| Basic Information | |
|---|---|
| Family ID | F059183 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTPAEIRALAAEAIAHLHEVAGKLAELSALLGGDEAGEGKP |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.70 % |
| % of genes near scaffold ends (potentially truncated) | 91.04 % |
| % of genes from short scaffolds (< 2000 bps) | 95.52 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.731 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (51.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.970 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (51.493 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 4.48 |
| PF00196 | GerE | 2.24 |
| PF13556 | HTH_30 | 2.24 |
| PF13613 | HTH_Tnp_4 | 2.24 |
| PF13520 | AA_permease_2 | 2.24 |
| PF10009 | DUF2252 | 2.24 |
| PF09860 | DUF2087 | 1.49 |
| PF03176 | MMPL | 1.49 |
| PF07883 | Cupin_2 | 1.49 |
| PF02129 | Peptidase_S15 | 0.75 |
| PF13076 | Fur_reg_FbpA | 0.75 |
| PF05175 | MTS | 0.75 |
| PF03241 | HpaB | 0.75 |
| PF03721 | UDPG_MGDP_dh_N | 0.75 |
| PF00324 | AA_permease | 0.75 |
| PF00296 | Bac_luciferase | 0.75 |
| PF11774 | Lsr2 | 0.75 |
| PF13683 | rve_3 | 0.75 |
| PF02738 | MoCoBD_1 | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF08530 | PepX_C | 0.75 |
| PF13193 | AMP-binding_C | 0.75 |
| PF01471 | PG_binding_1 | 0.75 |
| PF09335 | SNARE_assoc | 0.75 |
| PF04286 | DUF445 | 0.75 |
| PF13565 | HTH_32 | 0.75 |
| PF02481 | DNA_processg_A | 0.75 |
| PF14019 | DUF4235 | 0.75 |
| PF00155 | Aminotran_1_2 | 0.75 |
| PF14016 | DUF4232 | 0.75 |
| PF06736 | TMEM175 | 0.75 |
| PF02909 | TetR_C_1 | 0.75 |
| PF14833 | NAD_binding_11 | 0.75 |
| PF00092 | VWA | 0.75 |
| PF00072 | Response_reg | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.49 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.49 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.49 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.75 |
| COG4399 | Uncharacterized membrane protein YheB, UPF0754 family | Function unknown [S] | 0.75 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.75 |
| COG2733 | Uncharacterized membrane-anchored protein YjiN, DUF445 family | Function unknown [S] | 0.75 |
| COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.75 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.75 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.75 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.75 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.75 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.75 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.75 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.75 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.75 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.73 % |
| All Organisms | root | All Organisms | 46.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HIFL9 | Not Available | 500 | Open in IMG/M |
| 3300000956|JGI10216J12902_105629206 | Not Available | 959 | Open in IMG/M |
| 3300005177|Ga0066690_10361534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Glycomycetales → Glycomycetaceae → Stackebrandtia → Stackebrandtia endophytica | 984 | Open in IMG/M |
| 3300005177|Ga0066690_10776480 | Not Available | 625 | Open in IMG/M |
| 3300005434|Ga0070709_11057725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300005445|Ga0070708_102207585 | Not Available | 508 | Open in IMG/M |
