga0173481_10109156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1078 | Open in IMG/M |
| 3300019789|Ga0137408_1271043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1570 | Open in IMG/M |
| 3300019886|Ga0193727_1062763 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300020006|Ga0193735_1089750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300020061|Ga0193716_1045586 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
| 3300021432|Ga0210384_10372636 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
| 3300021560|Ga0126371_10418068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1484 | Open in IMG/M |
| 3300021560|Ga0126371_10916669 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300025324|Ga0209640_10797892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300025580|Ga0210138_1040566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1051 | Open in IMG/M |
| 3300025796|Ga0210113_1095352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300025905|Ga0207685_10309917 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300025914|Ga0207671_11107821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300025933|Ga0207706_10592748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
| 3300025935|Ga0207709_10835393 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300025959|Ga0210116_1098209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300025961|Ga0207712_10568288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300025986|Ga0207658_10452800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1136 | Open in IMG/M |
| 3300026067|Ga0207678_11907714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300026315|Ga0209686_1167280 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300026317|Ga0209154_1239084 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026327|Ga0209266_1039952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2399 | Open in IMG/M |
| 3300026329|Ga0209375_1032155 | All Organisms → cellular organisms → Bacteria | 2814 | Open in IMG/M |
| 3300026536|Ga0209058_1077311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1761 | Open in IMG/M |
| 3300026547|Ga0209156_10133681 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300026550|Ga0209474_10160226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1459 | Open in IMG/M |
| 3300027840|Ga0209683_10378621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 650 | Open in IMG/M |
| 3300027886|Ga0209486_10640784 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300027909|Ga0209382_10904814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300028379|Ga0268266_10341993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1405 | Open in IMG/M |
| 3300031231|Ga0170824_102396450 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031446|Ga0170820_15033410 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300031474|Ga0170818_101013424 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031547|Ga0310887_10920872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300031573|Ga0310915_10959404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300031720|Ga0307469_10235510 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300031720|Ga0307469_12442238 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031740|Ga0307468_100134144 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300031908|Ga0310900_10324909 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300031908|Ga0310900_11348314 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031912|Ga0306921_10180447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2475 | Open in IMG/M |
| 3300031941|Ga0310912_10587852 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032002|Ga0307416_102623038 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032005|Ga0307411_10259383 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300032013|Ga0310906_10443820 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032075|Ga0310890_10555853 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300032157|Ga0315912_10032855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4176 | Open in IMG/M |
