| Basic Information | |
|---|---|
| Family ID | F059191 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VFYVPWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 78.36 % |
| % of genes from short scaffolds (< 2000 bps) | 72.39 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.701 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.881 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.239 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 2.99 |
| PF13091 | PLDc_2 | 2.24 |
| PF07883 | Cupin_2 | 2.24 |
| PF00881 | Nitroreductase | 1.49 |
| PF05960 | DUF885 | 1.49 |
| PF01255 | Prenyltransf | 1.49 |
| PF04672 | Methyltransf_19 | 1.49 |
| PF14452 | Multi_ubiq | 1.49 |
| PF00589 | Phage_integrase | 1.49 |
| PF01494 | FAD_binding_3 | 1.49 |
| PF12802 | MarR_2 | 1.49 |
| PF05719 | GPP34 | 0.75 |
| PF02219 | MTHFR | 0.75 |
| PF14117 | DUF4287 | 0.75 |
| PF00590 | TP_methylase | 0.75 |
| PF13340 | DUF4096 | 0.75 |
| PF00202 | Aminotran_3 | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF01070 | FMN_dh | 0.75 |
| PF00171 | Aldedh | 0.75 |
| PF03441 | FAD_binding_7 | 0.75 |
| PF12867 | DinB_2 | 0.75 |
| PF07366 | SnoaL | 0.75 |
| PF09118 | GO-like_E_set | 0.75 |
| PF13560 | HTH_31 | 0.75 |
| PF13546 | DDE_5 | 0.75 |
| PF01695 | IstB_IS21 | 0.75 |
| PF13671 | AAA_33 | 0.75 |
| PF08031 | BBE | 0.75 |
| PF13377 | Peripla_BP_3 | 0.75 |
| PF03640 | Lipoprotein_15 | 0.75 |
| PF00392 | GntR | 0.75 |
| PF01243 | Putative_PNPOx | 0.75 |
| PF03703 | bPH_2 | 0.75 |
| PF01734 | Patatin | 0.75 |
| PF13338 | AbiEi_4 | 0.75 |
| PF00106 | adh_short | 0.75 |
| PF04149 | DUF397 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.99 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 1.49 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.49 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.49 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.49 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.49 |
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.75 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.75 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.75 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.75 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.75 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.75 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.75 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.75 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.75 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.75 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.75 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.75 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.75 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.75 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.70 % |
| All Organisms | root | All Organisms | 40.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001644|JGI20279J16325_100543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 573 | Open in IMG/M |
| 3300005163|Ga0066823_10113371 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005334|Ga0068869_101094982 | Not Available | 697 | Open in IMG/M |
| 3300005435|Ga0070714_101849299 | Not Available | 589 | Open in IMG/M |