| 3300005549|Ga0070704_101040901 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005614|Ga0068856_102008024 | Not Available | 589 | Open in IMG/M |
| 3300005764|Ga0066903_108008094 | Not Available | 542 | Open in IMG/M |
| 3300006175|Ga0070712_101776144 | Not Available | 540 | Open in IMG/M |
| 3300006755|Ga0079222_12393225 | Not Available | 529 | Open in IMG/M |
| 3300006796|Ga0066665_11519100 | Not Available | 523 | Open in IMG/M |
| 3300006852|Ga0075433_11849322 | Not Available | 518 | Open in IMG/M |
| 3300006854|Ga0075425_101041291 | Not Available | 933 | Open in IMG/M |
| 3300006914|Ga0075436_101080437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300006954|Ga0079219_11178042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 660 | Open in IMG/M |
| 3300009098|Ga0105245_10660803 | Not Available | 1076 | Open in IMG/M |
| 3300010046|Ga0126384_10313125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1295 | Open in IMG/M |
| 3300010048|Ga0126373_10696053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia ammonioxydans | 1074 | Open in IMG/M |
| 3300010048|Ga0126373_12084513 | Not Available | 629 | Open in IMG/M |
| 3300010048|Ga0126373_12791752 | Not Available | 545 | Open in IMG/M |
| 3300010358|Ga0126370_11387769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300010361|Ga0126378_10635915 | Not Available | 1181 | Open in IMG/M |
| 3300010361|Ga0126378_10935369 | Not Available | 972 | Open in IMG/M |
| 3300010366|Ga0126379_10330055 | Not Available | 1546 | Open in IMG/M |
| 3300010373|Ga0134128_11157284 | Not Available | 854 | Open in IMG/M |
| 3300012209|Ga0137379_11348965 | Not Available | 618 | Open in IMG/M |
| 3300012958|Ga0164299_11231101 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012971|Ga0126369_12721292 | Not Available | 578 | Open in IMG/M |
| 3300012971|Ga0126369_13232884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012984|Ga0164309_10665908 | Not Available | 821 | Open in IMG/M |
| 3300015372|Ga0132256_102220905 | Not Available | 653 | Open in IMG/M |
| 3300015372|Ga0132256_103664488 | Not Available | 517 | Open in IMG/M |
| 3300015374|Ga0132255_103709792 | Not Available | 649 | Open in IMG/M |
| 3300016319|Ga0182033_10034444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3275 | Open in IMG/M |
| 3300016404|Ga0182037_11531272 | Not Available | 592 | Open in IMG/M |
| 3300016404|Ga0182037_11573798 | Not Available | 584 | Open in IMG/M |
| 3300016404|Ga0182037_12119793 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300017926|Ga0187807_1074033 | Not Available | 1062 | Open in IMG/M |
| 3300017937|Ga0187809_10351860 | Not Available | 552 | Open in IMG/M |
| 3300017939|Ga0187775_10382521 | Not Available | 577 | Open in IMG/M |
| 3300017942|Ga0187808_10105534 | Not Available | 1227 | Open in IMG/M |
| 3300017943|Ga0187819_10617891 | Not Available | 613 | Open in IMG/M |
| 3300017947|Ga0187785_10764344 | Not Available | 511 | Open in IMG/M |
| 3300017955|Ga0187817_10258769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300017970|Ga0187783_10325250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1120 | Open in IMG/M |
| 3300017975|Ga0187782_10351870 | Not Available | 1115 | Open in IMG/M |
| 3300018060|Ga0187765_10860420 | Not Available | 610 | Open in IMG/M |
