| Basic Information | |
|---|---|
| Family ID | F059166 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LGLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLRDRRAIV |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.23 % |
| % of genes near scaffold ends (potentially truncated) | 98.51 % |
| % of genes from short scaffolds (< 2000 bps) | 88.81 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.299 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.075 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.985 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 18.92% Coil/Unstructured: 60.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF07478 | Dala_Dala_lig_C | 2.99 |
| PF00069 | Pkinase | 2.99 |
| PF01435 | Peptidase_M48 | 2.99 |
| PF12852 | Cupin_6 | 2.24 |
| PF04551 | GcpE | 2.24 |
| PF00132 | Hexapep | 2.24 |
| PF12833 | HTH_18 | 1.49 |
| PF13083 | KH_4 | 1.49 |
| PF00326 | Peptidase_S9 | 1.49 |
| PF00083 | Sugar_tr | 1.49 |
| PF14026 | DUF4242 | 1.49 |
| PF01174 | SNO | 1.49 |
| PF07690 | MFS_1 | 1.49 |
| PF02604 | PhdYeFM_antitox | 1.49 |
| PF00072 | Response_reg | 1.49 |
| PF07676 | PD40 | 0.75 |
| PF08282 | Hydrolase_3 | 0.75 |
| PF05198 | IF3_N | 0.75 |
| PF01914 | MarC | 0.75 |
| PF04095 | NAPRTase | 0.75 |
| PF12697 | Abhydrolase_6 | 0.75 |
| PF03725 | RNase_PH_C | 0.75 |
| PF08530 | PepX_C | 0.75 |
| PF03949 | Malic_M | 0.75 |
| PF01841 | Transglut_core | 0.75 |
| PF01928 | CYTH | 0.75 |
| PF10041 | DUF2277 | 0.75 |
| PF01479 | S4 | 0.75 |
| PF01551 | Peptidase_M23 | 0.75 |
| PF01850 | PIN | 0.75 |
| PF01740 | STAS | 0.75 |
| PF00886 | Ribosomal_S16 | 0.75 |
| PF02463 | SMC_N | 0.75 |
| PF01494 | FAD_binding_3 | 0.75 |
| PF00561 | Abhydrolase_1 | 0.75 |
| PF00375 | SDF | 0.75 |
| PF08494 | DEAD_assoc | 0.75 |
| PF00829 | Ribosomal_L21p | 0.75 |
| PF08281 | Sigma70_r4_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 11.94 |
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 2.24 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.49 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 1.49 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.49 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.49 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 1.49 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.75 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.75 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.75 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.75 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.75 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.75 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.75 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.75 |
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 0.75 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.75 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.75 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.75 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.75 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.75 |
| COG0290 | Translation initiation factor IF-3 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.75 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.30 % |
| Unclassified | root | N/A | 9.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10198133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 689 | Open in IMG/M |
| 3300004082|Ga0062384_101331730 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300004092|Ga0062389_102248419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300004092|Ga0062389_103831466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
| 3300005445|Ga0070708_101648583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300005538|Ga0070731_10279506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1108 | Open in IMG/M |
| 3300005538|Ga0070731_10610059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 726 | Open in IMG/M |
| 3300005541|Ga0070733_10034078 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300005921|Ga0070766_10795974 | Not Available | 644 | Open in IMG/M |
| 3300005950|Ga0066787_10065866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300005995|Ga0066790_10018506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3051 | Open in IMG/M |
| 3300006028|Ga0070717_12052503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300006052|Ga0075029_100119701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1597 | Open in IMG/M |
| 3300006176|Ga0070765_100207276 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300006176|Ga0070765_100554127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300006176|Ga0070765_101258448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300007788|Ga0099795_10521970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300009038|Ga0099829_11717734 | Not Available | 516 | Open in IMG/M |