| 3300005542|Ga0070732_10358678 | Not Available | 878 | Open in IMG/M |
| 3300005591|Ga0070761_10253106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea | 1053 | Open in IMG/M |
| 3300005921|Ga0070766_10038224 | Not Available | 2651 | Open in IMG/M |
| 3300005921|Ga0070766_10324003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 995 | Open in IMG/M |
| 3300006162|Ga0075030_101600088 | Not Available | 510 | Open in IMG/M |
| 3300006175|Ga0070712_101398417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300006579|Ga0074054_12010523 | Not Available | 569 | Open in IMG/M |
| 3300006804|Ga0079221_10138818 | Not Available | 1255 | Open in IMG/M |
| 3300006806|Ga0079220_10791886 | Not Available | 715 | Open in IMG/M |
| 3300006854|Ga0075425_101964889 | Not Available | 655 | Open in IMG/M |
| 3300006914|Ga0075436_100634259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus speluncae | 789 | Open in IMG/M |
| 3300009520|Ga0116214_1003360 | All Organisms → cellular organisms → Bacteria | 5856 | Open in IMG/M |
| 3300009522|Ga0116218_1004743 | All Organisms → cellular organisms → Bacteria | 6540 | Open in IMG/M |
| 3300009792|Ga0126374_10427995 | Not Available | 933 | Open in IMG/M |
| 3300010046|Ga0126384_11683836 | Not Available | 599 | Open in IMG/M |
| 3300010359|Ga0126376_12705328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300010366|Ga0126379_11634649 | Not Available | 749 | Open in IMG/M |
| 3300010376|Ga0126381_100339653 | Not Available | 2072 | Open in IMG/M |
| 3300010379|Ga0136449_101180629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
| 3300010379|Ga0136449_103464716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 602 | Open in IMG/M |
| 3300010379|Ga0136449_103730295 | Not Available | 575 | Open in IMG/M |
| 3300010398|Ga0126383_11939809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300010880|Ga0126350_10696615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1663 | Open in IMG/M |
| 3300012210|Ga0137378_11569765 | Not Available | 568 | Open in IMG/M |
| 3300012351|Ga0137386_10451675 | Not Available | 926 | Open in IMG/M |
| 3300012532|Ga0137373_10434628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simulans | 1013 | Open in IMG/M |
| 3300012960|Ga0164301_10083986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1773 | Open in IMG/M |
| 3300013308|Ga0157375_13382771 | Not Available | 531 | Open in IMG/M |
| 3300014169|Ga0181531_10755018 | Not Available | 606 | Open in IMG/M |
| 3300014838|Ga0182030_10938012 | Not Available | 770 | Open in IMG/M |
| 3300016294|Ga0182041_11106050 | Not Available | 720 | Open in IMG/M |
| 3300016445|Ga0182038_11217327 | Not Available | 672 | Open in IMG/M |
| 3300017821|Ga0187812_1146734 | Not Available | 760 | Open in IMG/M |
| 3300017926|Ga0187807_1264788 | Not Available | 565 | Open in IMG/M |
| 3300017926|Ga0187807_1327310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 512 | Open in IMG/M |
| 3300017932|Ga0187814_10139695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 901 | Open in IMG/M |
| 3300017933|Ga0187801_10130408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 970 | Open in IMG/M |
| 3300019260|Ga0181506_1130830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 830 | Open in IMG/M |