| 3300018062|Ga0187784_10907408 | Not Available | 701 | Open in IMG/M |
| 3300018064|Ga0187773_10952413 | Not Available | 559 | Open in IMG/M |
| 3300018085|Ga0187772_10139584 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300018085|Ga0187772_11028739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300021170|Ga0210400_10064131 | All Organisms → cellular organisms → Bacteria | 2868 | Open in IMG/M |
| 3300021474|Ga0210390_11102140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300021560|Ga0126371_11598584 | Not Available | 778 | Open in IMG/M |
| 3300021560|Ga0126371_13808482 | Not Available | 508 | Open in IMG/M |
| 3300022525|Ga0242656_1132242 | Not Available | 514 | Open in IMG/M |
| 3300025898|Ga0207692_10957555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300025910|Ga0207684_11217669 | Not Available | 623 | Open in IMG/M |
| 3300026078|Ga0207702_12066655 | Not Available | 560 | Open in IMG/M |
| 3300031543|Ga0318516_10343350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300031544|Ga0318534_10620733 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031545|Ga0318541_10026682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2825 | Open in IMG/M |
| 3300031546|Ga0318538_10027021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2636 | Open in IMG/M |
| 3300031564|Ga0318573_10452266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300031572|Ga0318515_10544804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300031573|Ga0310915_10321626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| 3300031640|Ga0318555_10126859 | Not Available | 1358 | Open in IMG/M |
| 3300031640|Ga0318555_10316623 | Not Available | 845 | Open in IMG/M |
| 3300031680|Ga0318574_10164092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300031680|Ga0318574_10219505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| 3300031682|Ga0318560_10407305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300031682|Ga0318560_10631730 | Not Available | 580 | Open in IMG/M |
| 3300031713|Ga0318496_10742714 | Not Available | 541 | Open in IMG/M |
| 3300031724|Ga0318500_10176002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300031724|Ga0318500_10747890 | Not Available | 500 | Open in IMG/M |
| 3300031751|Ga0318494_10930420 | Not Available | 510 | Open in IMG/M |
| 3300031771|Ga0318546_10465542 | Not Available | 886 | Open in IMG/M |
| 3300031771|Ga0318546_10589232 | Not Available | 782 | Open in IMG/M |
| 3300031771|Ga0318546_10697369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 714 | Open in IMG/M |
| 3300031779|Ga0318566_10339490 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031779|Ga0318566_10440109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300031780|Ga0318508_1177320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300031782|Ga0318552_10058499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1841 | Open in IMG/M |
| 3300031782|Ga0318552_10142889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1200 | Open in IMG/M |
| 3300031782|Ga0318552_10241263 | Not Available | 917 | Open in IMG/M |
| 3300031792|Ga0318529_10137933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1117 | Open in IMG/M |
| 3300031793|Ga0318548_10286686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
| 3300031793|Ga0318548_10390946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus | 682 | Open in IMG/M |