| 3300032180|Ga0307471_102106019 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300033158|Ga0335077_10621716 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300033412|Ga0310810_11462912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300033414|Ga0316619_10079900 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300033433|Ga0326726_11547102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300033481|Ga0316600_10512726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 833 | Open in IMG/M |
| 3300034090|Ga0326723_0294412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300034417|Ga0364941_154846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.46% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.22% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.24% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.49% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.49% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.75% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_10559521 | 2228664021 | Soil | MANIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVEDSGKVEFLLGAHHTGFKADASELQGQ |
| JGI1357J11328_101118371 | 3300000574 | Groundwater | MAKIRAVVVEGDRQQGYKRVQVLFGANSFIEITDAAGRVNLLVGAHDRGFT |
| soilL2_100962541 | 3300003319 | Sugarcane Root And Bulk Soil | MAKIRSVVVEGSRESGFRRVQVLFGTNYFVEIVDRDGKVDFTLGAHHTGFKADASD |
| Ga0055432_101882982 | 3300004022 | Natural And Restored Wetlands | MAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDDAGQINLLLGAHDRGVK |
| Ga0063356_1032989982 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAKIRSVVVEGTRETGYKRVQVLFGTNYFLEIVEDAGRVELLLGAHHTGFKADASELQGE |
| Ga0062380_101965182 | 3300004779 | Wetland Sediment | MAKIRAVVVEGDRERGYERVQVLFGTNSFIEITENDGRVMCLLGAHAGGVEVDGSE |
| Ga0062594_1027063811 | 3300005093 | Soil | MAKIRGVVVEGDRQHGYKRVQVLFGTNSFIEITENDGRVMC |
| Ga0066680_106864171 | 3300005174 | Soil | MAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVS |
| Ga0065715_102074983 | 3300005293 | Miscanthus Rhizosphere | MAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENQGRVDFLLGAHHTGFKADASE |
| Ga0065705_102908021 | 3300005294 | Switchgrass Rhizosphere | MAKIRGVVVEGDRQTGYNRVQVLFGTNSFIEITENDGRVMCLLGAHAGGVQAEASDS |
| Ga0066687_104676231 | 3300005454 | Soil | MAKIRSVVVEGNREHGYRTVQVLFGQFFLEITESDGRVSFLL |
| Ga0070707_1015042821 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDEGGQVNFLLGSHHEAFKADASEVKGD |
| Ga0070679_1019198762 | 3300005530 | Corn Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGRVNFLLGAHHTGFKADASEL |
| Ga0066691_106791342 | 3300005586 | Soil | MAKIRAVVAEGDRERGYKRIQVLFGTNSFIEITENDGKVMCLLGARDGGIQADAS |
| Ga0068864_1013487052 | 3300005618 | Switchgrass Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGRVNFLLGAHHTG |
| Ga0066905_1021007881 | 3300005713 | Tropical Forest Soil | MAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEE |
| Ga0070712_1012606092 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSE |
| Ga0075422_104393012 | 3300006196 | Populus Rhizosphere | MAKIRAVVVEGNRESGYKRVHVLFGTNSFVEITEN |
| Ga0075428_1024356832 | 3300006844 | Populus Rhizosphere | MAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDG |
| Ga0075433_105487662 | 3300006852 | Populus Rhizosphere | MAKIRAVVVEGNRESGYKRVHVLFGTNSFVEITENDGRV |
| Ga0075425_1001816413 | 3300006854 | Populus Rhizosphere | MAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADG |
| Ga0075429_1004960663 | 3300006880 | Populus Rhizosphere | MAKIRAVVTEGDRQHGYKRVQVLFGTNYFLEIVENDG |
| Ga0079215_100241023 | 3300006894 | Agricultural Soil | MAKIRSVVVEGERQSGYKRVQVLFGTNYFLEIVENDGKVEFLL |
| Ga0075424_1014803361 | 3300006904 | Populus Rhizosphere | MAKIRAVVVEGDRERGYKRIQVLFGTNSFIEITENDGKVMC |
| Ga0075436_1013700742 | 3300006914 | Populus Rhizosphere | MAKIRAVVVEGDRERGYRRVQVLFGTNSFVEITEQEGRVLCLLGAHDGGVQADGSE |