| 3300020583|Ga0210401_10309097 | Not Available | 1441 | Open in IMG/M |
| 3300021401|Ga0210393_11105558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 640 | Open in IMG/M |
| 3300021402|Ga0210385_10933691 | Not Available | 666 | Open in IMG/M |
| 3300021404|Ga0210389_10765503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
| 3300021405|Ga0210387_10770885 | Not Available | 851 | Open in IMG/M |
| 3300021406|Ga0210386_10896425 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300021407|Ga0210383_10937455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300021433|Ga0210391_10694854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 797 | Open in IMG/M |
| 3300021433|Ga0210391_11478005 | Not Available | 521 | Open in IMG/M |
| 3300021559|Ga0210409_10697544 | Not Available | 886 | Open in IMG/M |
| 3300022529|Ga0242668_1038921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300024288|Ga0179589_10227538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 823 | Open in IMG/M |
| 3300025321|Ga0207656_10544815 | Not Available | 591 | Open in IMG/M |
| 3300025927|Ga0207687_11874561 | Not Available | 513 | Open in IMG/M |
| 3300026118|Ga0207675_102714656 | Not Available | 503 | Open in IMG/M |
| 3300026121|Ga0207683_10020629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5639 | Open in IMG/M |
| 3300027528|Ga0208985_1014503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1507 | Open in IMG/M |
| 3300027812|Ga0209656_10033899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3000 | Open in IMG/M |
| 3300027853|Ga0209274_10097179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea | 1449 | Open in IMG/M |
| 3300027869|Ga0209579_10619193 | Not Available | 587 | Open in IMG/M |
| 3300027879|Ga0209169_10470369 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300027889|Ga0209380_10261286 | Not Available | 1017 | Open in IMG/M |
| 3300028800|Ga0265338_10478891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300028863|Ga0302218_10253698 | Not Available | 567 | Open in IMG/M |
| 3300028877|Ga0302235_10190103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300029943|Ga0311340_11358671 | Not Available | 563 | Open in IMG/M |
| 3300029944|Ga0311352_10656987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
| 3300029951|Ga0311371_11135159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300029997|Ga0302302_1182876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 800 | Open in IMG/M |
| 3300029999|Ga0311339_10188768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2352 | Open in IMG/M |
| 3300030399|Ga0311353_10300383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1471 | Open in IMG/M |
| 3300030494|Ga0310037_10140918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1099 | Open in IMG/M |
| 3300030548|Ga0210252_10099064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 575 | Open in IMG/M |
| 3300031234|Ga0302325_11720541 | Not Available | 791 | Open in IMG/M |
| 3300031234|Ga0302325_11799264 | Not Available | 768 | Open in IMG/M |
| 3300031236|Ga0302324_103332490 | Not Available | 525 | Open in IMG/M |
| 3300031525|Ga0302326_12309341 | Not Available | 682 | Open in IMG/M |