| 3300031797|Ga0318550_10104946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
| 3300031798|Ga0318523_10650652 | Not Available | 518 | Open in IMG/M |
| 3300031805|Ga0318497_10792792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 531 | Open in IMG/M |
| 3300031821|Ga0318567_10425298 | Not Available | 753 | Open in IMG/M |
| 3300031832|Ga0318499_10279464 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031835|Ga0318517_10535740 | Not Available | 527 | Open in IMG/M |
| 3300031845|Ga0318511_10485280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus nigrescens | 571 | Open in IMG/M |
| 3300031860|Ga0318495_10423221 | Not Available | 585 | Open in IMG/M |
| 3300031879|Ga0306919_10888804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300031894|Ga0318522_10094769 | Not Available | 1101 | Open in IMG/M |
| 3300031896|Ga0318551_10744776 | Not Available | 569 | Open in IMG/M |
| 3300031896|Ga0318551_10895040 | Not Available | 518 | Open in IMG/M |
| 3300031897|Ga0318520_10794374 | Not Available | 594 | Open in IMG/M |
| 3300031912|Ga0306921_12166133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300031912|Ga0306921_12490005 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300031941|Ga0310912_10457300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300031942|Ga0310916_10427938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
| 3300031945|Ga0310913_11106609 | Not Available | 553 | Open in IMG/M |
| 3300031946|Ga0310910_11062581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 631 | Open in IMG/M |
| 3300031947|Ga0310909_10794071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
| 3300031947|Ga0310909_11243688 | Not Available | 601 | Open in IMG/M |
| 3300031947|Ga0310909_11449055 | Not Available | 548 | Open in IMG/M |
| 3300031959|Ga0318530_10135782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300031981|Ga0318531_10218566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300032010|Ga0318569_10033134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2163 | Open in IMG/M |
| 3300032025|Ga0318507_10216934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 827 | Open in IMG/M |
| 3300032035|Ga0310911_10395152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300032039|Ga0318559_10459269 | Not Available | 594 | Open in IMG/M |
| 3300032043|Ga0318556_10054937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1936 | Open in IMG/M |
| 3300032043|Ga0318556_10593453 | Not Available | 578 | Open in IMG/M |
| 3300032052|Ga0318506_10486568 | Not Available | 547 | Open in IMG/M |
| 3300032055|Ga0318575_10291050 | Not Available | 826 | Open in IMG/M |
| 3300032055|Ga0318575_10657578 | Not Available | 530 | Open in IMG/M |
| 3300032059|Ga0318533_10202343 | Not Available | 1423 | Open in IMG/M |
| 3300032063|Ga0318504_10157917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300032065|Ga0318513_10464938 | Not Available | 619 | Open in IMG/M |
| 3300032065|Ga0318513_10537923 | Not Available | 572 | Open in IMG/M |
| 3300032067|Ga0318524_10056756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1876 | Open in IMG/M |
| 3300032068|Ga0318553_10417168 | Not Available | 703 | Open in IMG/M |
| 3300032076|Ga0306924_10819481 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300032174|Ga0307470_11426818 | Not Available | 572 | Open in IMG/M |