| Ga0079216_109440711 | 3300006918 | Agricultural Soil | MAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEFL |
| Ga0075419_102407531 | 3300006969 | Populus Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVD |
| Ga0075419_108733601 | 3300006969 | Populus Rhizosphere | MAKIRAVVTEGDRQHGYKRVQVLFGTNYFLEIVENDGRVEFLL |
| Ga0111539_123275153 | 3300009094 | Populus Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGR |
| Ga0115026_111386121 | 3300009111 | Wetland | MAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLG |
| Ga0114129_105090021 | 3300009147 | Populus Rhizosphere | MAKIRAVIVEGNRESGYQLVQVLFGTNAFVEITERT |
| Ga0114129_124935482 | 3300009147 | Populus Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLG |
| Ga0111538_109145151 | 3300009156 | Populus Rhizosphere | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADASELNGQLQK |
| Ga0105237_112458282 | 3300009545 | Corn Rhizosphere | MAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEAN |
| Ga0105249_105093701 | 3300009553 | Switchgrass Rhizosphere | MAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITENEGRVL |
| Ga0105340_13481081 | 3300009610 | Soil | MAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDD |
| Ga0126377_102827073 | 3300010362 | Tropical Forest Soil | MAKIRAVVVEGDRERGYKRVQVLFGTNSFIEITENDGRVLCLLGA |
| Ga0126377_110599792 | 3300010362 | Tropical Forest Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADATELNGQ |
| Ga0126377_120629282 | 3300010362 | Tropical Forest Soil | MAKIRSVVVEGNREHGYKRVQVLFGVNYFLEITEDGDRVSFLLGNHHEAFK |
| Ga0126381_1037995831 | 3300010376 | Tropical Forest Soil | MAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEENDCVTFLLGNHHEAFK |
| Ga0134127_128049142 | 3300010399 | Terrestrial Soil | MAKIRSVVVEGNREQGYKRVQVLFGTDCFLEITDQQGRIEFLLGSHHEAFK |
| Ga0134122_101834871 | 3300010400 | Terrestrial Soil | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGVQADGSE |
| Ga0134122_104303911 | 3300010400 | Terrestrial Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDF |
| Ga0134121_117023731 | 3300010401 | Terrestrial Soil | MAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGR |
| Ga0137340_10551261 | 3300011405 | Soil | MAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGN |
| Ga0137323_10050295 | 3300011409 | Soil | MAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDHAGQINLLVGAHDRGVKLDGSEAH |
| Ga0137422_10854722 | 3300011416 | Soil | MAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGNVSFLLGSHHE |
| Ga0137349_10158122 | 3300012160 | Soil | MAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRVTCLLGAHDGGVQADGSE |
| Ga0137338_11081822 | 3300012174 | Soil | MAKIRAVVVEGDRERGYKRVQVLFGTNYFLEIDEHDGRVSFLLGAHHEAFKA |
| Ga0137364_102201431 | 3300012198 | Vadose Zone Soil | MAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAIMKPSRRML |
| Ga0137465_11679532 | 3300012231 | Soil | MAKIRAVVVEGDRQHGYKRVQIIFGTNSFIEITENDGRVTCLLGAHDGGVQ |
| Ga0137371_100070734 | 3300012356 | Vadose Zone Soil | MAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAIMKPSRRMLRKQRES |
| Ga0137368_107546291 | 3300012358 | Vadose Zone Soil | MAKIRAVVVEGDRERGYKRVQVLFGANSFVEITEND |
| Ga0137360_106595131 | 3300012361 | Vadose Zone Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVENDGRVEFL |
| Ga0157336_10155221 | 3300012477 | Arabidopsis Rhizosphere | MAKIRSVVVEGDRQNGYRRVQVLFGTNYFLEIVENDGHVDFLLG |
| Ga0157285_100257092 | 3300012897 | Soil | MAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEK |
| Ga0137359_104027841 | 3300012923 | Vadose Zone Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEND |
| Ga0137404_122395452 | 3300012929 | Vadose Zone Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVEN |
| Ga0164298_100028942 | 3300012955 | Soil | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGVQAHGS* |
| Ga0164303_110066521 | 3300012957 | Soil | MAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGRVEFL |
| Ga0126369_127715091 | 3300012971 | Tropical Forest Soil | MAKIRSVVVEGDREHGYKRVQVLFGVNYFLEITEENDSVTFLL |