| 3300031668|Ga0318542_10256116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300031708|Ga0310686_104462429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium moriokaense | 531 | Open in IMG/M |
| 3300031708|Ga0310686_108858459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300031715|Ga0307476_11199863 | Not Available | 555 | Open in IMG/M |
| 3300031718|Ga0307474_10653858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300031723|Ga0318493_10302713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinoalloteichus | 863 | Open in IMG/M |
| 3300031751|Ga0318494_10783707 | Not Available | 558 | Open in IMG/M |
| 3300031765|Ga0318554_10028767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2965 | Open in IMG/M |
| 3300031779|Ga0318566_10085741 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300031781|Ga0318547_10966200 | Not Available | 532 | Open in IMG/M |
| 3300031798|Ga0318523_10436438 | Not Available | 650 | Open in IMG/M |
| 3300031799|Ga0318565_10020895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2874 | Open in IMG/M |
| 3300031823|Ga0307478_11582930 | Not Available | 541 | Open in IMG/M |
| 3300031860|Ga0318495_10228169 | Not Available | 836 | Open in IMG/M |
| 3300031910|Ga0306923_10443606 | Not Available | 1473 | Open in IMG/M |
| 3300031942|Ga0310916_10273512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1427 | Open in IMG/M |
| 3300031946|Ga0310910_10574806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 894 | Open in IMG/M |
| 3300031946|Ga0310910_11472594 | Not Available | 523 | Open in IMG/M |
| 3300032001|Ga0306922_10622392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1142 | Open in IMG/M |
| 3300032009|Ga0318563_10743693 | Not Available | 526 | Open in IMG/M |
| 3300032044|Ga0318558_10452207 | Not Available | 640 | Open in IMG/M |
| 3300032044|Ga0318558_10672874 | Not Available | 517 | Open in IMG/M |
| 3300032059|Ga0318533_10555661 | Not Available | 842 | Open in IMG/M |
| 3300032160|Ga0311301_10356206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2283 | Open in IMG/M |
| 3300032160|Ga0311301_10438819 | Not Available | 1974 | Open in IMG/M |
| 3300032160|Ga0311301_10491344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1825 | Open in IMG/M |
| 3300032783|Ga0335079_11481087 | Not Available | 671 | Open in IMG/M |
| 3300032895|Ga0335074_10307041 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.21% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.75% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001644 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030548 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20279J16325_1005431 | 3300001644 | Forest Soil | IASESYTVVFYVPWMARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR* |
| Ga0066823_101133711 | 3300005163 | Soil | ESYTVVFYVPWVARAVQRRRPRIAAGSALVVAGAVARLRAASAEPLR* |
| Ga0068869_1010949821 | 3300005334 | Miscanthus Rhizosphere | ASEAWFAVFYALRVPRAVRRRRPRTAVGSALVVAGSVARLRAASAEPLQ* |
| Ga0070714_1017515981 | 3300005435 | Agricultural Soil | AFYVLLAARAAQRHRPRIAVGRALSAAGSVARLRAASAEPMR* |
| Ga0070714_1018492991 | 3300005435 | Agricultural Soil | EAWFAVFYALRVPRAVRRRRPRTAVGSALVVAGSVARLRAASAEPLQ* |
| Ga0070710_100710074 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLAVADEAPAVVLFTLRAGRAVQRRKPRIAAGSALLVAGSIARLRAASAEPLP* |