| 3300032261|Ga0306920_101246437 | Not Available | 1072 | Open in IMG/M |
| 3300032805|Ga0335078_10450385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1671 | Open in IMG/M |
| 3300032896|Ga0335075_10087444 | All Organisms → cellular organisms → Bacteria | 4143 | Open in IMG/M |
| 3300033290|Ga0318519_10448100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 51.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.72% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_07906790 | 2170459013 | Grass Soil | MTPAEIRALAAEAIAHLHEVAGKLAELSALLGGDEAGEGKP |
| JGI10216J12902_1056292061 | 3300000956 | Soil | EIRALAAESIASLHEVAGKLADLSALLDDEAGEGRS* |
| Ga0066690_103615343 | 3300005177 | Soil | MTSAEIRALAAESIASLQEVAGKLADLSALLDDEAAEGGS |
| Ga0066690_107764801 | 3300005177 | Soil | MTSAEIRALAAESIASLQEVAGKLADLSALLDDEAAEGGS* |
| Ga0070709_110577253 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPAEIRALAAEAITHLHEVADRLAELSALLGEDKPLGEDKP* |
| Ga0070708_1022075851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKPRQTMTPAEIRALAAEAIAHLHEVAGQLAELSALLGDDEAGEDKP* |
| Ga0070704_1010409011 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PAEIRALAAEAIAHLHEVAGQLAELSALLGDDEAGEDKP* |
| Ga0068856_1020080241 | 3300005614 | Corn Rhizosphere | AEIRALAAEAIAHLHEVAGKLAELSALLGGGEAGGGKP* |
| Ga0066903_1080080941 | 3300005764 | Tropical Forest Soil | EIRALAAEAIANLREVADKLAELSTLLGDDEAGEDRS* |
| Ga0070712_1017761441 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RALAAESIASLHEVAGKLAELSALVDDEAGEGRS* |
| Ga0079222_123932251 | 3300006755 | Agricultural Soil | ALAAEAITQLHKVADRIAELSVLLADDAAGEGKP* |
| Ga0066665_115191001 | 3300006796 | Soil | RARSAAAIASLHEVAGQLTELSALLDDEAGEGTS* |
| Ga0075433_118493221 | 3300006852 | Populus Rhizosphere | ALVTPRQTMTPAEIRALAAEAIAHLHEVAGKLAELSALLGAGEAGEGKP* |
| Ga0075425_1010412911 | 3300006854 | Populus Rhizosphere | EPRRTMTPAEIRALAAESIASLQEVAGKLAELSALLDDDEGGEGRS* |
| Ga0075436_1010804371 | 3300006914 | Populus Rhizosphere | MTPAEIRALAAEAIAHLHEVAGKLAELSALLGEDTP* |
| Ga0079219_111780421 | 3300006954 | Agricultural Soil | TEAEIRALTAEAIAHLHEVADRLTELSALLGEEGSHERA* |
| Ga0105245_106608031 | 3300009098 | Miscanthus Rhizosphere | QTMTPAEIRALAAEAIAHLHEVAGQLAELSALLGDDEAGEDKP* |
| Ga0126384_103131253 | 3300010046 | Tropical Forest Soil | LAEQAIAHLHEVAGKLAELSALLGGDQATGAGHERA* |
| Ga0126373_106960531 | 3300010048 | Tropical Forest Soil | MTPAEIRALAAESIAGLHEVAGKLAELAALLGDDEAGEGLS* |
| Ga0126373_120845131 | 3300010048 | Tropical Forest Soil | ALAEEAIAHLHEVAGKLAELSALLGDDEASQGKP* |
| Ga0126373_127917521 | 3300010048 | Tropical Forest Soil | MTSAEIRALAVESIASLHEVAGKLAELSALLGDEAGEGRS* |
| Ga0126370_113877693 | 3300010358 | Tropical Forest Soil | TLTPVEIRALAAEAIAHLHKVAAKLTELSALLSDDAPGEAQP* |
| Ga0126378_106359151 | 3300010361 | Tropical Forest Soil | MTPAEIRALAAEAIAHLHEVAGQLAELSALLGDDEADEGQP* |
| Ga0126378_109353691 | 3300010361 | Tropical Forest Soil | PAEIRALAGEAITHLQEVAGKLAELSALLGDDKTGQDES* |
| Ga0126379_103300551 | 3300010366 | Tropical Forest Soil | PAEIRALAEESIASLHEVAGKLAELSALLGDDEAGEGRS* |
| Ga0134128_111572843 | 3300010373 | Terrestrial Soil | AEIRTLTTEAIAHLHEVADKLAKLSALLADDEPSEGQP* |
| Ga0137379_113489651 | 3300012209 | Vadose Zone Soil | TPAEIRALAAESIASLHEVAGKLADLSALLDDEAAEGGS* |
| Ga0164299_112311011 | 3300012958 | Soil | MSPAEIRSLAAEAIAYLHEVADKLTELSALLGDHEAGDDKP* |