| 3300009518|Ga0116128_1117313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300009520|Ga0116214_1338784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300009521|Ga0116222_1562363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009522|Ga0116218_1255664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300009523|Ga0116221_1143156 | Not Available | 1043 | Open in IMG/M |
| 3300009638|Ga0116113_1088796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300009638|Ga0116113_1113963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300009640|Ga0116126_1048101 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300009683|Ga0116224_10057072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1904 | Open in IMG/M |
| 3300009759|Ga0116101_1007674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1884 | Open in IMG/M |
| 3300009764|Ga0116134_1311430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300009824|Ga0116219_10273183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300010379|Ga0136449_100825989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
| 3300010379|Ga0136449_103022019 | Not Available | 656 | Open in IMG/M |
| 3300012208|Ga0137376_10191182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1769 | Open in IMG/M |
| 3300012351|Ga0137386_10666474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300012359|Ga0137385_11244330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012532|Ga0137373_10807208 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300013104|Ga0157370_10187798 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300014654|Ga0181525_10060192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2144 | Open in IMG/M |
| 3300016294|Ga0182041_10852307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300017822|Ga0187802_10169037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300017925|Ga0187856_1203517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300017933|Ga0187801_10169127 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300017933|Ga0187801_10182881 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300017938|Ga0187854_10034546 | All Organisms → cellular organisms → Bacteria | 2639 | Open in IMG/M |
| 3300017938|Ga0187854_10279379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300017943|Ga0187819_10546587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300017959|Ga0187779_10306007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 1018 | Open in IMG/M |
| 3300017970|Ga0187783_11209230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300017974|Ga0187777_10803251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 672 | Open in IMG/M |
| 3300017995|Ga0187816_10341548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300017995|Ga0187816_10373804 | Not Available | 631 | Open in IMG/M |
| 3300018013|Ga0187873_1358771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300018014|Ga0187860_1186685 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300018017|Ga0187872_10031876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2939 | Open in IMG/M |
| 3300018020|Ga0187861_10009123 | All Organisms → cellular organisms → Bacteria | 7107 | Open in IMG/M |
| 3300018020|Ga0187861_10492973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300018021|Ga0187882_1156623 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300018025|Ga0187885_10086802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
| 3300018025|Ga0187885_10218071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300018032|Ga0187788_10224572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300018038|Ga0187855_10015318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5085 | Open in IMG/M |
| 3300018040|Ga0187862_10260188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300018047|Ga0187859_10443818 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300018057|Ga0187858_10275464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300018062|Ga0187784_10064960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2959 | Open in IMG/M |
| 3300018085|Ga0187772_10651656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 752 | Open in IMG/M |
| 3300018088|Ga0187771_11045972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300019877|Ga0193722_1040549 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300020021|Ga0193726_1085785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1444 | Open in IMG/M |
| 3300020580|Ga0210403_11508551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300020581|Ga0210399_10080794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2641 | Open in IMG/M |