| Ga0070732_103586781 | 3300005542 | Surface Soil | VPWVARAVQRRRPRIAAGYALVVAGSVARLRAASAEPLR* |
| Ga0070761_102531063 | 3300005591 | Soil | VPWLARAVQRRRPRIAAGYALVVAGSVARLRAASAEPLP* |
| Ga0070762_110364052 | 3300005602 | Soil | SETFSTVTYVLVAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ* |
| Ga0070763_105667992 | 3300005610 | Soil | LVAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ* |
| Ga0070766_100382245 | 3300005921 | Soil | YTVVFYVPWVARAVQRRRPRTAAGWALVAAGAVARLRAAAAEPLR* |
| Ga0070766_103240033 | 3300005921 | Soil | VLRAARAVQRRRPRIAAGSALVAAGSVARLRAASAEPLR* |
| Ga0070766_106288941 | 3300005921 | Soil | YVLRAVRAVQQHRPRIAVGRALGAAGSLARLRAASAEPLR* |
| Ga0075030_1016000881 | 3300006162 | Watersheds | SYTVVFYVPWVARAVQRRRPRIAAGYALVAAGSVARLRAAAAEPLR* |
| Ga0070712_1013984171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVPRAVQRRRPRIAAGSALVAAGAVARLWAAAAEPLR* |
| Ga0074054_120105231 | 3300006579 | Soil | ASDGYAVVFYVPWVARAVQRRRPRIAAGWALVMAGSVARLRAAAAEPLR* |
| Ga0079221_101388181 | 3300006804 | Agricultural Soil | TVLRAARAVQQRKPRIAAGSALAVAGWVARLREASAEPLR* |
| Ga0079221_113384902 | 3300006804 | Agricultural Soil | GVLRGARAVQRRRPRMAAGSALVAAGSVARLRAASAEPLR* |
| Ga0079220_107918861 | 3300006806 | Agricultural Soil | ARAVQRRRPRTAAGYALVVAGSVARLRAASAEPLR* |
| Ga0075425_1019648892 | 3300006854 | Populus Rhizosphere | ARAVQRRRPRIAAGWALVAAGSVARLRAASAEPLR* |
| Ga0075436_1006342591 | 3300006914 | Populus Rhizosphere | VPWVARAVQRRRPRMAVGYALVVAGSVVRLRAASAEPLR* |
| Ga0079219_101791961 | 3300006954 | Agricultural Soil | VPAIAIEAPGVAFTVLRAARAVQQRKPRIAAGSALAVAGWVARLREASAEPLR* |
| Ga0116214_100336012 | 3300009520 | Peatlands Soil | IASESYTVVFYVPWVARAVQRRRPRIAAGWALVMAGSVARMRAAAAEPLR* |
| Ga0116218_100474313 | 3300009522 | Peatlands Soil | LAIASESYTVVFYVPWVARAVQRRRPRIAAGWALLMAGSVARLRAAAAEPLR* |
| Ga0126374_104279951 | 3300009792 | Tropical Forest Soil | LRVPRAVQRRRPRIAVGSALVVAGSVARLRAASAEPLR* |
| Ga0126384_116838362 | 3300010046 | Tropical Forest Soil | RVARSVQRRRPRIAVGSALVAAGSVARLRAAAAEPLR* |
| Ga0126376_127053281 | 3300010359 | Tropical Forest Soil | TVLAIAGEAPAVVFSVLRVARAVQRRRPRIAAGSALVVAGSVARLRAASVEPLR* |
| Ga0126379_116346492 | 3300010366 | Tropical Forest Soil | NAVFSVLRVARSVQRRRPRIAVGSALVAAGSVARLRATAAEPLR* |
| Ga0126381_1003396534 | 3300010376 | Tropical Forest Soil | PDAVIHVPWVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR* |
| Ga0136449_1011806292 | 3300010379 | Peatlands Soil | TVVFYVPWVARAVQRRRPRIAAGWALVAAGSVARLQAAAAEPLR* |
| Ga0136449_1034647161 | 3300010379 | Peatlands Soil | VVFQVPWVARAVQRRRPRIAAGWALVMAGSVARLRAAAAEPLR* |
| Ga0136449_1037302951 | 3300010379 | Peatlands Soil | VVFYVPWVARAVQRRRPRIAAGWALVMAGSVARLRAAAAEPLR* |
| Ga0126383_119398092 | 3300010398 | Tropical Forest Soil | AGEAPAVVFSVLRVPRAVRRRRPRIAAGSALVVAGSVARLRAASAEPLR* |
| Ga0126361_109725461 | 3300010876 | Boreal Forest Soil | TYVLVAARAVQRRRPRIAAGRALYAAGSLARLRAASAEPLQ* |
| Ga0126350_106966155 | 3300010880 | Boreal Forest Soil | AIASESYTVVFYVPWVARAVQRRRPRIAAGWALVIAGSVARLRAAAAEPLR* |
| Ga0137378_115697651 | 3300012210 | Vadose Zone Soil | AIAVEAPNAVIHVPWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR* |
| Ga0137386_104516751 | 3300012351 | Vadose Zone Soil | EAPYVVVTVLWAGRAVQRRRPRIAAGYALVVAGSVAQLRAASAEPLR* |