| Ga0164305_119890812 | 3300012989 | Soil | MAKIRSVVVEGNRESGYKRVQVLFGTNYFIEIVDNDGRVEFLLGA |
| Ga0157378_113384881 | 3300013297 | Miscanthus Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDG |
| Ga0157375_119100291 | 3300013308 | Miscanthus Rhizosphere | MAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENQG |
| Ga0075313_11785051 | 3300014267 | Natural And Restored Wetlands | MAKIRAVVVEGDREHGYKRVQILFGTNYFAEIVDDGGRVSFLL |
| Ga0075342_10177291 | 3300014320 | Natural And Restored Wetlands | MAKIRAVVVEGDREQGYKRVQILFGTNYFVEIVDDGGRVSF |
| Ga0180064_11162501 | 3300014876 | Soil | MAKIRAVVVEGDREQGYKRVQILFGTNYFAEIIDDGGNVSFLLGSHHEAFKADA |
| Ga0132255_1043989001 | 3300015374 | Arabidopsis Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGFKADASEREGE |
| Ga0134069_10086454 | 3300017654 | Grasslands Soil | MAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITES |
| Ga0134083_100813562 | 3300017659 | Grasslands Soil | MAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKRMLRKQRES |
| Ga0184608_101029001 | 3300018028 | Groundwater Sediment | MAKIRAVVVEGDRERGYKRVQVLFGTNSFVEITENDGR |
| Ga0187788_101568441 | 3300018032 | Tropical Peatland | MAKIRAVVLEGDRQTGYKRVQILFGTNSFVEITENDGRVKCLLGAHDGGVQA |
| Ga0184621_100516991 | 3300018054 | Groundwater Sediment | MAKIRAVIVEGDRERGYKRVQVLFGTNSFVEITEND |
| Ga0184621_100624571 | 3300018054 | Groundwater Sediment | MAKIRAVVVEGDRERGYKRVQVLFGTNSFVEITENEGRVMCLLGTHDGGVEVDGSVANGQFAQ |
| Ga0184617_10872611 | 3300018066 | Groundwater Sediment | MAKIRSVVVEGDRQSGYQRVQVLFGTNYFLEIVENQGRV |
| Ga0184632_100395493 | 3300018075 | Groundwater Sediment | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRV |
| Ga0190272_102534781 | 3300018429 | Soil | MANIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGRVDFLLGAHHT |
| Ga0190272_103997831 | 3300018429 | Soil | MAKIRAVVVEGDRERGYKRVQVIFGTNSFIEITENDGRVMC |
| Ga0190270_111338551 | 3300018469 | Soil | MAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRV |
| Ga0173481_101091561 | 3300019356 | Soil | MAKIRAVIVEGNRESGYERVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEANG |
| Ga0137408_12710434 | 3300019789 | Vadose Zone Soil | MAKIRAVVIEGDRQRGYKRVQVLFGTNSFVEITENDGRVMCLLGT |
| Ga0193727_10627631 | 3300019886 | Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHT |
| Ga0193735_10897501 | 3300020006 | Soil | MAKIRAVVVEGDRERGYKRIQVLFGTNSFIEITENDGKVMCLLGARDGGIQADASTA |
| Ga0193716_10455863 | 3300020061 | Soil | MAKIRSVVVEGDRQSGYKRVQVLFGTNYFLEIVENEGRVDFLLGAHHTGFNADASEL |
| Ga0210384_103726361 | 3300021432 | Soil | MAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGQVSFLLGSHHEAFKADASE |
| Ga0126371_104180683 | 3300021560 | Tropical Forest Soil | MAKIRAVVVEGNRETGYKRVQVLFGTNSFVEITEDDGQVLCLLGAHD |
| Ga0126371_109166692 | 3300021560 | Tropical Forest Soil | MAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGRVEFLLGAHHEAFKADASEAKG |
| Ga0209640_107978922 | 3300025324 | Soil | MAKIRAVVVEGDREHGYRRVQVLFGTNYFVEIVDNDGKISFLLGAHHE |
| Ga0210138_10405662 | 3300025580 | Natural And Restored Wetlands | MAKIRAVVVEGDRSSGYRRVQVLFGTNSFIEITDDAGQINLLLGAHDRGVKVDGSE |
| Ga0210113_10953522 | 3300025796 | Natural And Restored Wetlands | MAKIRAVVVEGDQERGYRRVQVLFGTNYFLEISDNDGKISFVLGARDEAFKAD |
| Ga0207685_103099171 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENEGHVDF |
| Ga0207671_111078212 | 3300025914 | Corn Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIHADGSE |
| Ga0207706_105927483 | 3300025933 | Corn Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENEGRVLCLLGTHDG |
| Ga0207709_108353931 | 3300025935 | Miscanthus Rhizosphere | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGFKADASEREGELQ |
| Ga0210116_10982091 | 3300025959 | Natural And Restored Wetlands | MANIRAVVVEGDRERGYKRVQILFGTNYFAEIIDDGGRVSFLLGSHHEAFKAD |
| Ga0207712_105682881 | 3300025961 | Switchgrass Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENEGRVL |
| Ga0207658_104528002 | 3300025986 | Switchgrass Rhizosphere | MAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDG |
| Ga0207678_119077142 | 3300026067 | Corn Rhizosphere | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITENDGRVLCLLGTHDGGV |
| Ga0209686_11672802 | 3300026315 | Soil | MAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFL |
| Ga0209154_12390841 | 3300026317 | Soil | MAKIRSVVVEGNREDGYKTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKADASEAKG |
| Ga0209266_10399524 | 3300026327 | Soil | MAKIRSVVVEGNREHGYKTVQVLFGTNFFLEISESDGRVSFLLGAHHEAFKADASEAKGE |
| Ga0209375_10321555 | 3300026329 | Soil | MAKIRSVVVEGNREDGYRTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFK |
| Ga0209058_10773111 | 3300026536 | Soil | MAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFLLGAHHEAFKADASEA |
| Ga0209156_101336811 | 3300026547 | Soil | MAKIRSVVVEGNREHGYKTVQVLFGTNFFLEISESDGRVSFLLGAHHE |
| Ga0209474_101602263 | 3300026550 | Soil | MAKIRSVVVEGNREHGYRTVQVLFGTNFFLEITESDGRVSFL |
| Ga0209683_103786211 | 3300027840 | Wetland Sediment | MAKIRAVVVEGDRERGYERVQVLFGTNSFIEITENDGRVMCLLGAHAGGVEVDGSEARGQ |
| Ga0209486_106407842 | 3300027886 | Agricultural Soil | MAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRV |
| Ga0209382_109048141 | 3300027909 | Populus Rhizosphere | MAKIRAVIVEGNRESGYQRVQVLFGTNAFVEITEKDGRVLC |
| Ga0268266_103419933 | 3300028379 | Switchgrass Rhizosphere | MAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITEKDGRVLCLLGTHDGGIQADGSEAN |
| Ga0170824_1023964502 | 3300031231 | Forest Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDG |
| Ga0170820_150334101 | 3300031446 | Forest Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGA |
| Ga0170818_1010134242 | 3300031474 | Forest Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLG |
| Ga0310887_109208721 | 3300031547 | Soil | MAKIRAVIVEGNRETGYQRVQVLFGTNSFVEITEND |
| Ga0310915_109594041 | 3300031573 | Soil | MAKIRAVVVEGNRETGYKRVQVLFGTNSFVEISEADGQVLCLLGAHDGGVQADGSEANSRFA |
| Ga0307469_102355103 | 3300031720 | Hardwood Forest Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHT |
| Ga0307469_124422382 | 3300031720 | Hardwood Forest Soil | MAKIRSVVVEGNREQGFKRVQVLFGTDYFLEIVDDGGQVSFLLGSHHEAFKADASEAQGA |
| Ga0307468_1001341441 | 3300031740 | Hardwood Forest Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKANASELNGQLQ |
| Ga0310900_103249093 | 3300031908 | Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADAS |
| Ga0310900_113483141 | 3300031908 | Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAHHTGF |
| Ga0306921_101804473 | 3300031912 | Soil | MAKIRAVVVEGNRERGYKRVQVLFGTNSFVEITEHEVA |
| Ga0310912_105878522 | 3300031941 | Soil | MAKIRAVVVEGDREHGYKRVQVLFGTNYFLEIVEDDGRVEFLLGAHHTGFKADASELNG |
| Ga0307416_1026230382 | 3300032002 | Rhizosphere | MAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEFLLGAHHTGFKADASEPNGE |
| Ga0307411_102593833 | 3300032005 | Rhizosphere | MAKIRAVITEGDRQNGYKRVQVLFGTNYFLEIVENDGRVEF |
| Ga0310906_104438201 | 3300032013 | Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGAH |
| Ga0310890_105558531 | 3300032075 | Soil | MAKIRSVVVEGDRQNGYKRVQVLFGTNYFLEIVENDGHVDFLLGTHH |
| Ga0315912_100328551 | 3300032157 | Soil | MAKIRGVVVEGDRQHGYKRVQVLFGTNSFIEITEN |
| Ga0307471_1021060191 | 3300032180 | Hardwood Forest Soil | MAKIRAVVVEGDRERGYKRVHVLFGTNYFLEIVENDGRVEFLLGAHHTGFKADASELNGQLQK |
| Ga0335077_106217163 | 3300033158 | Soil | MAKIRSVIVEGNREQGFKRVQVLFGTDYFLEIIDDG |
| Ga0310810_114629121 | 3300033412 | Soil | MAKIRAVIVEGNRESGYQRVQVLFGTNSFVEITENDGR |
| Ga0316619_100799003 | 3300033414 | Soil | MAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLGSHAGGVHADRS |
| Ga0326726_115471022 | 3300033433 | Peat Soil | MAKIRAVVVEGDRQQGYKRVQVLFGANSFIEITDEAGRVKLLVGAHDRGFTVD |
| Ga0316600_105127261 | 3300033481 | Soil | MAKIRSVVVEGDRQRGYKRVQILFGVNSFIEITENDG |
| Ga0326723_0294412_576_728 | 3300034090 | Peat Soil | MVKIRGVVVEGDRQRGYKRVQILFGVNSFIEITENDGRVMCLLGSHAGGVH |
| Ga0364941_154846_2_124 | 3300034417 | Sediment | MAKIRAVVVEGDRQNGYKRVQIIFGTNSFIEITENDGRVTC |
| ⦗Top⦘ |