| Ga0126369_127212921 | 3300012971 | Tropical Forest Soil | LARPRATMTPAEIRALAEETIARLHEVADKLAELSTLLGDDQAAEGKP* |
| Ga0126369_132328842 | 3300012971 | Tropical Forest Soil | MTTAEIRALTAEAITHLHKVADKLAELSALLADDGTGKGKP* |
| Ga0164309_106659081 | 3300012984 | Soil | IRALAAEAITHLHEVAGKLAELSALLGDDEAGEASHERT* |
| Ga0132256_1022209051 | 3300015372 | Arabidopsis Rhizosphere | IRALAAEAIAHLHEVAGQLAELSALLGDDEAGEDKP* |
| Ga0132256_1036644881 | 3300015372 | Arabidopsis Rhizosphere | GRTMTPAEIRVLAAESIASLHEVAGKLAELSALLDDEAGEGRS* |
| Ga0132255_1037097921 | 3300015374 | Arabidopsis Rhizosphere | RRTMTPAEIRALAAESIASLQEVAGKLAELSALLDDDEAGEDRP* |
| Ga0182033_100344443 | 3300016319 | Soil | MTPAEIRARAADTIAQLHAVAGKLAELSALLGDDEDRS |
| Ga0182037_115312721 | 3300016404 | Soil | PAEIRVLAAEAIAQLHEVAGKLTELSALLGAGEAGEDQA |
| Ga0182037_115737983 | 3300016404 | Soil | RALAAESIASLHAVAGQLAELSALLGEDEAGEGQS |
| Ga0182037_121197931 | 3300016404 | Soil | AMTPAEIRARATEAIAQLHEVADKLAELSALLGDDAAGGGAS |
| Ga0187807_10740332 | 3300017926 | Freshwater Sediment | MTPAEIRAMTAEAIAHLHEVAVKLAELSALLGDDEADEGTP |
| Ga0187809_103518603 | 3300017937 | Freshwater Sediment | MTPAEIRALTAEAIAHLHEVADKLSELSALLGDDEAGEDKP |
| Ga0187775_103825211 | 3300017939 | Tropical Peatland | TMTPAEIRTLAAEAIAHLRKVADNLAQLAALLGDDETGEGKP |
| Ga0187808_101055342 | 3300017942 | Freshwater Sediment | GGRRPGQAEETMTPAEIRALTAEAIAHLYEVAAKLAELSALLGDDEADEGTP |
| Ga0187819_106178911 | 3300017943 | Freshwater Sediment | MTPAGIRALTAEAIAHLYEVAAKLAELSALLGDDEADEGTP |
| Ga0187785_107643442 | 3300017947 | Tropical Peatland | MTPAEIRALAEEAIVHLHQVADNLAQLAALLGDDETGEGKP |
| Ga0187817_102587691 | 3300017955 | Freshwater Sediment | MTPAEIRVLAAAAIAHLHEVADRLAELSALLGEDEASEDKS |
| Ga0187783_103252503 | 3300017970 | Tropical Peatland | AEIRALAAAAIAHLHEVAGQLTELSALLGDDEAGEDKR |
| Ga0187782_103518701 | 3300017975 | Tropical Peatland | KPRETMTSAEIRALAADTIAQLHEVAGKLAELSALLGDDEPGRDAS |
| Ga0187765_108604203 | 3300018060 | Tropical Peatland | MSPAEIRALAAEAIGYPHEVADKLAELSALLGEDKAGDGKP |
| Ga0187784_109074081 | 3300018062 | Tropical Peatland | ALAKPRETLTPAEIRALAAAAIIHLQEVADKLTELSALLGDDEAIEGRS |
| Ga0187773_109524133 | 3300018064 | Tropical Peatland | PRETMTPAEIRALAEEAIAHLHEVAGKLAKLSALLGGDESDEGKP |
| Ga0187772_101395843 | 3300018085 | Tropical Peatland | LTPAEIRALAAAAIVHLHEVGDKLTELPALLGDDDAVAGRS |
| Ga0187772_110287391 | 3300018085 | Tropical Peatland | KPRRTMAPAEIRAVAAQAIAHLHEVAGQLAELSALLGDDEPGEDTR |
| Ga0210400_100641315 | 3300021170 | Soil | RETITQAEIRALAAEAIAHLHEVADKLAELSALLGDDEAGEDKP |
| Ga0210390_111021401 | 3300021474 | Soil | EIRSLAAEAIAHLHKVADELAELSALLGDDEASEDKP |
| Ga0126371_115985842 | 3300021560 | Tropical Forest Soil | EIRALAAEAIAHLHEVAGKLAELSALLGDDEADGGKP |
| Ga0126371_138084823 | 3300021560 | Tropical Forest Soil | KTMTPTEIRALAAEAITHLHKVADKLADLSALLSEDEGKP |
| Ga0242656_11322421 | 3300022525 | Soil | QAEIRALAAEAIAHLHEVADKLAELSALLGDDEAGEDKP |
| Ga0207692_109575551 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RESMTPAEIRALAAEAIAHLHEVAGKLAELSALLGEDTP |
| Ga0207684_112176692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RETMTPAEIRALAAEAITHMHEVAGKLAELSALLGDDEAGEDKP |
| Ga0207702_120666551 | 3300026078 | Corn Rhizosphere | ATQNPTMTPAEIRALAAEAIAHLHEVAGKLAELSALLGGGEAGGGKP |
| Ga0318516_103433501 | 3300031543 | Soil | PAEIRALTAESITSLHEVAGKLAELSALLGDDEAGEGTS |