| Ga0137373_104346281 | 3300012532 | Vadose Zone Soil | VVFYVPWVARAVQRRRPRIAAGWALVMAGAVARLRAAAAEPLR* |
| Ga0137416_114253642 | 3300012927 | Vadose Zone Soil | YSVLRAARAVQRRRPRMAAGSALVAAGSVARLRAAAEPLR* |
| Ga0164301_100839863 | 3300012960 | Soil | LAIAGEARNAVFFVLRVPRAVQRRRPRTAAGWALVAAGAVARLRAAAAEPLR* |
| Ga0157375_133827711 | 3300013308 | Miscanthus Rhizosphere | HVPWLARAVQQRRPRIAAGWALVAAASVARLRAASAEPVR* |
| Ga0181531_107550181 | 3300014169 | Bog | VFYVPWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR* |
| Ga0157377_104983313 | 3300014745 | Miscanthus Rhizosphere | PWVARAVQRRRPRMAAGSALVAVGSLARLRAASAEPLR* |
| Ga0182030_109380122 | 3300014838 | Bog | AVEAPNAVIHVPWVARAVQRRRPRIAAGWALVAAGSVARLRAASAEPLR* |
| Ga0182041_111060501 | 3300016294 | Soil | NAVIHVPWMARAVQRRKPRIAAGWALVAAASVARLRAASAEPLR |
| Ga0182038_112173271 | 3300016445 | Soil | TVVFYVLRVARAVQRRKPRITAGSVLVVAGSVARLWAASAEPLR |
| Ga0187812_11467342 | 3300017821 | Freshwater Sediment | AIASESYTVVFYVPWMARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Ga0187807_12647881 | 3300017926 | Freshwater Sediment | DEAWTVVFYALRVPRAVQRSRPRIAVGSALVVYGSVARLRAASAEPLRLQRARDGHF |
| Ga0187807_13273101 | 3300017926 | Freshwater Sediment | PAVVLYALRTARAVQRRRPRIAVGSALVVAGSVARLRAASPEPLR |
| Ga0187814_101396952 | 3300017932 | Freshwater Sediment | YVLRVPRAVQRRRPRIAAGSALVVAGAVARLWAAAAEPLR |
| Ga0187801_101304082 | 3300017933 | Freshwater Sediment | VFYALRVPRAAQRRRPRIAAGSALVAAGSVARLRAASAEPLR |
| Ga0187808_103725251 | 3300017942 | Freshwater Sediment | IASETFSTVTYVLVAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLR |
| Ga0181506_11308302 | 3300019260 | Peatland | AVFYVPWVARAAQRRRPRIAAGWALVAAGSIARLRAAAAEPLR |
| Ga0210395_112156332 | 3300020582 | Soil | NVVYSVLRAARAVQRRRPRMAAGSALVAAGSVARLRAASAEPLR |
| Ga0210401_103090971 | 3300020583 | Soil | SGSYTVVFYVPWVARAVQRRRPRTAAGWALVVAGAVARLRAAAAEPLR |
| Ga0210400_102548631 | 3300021170 | Soil | VVLAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0210408_104204731 | 3300021178 | Soil | VAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0210393_111055582 | 3300021401 | Soil | EAPYAVLYALRVPRAVQRRRPRIAVGSALVVAASVARLRAASAEPLG |
| Ga0210385_109336912 | 3300021402 | Soil | TVLAVADGTYTVVFYVPWVARAVQRRRPRTAAGWALVAAGAVARLRAAAAEPLR |
| Ga0210389_107655031 | 3300021404 | Soil | VVFYVAWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Ga0210387_107708851 | 3300021405 | Soil | VVVYVLRVARAVQRRRPRIAAGSALVAAGAVARLRAASAEPLR |
| Ga0210386_108964252 | 3300021406 | Soil | WMARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Ga0210383_109374552 | 3300021407 | Soil | LTVLAIASESYTVVFYVPWAARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0210391_106948542 | 3300021433 | Soil | SESYTAVFYVPWVARAVQRRRPRTAAGWTLVVAGSAARLRAAAAEPLR |
| Ga0210391_114780051 | 3300021433 | Soil | AIASEAPMAVFYGLRVPRAVQWRRPRIAAGSALVAAGAFARLRAASAEPLR |
| Ga0210390_104444281 | 3300021474 | Soil | YSVLRAARAVQRRRPRMAAGSALVAAGSVARLRAASAEPLR |
| Ga0210409_106975443 | 3300021559 | Soil | WVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0242668_10389212 | 3300022529 | Soil | VIASETYTVVFYVPWVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0179589_102275383 | 3300024288 | Vadose Zone Soil | VPWVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0207656_105448151 | 3300025321 | Corn Rhizosphere | AAFHALRVPRAVRRRRPRIAAGSVLLIAGAVARLRAASAEPLP |