| 3300020583|Ga0210401_10651701 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300021171|Ga0210405_11053455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300021171|Ga0210405_11074572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300021180|Ga0210396_11680353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300021181|Ga0210388_11064434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300021402|Ga0210385_10852046 | Not Available | 699 | Open in IMG/M |
| 3300021402|Ga0210385_10951469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300021406|Ga0210386_11672090 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021420|Ga0210394_11222607 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 644 | Open in IMG/M |
| 3300021432|Ga0210384_11736495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021433|Ga0210391_10559723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300021474|Ga0210390_10807765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300021475|Ga0210392_10618017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300021559|Ga0210409_11734659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021560|Ga0126371_11223914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 887 | Open in IMG/M |
| 3300022508|Ga0222728_1065338 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300022715|Ga0242678_1075852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300023090|Ga0224558_1007862 | All Organisms → cellular organisms → Bacteria | 7018 | Open in IMG/M |
| 3300025477|Ga0208192_1048884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300025480|Ga0208688_1035537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
| 3300027069|Ga0208859_1004901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1427 | Open in IMG/M |
| 3300027562|Ga0209735_1045239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300027625|Ga0208044_1060857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300027641|Ga0208827_1123801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300027641|Ga0208827_1204228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300027678|Ga0209011_1221774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027696|Ga0208696_1288855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300027795|Ga0209139_10144362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
| 3300027882|Ga0209590_10785636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027884|Ga0209275_10015256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3361 | Open in IMG/M |
| 3300027908|Ga0209006_11246947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300028731|Ga0302301_1134593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300028746|Ga0302233_10083539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300028783|Ga0302279_10361797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300028906|Ga0308309_10612162 | Not Available | 945 | Open in IMG/M |
| 3300029817|Ga0247275_1049608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1191 | Open in IMG/M |
| 3300030007|Ga0311338_10076619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4275 | Open in IMG/M |
| 3300030053|Ga0302177_10254666 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300030056|Ga0302181_10464045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300030058|Ga0302179_10033220 | Not Available | 2393 | Open in IMG/M |
| 3300030294|Ga0311349_11552316 | Not Available | 614 | Open in IMG/M |
| 3300030399|Ga0311353_10382327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300030518|Ga0302275_10222895 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300030518|Ga0302275_10646712 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300030659|Ga0316363_10078814 | Not Available | 1500 | Open in IMG/M |
| 3300031233|Ga0302307_10659842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300031234|Ga0302325_12834133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300031236|Ga0302324_102967631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031247|Ga0265340_10138054 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300031524|Ga0302320_10186046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3018 | Open in IMG/M |
| 3300031708|Ga0310686_105769023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300031708|Ga0310686_107139956 | Not Available | 786 | Open in IMG/M |
| 3300031708|Ga0310686_118805383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300031718|Ga0307474_10489742 | Not Available | 963 | Open in IMG/M |
| 3300031823|Ga0307478_10432530 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300031823|Ga0307478_11504431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300031947|Ga0310909_10448185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 1083 | Open in IMG/M |
| 3300032805|Ga0335078_11796181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300032892|Ga0335081_10572813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 1400 | Open in IMG/M |
| 3300032955|Ga0335076_11317895 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300033134|Ga0335073_10741820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1065 | Open in IMG/M |