| Ga0318534_106207333 | 3300031544 | Soil | AKPRKAMTPAEIRARAAEAIIHLREVAAKMAELSALLGDDAAGGGAS |
| Ga0318541_100266821 | 3300031545 | Soil | RALAEETIAHLHEVAGKLAELSALLGDDQAAEAKP |
| Ga0318538_100270211 | 3300031546 | Soil | REAMTPAEIRALAAEAIIHLHEVAGKLAELSALLSDDKASEGKS |
| Ga0318573_104522662 | 3300031564 | Soil | ALAKPKKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318515_105448042 | 3300031572 | Soil | PKKTLTSAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0310915_103216263 | 3300031573 | Soil | RKTMTPAEIRARAAEAIIHLREVAAQIAELSALLGDDAVGEGKS |
| Ga0318555_101268593 | 3300031640 | Soil | TRTLPPAEIRALAAEAIAHLHKVADKLTELSALLGDDQASEGRP |
| Ga0318555_103166233 | 3300031640 | Soil | TMTPAEIRALAAESIASLHEVAGKLAELSALLGDDEAGEGRS |
| Ga0318574_101640923 | 3300031680 | Soil | ALARPRKTMTPAEIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0318574_102195055 | 3300031680 | Soil | AKPRKTMTPAEIRARAAEAIIHLREVAAQIAELSALLGDDAVGEGKS |
| Ga0318560_104073053 | 3300031682 | Soil | TEIRALAAESIASLHEVAGKLVELSALLDDDEGGEAT |
| Ga0318560_106317301 | 3300031682 | Soil | RITMTPAEIRALAAEAIAHLHEVADKLAELSALVGDDQGGEDKS |
| Ga0318496_107427142 | 3300031713 | Soil | RETMTPAEIRALAAETIAHLHKVADKLAELSALLADDEPGEGKP |
| Ga0318500_101760024 | 3300031724 | Soil | ASALARPRKTMTPAEIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0318500_107478901 | 3300031724 | Soil | PRKTMTPTEIRALAAEAITHLHKVADKLTELSALLDDHPGEGKP |
| Ga0318494_109304202 | 3300031751 | Soil | TMTPAEIRALAAESIASLHEVAGKLAELSALLGDDQAGEGRS |
| Ga0318546_104655423 | 3300031771 | Soil | PAEIRALAADAIGQLHEAAGKLAELSALLGGDEAGEGTP |
| Ga0318546_105892321 | 3300031771 | Soil | AEIRAVADEAIAHLRDVADRLAELSALLGDDEADGGKP |
| Ga0318546_106973692 | 3300031771 | Soil | AALAEPKKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318566_103394903 | 3300031779 | Soil | TTTPAQIRALAAEAVAQLHEVAAKLTELSALLGDDQADEGKP |
| Ga0318566_104401092 | 3300031779 | Soil | EAAALAKPKKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318508_11773201 | 3300031780 | Soil | KKTLTPAEIRALATEAITHLHKVAAKLTELSALLGDDQPGEAQP |
| Ga0318552_100584993 | 3300031782 | Soil | KPRDTMTPADIRALAAEAIAHLREVAGKLAELSALLGDGEADEGKS |
| Ga0318552_101428894 | 3300031782 | Soil | MTPAEIRALAAEAIAQLHEVAGKLTELSALLGADKAGEDQA |
| Ga0318552_102412631 | 3300031782 | Soil | EIRALAAEAIAHLHKVADKLTELSALLGDDQASEGRP |
| Ga0318529_101379331 | 3300031792 | Soil | AEIRARAAEAIAHLHEVATKLAELSALLGDDEDKS |
| Ga0318548_102866863 | 3300031793 | Soil | ALARPRESMTPAEIRAVAADAIAHLQEVAGKLGELSALLGDGEASEGKS |
| Ga0318548_103909462 | 3300031793 | Soil | MTPAEIRALAAEAIGHLHEVADKLAELSALVGDDQGGEDKS |
| Ga0318550_101049463 | 3300031797 | Soil | AARPRKTMTPAEIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0318523_106506521 | 3300031798 | Soil | MTPAEIRAVAADAIAHLQEVAGKLGELSALLGDGEASEGKS |
| Ga0318497_107927921 | 3300031805 | Soil | DIRVLAAQAIAHLQEVAGKLAELSALLGDEAGEATP |
| Ga0318567_104252981 | 3300031821 | Soil | AEIRALAAEAIAHLHKVADKLTELSALLGDDQASEGRP |
| Ga0318499_102794643 | 3300031832 | Soil | AEIRARATEAKAQLHEVADKLAELSALLGDDAAGGGAS |
| Ga0318517_105357401 | 3300031835 | Soil | ALAKPRKAMAPAEIRAVAEEAIANLHEVAGQLAELSALLGDDEADGGKP |
| Ga0318511_104852801 | 3300031845 | Soil | PAEIRALAADSIASLHEVADKLAELTALLDNEAGEDGS |
| Ga0318495_104232213 | 3300031860 | Soil | TTALARPRATMTPAEIRALAEETIAHLHEVAAKLAELSALLGDDQAGEAKP |