| Ga0207692_100562063 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLAVADEAPAVVLFTLRAGRAVQRRKPRIAAGSALLVAGSIARLRAASAEPLP |
| Ga0207685_101584221 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SETFSTVTYVLLAARAMQRRRPKIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0207687_118745611 | 3300025927 | Miscanthus Rhizosphere | AGEAWFAVFYALRVPRAVRRRRPRTAVGSALVVAGSVARLRAASAEPLQ |
| Ga0207664_112396522 | 3300025929 | Agricultural Soil | IASETFYTAFYVLLAARAAQRHRPRIAVGRALSAAGSVARLRAASAEPLR |
| Ga0207675_1027146561 | 3300026118 | Switchgrass Rhizosphere | KAVITVPWVARAVQRRRPRMAVGYALVVAGSVVRLRAASAEPLR |
| Ga0207683_1002062912 | 3300026121 | Miscanthus Rhizosphere | APNAVIHVPWLARAVQQRRPGIAAGWALVAAASVARLRAASAEPLR |
| Ga0208241_10367862 | 3300027297 | Forest Soil | ASETFSTVTYVVLAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0208985_10145035 | 3300027528 | Forest Soil | VFYVLRAARAVQRRRPRIAAGSALVAAGSVARLRAASAEPLR |
| Ga0209656_100338991 | 3300027812 | Bog Forest Soil | VVFYVPWVARAVQRRRPRIAIGWALVMAGSVARLRAAAAEPLR |
| Ga0209274_100971793 | 3300027853 | Soil | AVITVPWLARAVQRRRPRIAAGYALVVAGSVARLRAASAEPLP |
| Ga0209579_106191931 | 3300027869 | Surface Soil | VPWLARAVQRRRPRIAAGYALVAAGSVARLRAASAEPLR |
| Ga0209169_104703691 | 3300027879 | Soil | AVFYGLRVPRAVQRRRPRIAAGSALVVAGAFARLRAASAEPLR |
| Ga0209275_102611012 | 3300027884 | Soil | TFSTVTYVLVAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0209380_102612861 | 3300027889 | Soil | VFYVPWVARAVQRRRPRTAAGWALVAAGAVARLRAAAAEPLR |
| Ga0302225_103074222 | 3300028780 | Palsa | ETFSTVLYVLLAARAVQRRGPRIAAGRALYAAGSLARLRAASAEPLR |
| Ga0265338_104788911 | 3300028800 | Rhizosphere | VLYALRVPRAVQRRRPRIAVGSALVVAGAVARLRAASAEPLP |
| Ga0302218_102536982 | 3300028863 | Palsa | IASESYTVVFYVPWVARAVQRRRPRIAIGWALVIAGSAARLPAAAAEPLR |
| Ga0302235_101901033 | 3300028877 | Palsa | SYTVVFYVPWVARAVQRRRPRIAAGWALVAAGSVARLWAAAAEPLR |
| Ga0308309_112421571 | 3300028906 | Soil | VLVAARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0311368_102812602 | 3300029882 | Palsa | PDVALSVLRAARAVQRRRPRMAAGSALVGAGSVARLRAASAEPLR |
| Ga0311340_113586712 | 3300029943 | Palsa | SGSYTVVFYVPWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Ga0311352_106569871 | 3300029944 | Palsa | ESYTVVFYVPWVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0311371_111351591 | 3300029951 | Palsa | TVVFYVPWVARAVQRRRPRIAAGWALVAAGSVARLWAAAAEPLR |
| Ga0302302_11828762 | 3300029997 | Palsa | VLAIANEAPTAVFCTLRVPRAVQRRRPRIAAGSALVVAGAVARLRAASAEPLR |
| Ga0311339_101887681 | 3300029999 | Palsa | IASGSYTVVFYVPWVARAVQRRRPRIAAGWALVMAGSVARLWAAAAEPLR |
| Ga0302176_100793641 | 3300030057 | Palsa | LYVLLAARAVQRRGPRIAAGRALYAAGSLARLRAASAEPLR |
| Ga0311353_103003832 | 3300030399 | Palsa | NEAPLAVFFVVRAARAVQRRRPRIAAGSVLVAAGSVARLRAAAAEPLLQDPS |
| Ga0310037_101409181 | 3300030494 | Peatlands Soil | EAPTAVFCVLRVARAVQRRRPRIAAGSALVVAGSVARLWAAAAEPLR |
| Ga0311370_107205493 | 3300030503 | Palsa | TVVVSVLRAARAVQRRRPRMAAGSALVAYGSVARCLRAASAEPLR |
| Ga0210252_100990642 | 3300030548 | Soil | VPWLARAVQRRRPRIAAGWALVAAGSVARLRAASAEPLR |
| Ga0302325_117205412 | 3300031234 | Palsa | AIADETPLAVFYVLRAAQAVQRRRPRIAAGSAPAVAGSVARLRAASAEPLR |
| Ga0302325_117992641 | 3300031234 | Palsa | TVLAIASGSYTVVFYVPWVARAVQRRRPRIAAGWALVAAGSAARLRAASAEPLR |
| Ga0302324_1033324902 | 3300031236 | Palsa | LRLPRAVQRRRPRIAVGSALVVAGSVARLRAALAEPLQ |
| Ga0302326_123093411 | 3300031525 | Palsa | AAEAPTVVFSVLRAARAVQRRRPRIAVGYALVAAGSVARLRAASAEPLR |
| Ga0318542_102561161 | 3300031668 | Soil | HVPWMARAVQRRRPRIATGWALVIAASVARLRAAAAEPLR |
| Ga0310686_1044624291 | 3300031708 | Soil | TVLRAARAVQQRKPRIAAGSALAVAGWVARLREASAEPLR |
| Ga0310686_1088584591 | 3300031708 | Soil | ALAIASEAPMAVFYGLRVPRAVQRRRPRIAAGSALVVAGALARLRAASTEPLR |
| Ga0310686_1149911361 | 3300031708 | Soil | AARAVQRRRPRIAAGRALSAAGSLARLRAASAEPLQ |
| Ga0307476_111998631 | 3300031715 | Hardwood Forest Soil | ASGSYTVVFYVPWVARAVQRRRPRIAAGWALVIAGSVARLRAAAAEPLR |
| Ga0307474_106538581 | 3300031718 | Hardwood Forest Soil | FTVLRAARAVQQRKPRIAAGSALAVAGWVARLREASAEPLR |
| Ga0318493_103027131 | 3300031723 | Soil | VFYVLRVARAVQRRKPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0318494_107837072 | 3300031751 | Soil | AGEAPTVVFYVLRVARAVQRRKPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0318554_100287671 | 3300031765 | Soil | LAIAVEAPNAVIHVPWMARAVQRRRPRIATGWALVIAASVARLRAAAAEPLR |
| Ga0318566_100857413 | 3300031779 | Soil | WVARAVQRRRPRIAAGYVLVAAGSVARLRAASAEPLR |
| Ga0318547_109662002 | 3300031781 | Soil | MARAVQRRRPRIAAGYVLVAAGSVARLRAASAEPLR |
| Ga0318523_104364381 | 3300031798 | Soil | WMARAVQRRRPRIAAGWALVIAASVARLRAAAAEPLR |
| Ga0318565_100208951 | 3300031799 | Soil | ARAVQRRRPRIAAGWALVIAASVARLRAAAAEPLR |
| Ga0307478_115829301 | 3300031823 | Hardwood Forest Soil | MTVGAIADEAPMLFYVLRVPRAVQRRRPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0318495_102281691 | 3300031860 | Soil | WMARAVQRRRPRIATGWALVIAASVARLRAAAAEPLR |
| Ga0306923_104436062 | 3300031910 | Soil | MLAIAGEAPDVVFFVLRVARSVQRRRPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0310916_102735121 | 3300031942 | Soil | VEAPNAVIHVPWMARAVQRRRPRIAAGWALVIAASVARLRAAAAEPLR |
| Ga0310910_105748061 | 3300031946 | Soil | AVIHVPWMARAVQQRRPRIAAGWALVAAASVARLRAASAEPLR |
| Ga0310910_114725941 | 3300031946 | Soil | LAVFYGLRVPRAVHRRRPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0306922_106223923 | 3300032001 | Soil | VEAPNAVIHVPWMARAVQQRRPRIAAGWALVAAASVAGLRAAAAEPLR |
| Ga0318563_107436931 | 3300032009 | Soil | ARAVQRRRPRIAAGYVLVAAGLPIRLRAASAEPLR |
| Ga0318558_104522071 | 3300032044 | Soil | LSAARAVQRRRPRIAAGCALLVAGSVARLRAAAAEPLR |
| Ga0318558_106728741 | 3300032044 | Soil | APDVVFFVLRVARSVQRRRPRIAAGSALVVAGSVARLRAASAEPLR |
| Ga0318533_105556613 | 3300032059 | Soil | EAPNAVFSVLRAARSVQRRRPRIAVGSALVAAGSVARLRAAAAEPLR |
| Ga0311301_103562061 | 3300032160 | Peatlands Soil | GYTVVFYVPWVARAVQRRRPRIAAGWALVAAGSVARLQAAAAEPLR |
| Ga0311301_104388191 | 3300032160 | Peatlands Soil | ASESYTVVFYVPWVARAVQRRRPRIAAGWALVVAGSVARLRAAAAEPLR |
| Ga0311301_104913442 | 3300032160 | Peatlands Soil | LTVLAIASESYTVVFYVPWVARAVQRRRPRIAAGWALVMAGSAARLRAAAAEPLR |
| Ga0335079_114810871 | 3300032783 | Soil | AGGALNAVLNVLWVARAVQRRRPRIAAGWALVAAGSVARLRAAAAEPLR |
| Ga0335074_100696185 | 3300032895 | Soil | TLNTASYVLRAVRAGQQRKPRIAVGRALGAVGSLARLRAASA |
| Ga0335074_103070413 | 3300032895 | Soil | AIAGEAPTAVFYVLRVARAMQRRRPRMAAGAVLVVAGSVARLRAASAEPLR |
| ⦗Top⦘ |