| Ga0306919_108888043 | 3300031879 | Soil | TAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318522_100947693 | 3300031894 | Soil | EIRALAAEAIDHLHEVADKLAELSALLGDGHGGEDRS |
| Ga0318551_107447762 | 3300031896 | Soil | RPRKTMTPAEIRALAAESIASLNEVAGKLAELSALLGDEGAS |
| Ga0318551_108950401 | 3300031896 | Soil | AKTTRTLPPAEIRALAAEAIAHLHKVADKLTELSALLGDDQASEGRP |
| Ga0318520_107943741 | 3300031897 | Soil | SVLARPRKTMTPAEIRALAAEAIANLHKVADKLAELSALLPDNDPGEGKP |
| Ga0306921_121661333 | 3300031912 | Soil | RKNMSPAEIRALTAESITSLHEVASKLAELSALLGDDEVGEGTS |
| Ga0306921_124900053 | 3300031912 | Soil | TLTPAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQL |
| Ga0310912_104573003 | 3300031941 | Soil | ALAKPKKTRTPAEIRALAAEAIAHLHKVAAKLTELSALLGDDQAEAGQP |
| Ga0310916_104279381 | 3300031942 | Soil | AKPKKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0310913_111066093 | 3300031945 | Soil | PRQTMTPAEIRALAAEAIAQLHEVAGKLTELSALLGAGEAGEDQA |
| Ga0310910_110625813 | 3300031946 | Soil | MTPAEIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0310909_107940711 | 3300031947 | Soil | KTLTPAEIRALATEAITHLHKVAAKLTELSALLGDDQPGEAQP |
| Ga0310909_112436883 | 3300031947 | Soil | SQAGETMTPAEIRALAAEAITHLHEVADKLTELSALLGNDEAGRASHERAR |
| Ga0310909_114490552 | 3300031947 | Soil | MTPAEIRALAAESIASLHEVAGKLAELSALLGDDEAGEGRS |
| Ga0318530_101357821 | 3300031959 | Soil | AAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318531_102185661 | 3300031981 | Soil | AGALARPRETMTPAEIRALAAETIAHLHKVADKLAELSALLADDEPGEGKP |
| Ga0318569_100331341 | 3300032010 | Soil | LAKPKKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0318507_102169341 | 3300032025 | Soil | KKTLTAAEIRALAAEAITHLHKVAAKLTELSALLSDDQPGEAQP |
| Ga0310911_103951523 | 3300032035 | Soil | EIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0318559_104592691 | 3300032039 | Soil | PAEIRALAAESIASLQEVASKLAELSALLGDDQAGEGQP |
| Ga0318556_100549371 | 3300032043 | Soil | QTMTPAEIRALAAEAIAQLHEVAGKLTELSALLGADKAGEDQA |
| Ga0318556_105934531 | 3300032043 | Soil | EIRALATEAIAHLHEVAGKLAELSGLLGDDEPGEGQS |
| Ga0318506_104865684 | 3300032052 | Soil | KTMTPAEIRALAAEAIAHLHKVADKLAELSALLPDPEPGEGKP |
| Ga0318575_102910503 | 3300032055 | Soil | RTLPPAEIRALAAEAIAHLHKVADKLTELSALLGDDQASEGRP |
| Ga0318575_106575783 | 3300032055 | Soil | ALARPRATMTPAEIRALAEETIAHLHEVAAKLAELSALLGDDQAGEAKP |
| Ga0318533_102023431 | 3300032059 | Soil | AASSALATEAIAHLHEVAGKLAELSGLLGDDEPGEGQT |
| Ga0318504_101579174 | 3300032063 | Soil | PRESMAPAEIRALAEEAIAHLHEVADKLAELSALLDDKADGGKP |
| Ga0318513_104649383 | 3300032065 | Soil | DTMTPADIRALAAEAIAHLREVAGKLAELSALLGDGEADEGKS |
| Ga0318513_105379231 | 3300032065 | Soil | LAKPRTTTTPAQIRALAAEAVAQLHEVAAKLTELSALLGDDQADEGKP |
| Ga0318524_100567561 | 3300032067 | Soil | MTPAEIRARAAETIAQLHAVAGKLAELSALLGDDEDRS |
| Ga0318553_104171682 | 3300032068 | Soil | MTPAEIRALAAEAIDHLHEVADKLAELSALLGDGHGGEDRS |
| Ga0306924_108194813 | 3300032076 | Soil | PRKTMTPAEIRALAAEAIAHLHKVADKLAELSALLADGEPGEGKP |
| Ga0307470_114268183 | 3300032174 | Hardwood Forest Soil | AEIRALAAEAIAHLHEVAGQLAELSALLGDDEAGEDKP |
| Ga0306920_1012464373 | 3300032261 | Soil | IRALAAEAIAHLHEVTGKLTELSALLGGDEADEGTS |
| Ga0335078_104503851 | 3300032805 | Soil | RETMTPAEIRALAAESIASLHEVACKLAELSALLDDDEASEGRP |
| Ga0335075_100874441 | 3300032896 | Soil | PAEIRDLTDRTIGHLQEVASNLAELSALLGDDEAADDSEGRS |
| Ga0318519_104481001 | 3300033290 | Soil | TRPRESMAPAEIRALAEEAIAHLHEVADKLAELSALLDDKADGGKP |
| ⦗Top⦘ |