| 3300033977|Ga0314861_0274782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.18% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.19% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.46% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.22% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101981331 | 3300000567 | Peatlands Soil | LSLSLDTREVGCVTIVRCNGRIVAGSASESLLAHVAWLLHTR |
| Ga0062384_1013317301 | 3300004082 | Bog Forest Soil | LPLSLDTREVGRVTIVHCNGRIVAGSECDSLRAHITWLLRDRRSIVLHLGEVGFI |
| Ga0062389_1022484191 | 3300004092 | Bog Forest Soil | LSLDTREVGRVTIVRCNGRIVAGVETESLRTHVAWLLRDRRSIVLH |
| Ga0062389_1038314662 | 3300004092 | Bog Forest Soil | MLLSLDTREVGRVTIVRCNGRIVAGSESESLRAHLAWLLRDR |
| Ga0070708_1016485831 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLSLDTREVGRVTIVRCNGRIVAGGESESLRAHVDWLLRDRRSI |
| Ga0070731_102795061 | 3300005538 | Surface Soil | MLLSLQTRDVGRVTVIRCNGRIVSGPESESLITHVASLLHDRRAIVLHMEDVVYVDSS |
| Ga0070731_106100591 | 3300005538 | Surface Soil | VPLSLETREVGRVTIVRCKGRLVAGGEVEALREHIAWLLRDRRAIVLHLGE |
| Ga0070733_100340785 | 3300005541 | Surface Soil | MRLSLETREVGKVTIVCCNGRIVTGAESESLLSHVAWLLRDRRSIILHMGDVAFVDSS |
| Ga0070766_107959742 | 3300005921 | Soil | MKLSLETRDVGKVTIVRCKGRLVAGGEVESLKSHISHLLRDRRAIV |
| Ga0066787_100658662 | 3300005950 | Soil | MPLTLNTREVGRVTIVRCGGRIVAGADTDSLRAHIEHLFLDRKAIVLHLGDVEFVDSSGL |
| Ga0066790_100185064 | 3300005995 | Soil | MPLSLDTREVGRVTVVQCNGRIVAGKESDALRAHVTWLLRDRRSIVLD |
| Ga0070717_120525031 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLSLDTRQVGHVTIVCCNGRIVSGGESEALRAHVASLLRDRRSIVL |
| Ga0075029_1001197011 | 3300006052 | Watersheds | LNLLLDTREVGRVTIVRCKGRIVAGGEVEALRAHVTHLLRD |
| Ga0070765_1002072762 | 3300006176 | Soil | VNLSLQTRGVGRVTIVRCGGRIVAGAESVALREHVAEILLDRRSIVLHMG |
| Ga0070765_1005541271 | 3300006176 | Soil | VNLSLQTRGVGRVTIVRCGGRIVAGAESVALREHVAEILLDRRSIVLHMGE |
| Ga0070765_1012584482 | 3300006176 | Soil | VRLSLDTREVGRVTIVHCNGRIVAGGESEALREHIV |
| Ga0099795_105219701 | 3300007788 | Vadose Zone Soil | LPLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLHSS |
| Ga0099829_117177341 | 3300009038 | Vadose Zone Soil | VRLSLETRGVGDVTIIRCNGRIVAGSETELLHAHV |
| Ga0116128_11173131 | 3300009518 | Peatland | LPLSLDTREVGQVTIVHCNGRIVAGRESDSLRAHVAWLL |
| Ga0116214_13387841 | 3300009520 | Peatlands Soil | MRLSLQTREVGRVTIVRCNGRIVAGSESESLRSHVTWL |
| Ga0116222_15623631 | 3300009521 | Peatlands Soil | LSLSLDTREVGCVTIVRCNGRIVAGSASESLLAHVAWLLHTRSSIVLNLGQVGFID |
| Ga0116218_12556641 | 3300009522 | Peatlands Soil | LSLDTREVGRVTIVRCNGRIVVGSGSESLRAHVDRLLLDRRAIV |
| Ga0116221_11431561 | 3300009523 | Peatlands Soil | MRLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVTWLLRD |
| Ga0116113_10887961 | 3300009638 | Peatland | LSLSLATREVGRVTIVHCNGRIVAGTASDSLREHVTWLLRDRRSIVLH |
| Ga0116113_11139632 | 3300009638 | Peatland | LTLETREVGRVTIVHCNGRIIAGKESESLRAHVAWVLRDRRSIVLHLGDVGFVD |
| Ga0116126_10481014 | 3300009640 | Peatland | LPLSLDTREVGQVTIVHCNGRIVAGRESDSLRAHVAWLLRDRRSIVLH |
| Ga0116224_100570722 | 3300009683 | Peatlands Soil | VDLALQTRAVGRVTVVRCSGRIVAGVGSVALREHVT |
| Ga0116101_10076741 | 3300009759 | Peatland | MSVRPSNPLRLTLDTREVGRVTIVHCKGRIVAGGEAEALRAHVAHLLRDRR |
| Ga0116134_13114301 | 3300009764 | Peatland | VSLSLDTREVGRVTIVRCNGRIVAGKASESLLAHVAW |
| Ga0116219_102731831 | 3300009824 | Peatlands Soil | LSLSLDTREVGCVTIVRCNGRIVAGSASESLLAHVAWLLHTRSSIVL |
| Ga0136449_1008259891 | 3300010379 | Peatlands Soil | LRLSLDTRDVGRVTIVHCNGRIVAGGESESLRAHVAWLLRDRRSIVLH |
| Ga0136449_1030220191 | 3300010379 | Peatlands Soil | MRLSLETREVGRVTIVRCNVRIVAGSESESLRAHVTWLLRDRRAIVLHLGEVGF |
| Ga0137376_101911822 | 3300012208 | Vadose Zone Soil | LGLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLRDRRAIV |
| Ga0137386_106664741 | 3300012351 | Vadose Zone Soil | LGLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLRDRRAI |
| Ga0137385_112443301 | 3300012359 | Vadose Zone Soil | LGLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLRDRRAIVLHL |
| Ga0137373_108072081 | 3300012532 | Vadose Zone Soil | MIVRCNGRIVAGGESELLSSHVACLFRDRRAIVLHMGEVGFVDSSGLG |
| Ga0157370_101877983 | 3300013104 | Corn Rhizosphere | LRLSLDTREVGHVTIVRCNGRITAGDECDSLRSHVTW |
| Ga0181525_100601921 | 3300014654 | Bog | LQLTLDTRKVGRVTIVRCNGRIVAGSSSESLRAHVAWLLHDRRAIVLHLGE |
| Ga0182041_108523073 | 3300016294 | Soil | MLLSLETREVGRVTVIRCNGRIVSGPESELLISHVATLLQDRRAIVLHIGDVVFIDSSGLGT |
| Ga0187802_101690372 | 3300017822 | Freshwater Sediment | MIVHRSLLRLTLNTREVGRVTVVQCNGRIVSGGESDSLRTHVNQLLRDRRN |
| Ga0187856_12035172 | 3300017925 | Peatland | VSLSLDTREVGRVTIVRCNGRIVAGQASESLLAHVAWLLHTRSSIVLNLGE |
| Ga0187801_101691271 | 3300017933 | Freshwater Sediment | MPLSLDTRGVGKVTVVRCNGRIVAGTENESLRTHISGMMRD |
| Ga0187801_101828811 | 3300017933 | Freshwater Sediment | MLLSLDTRDVGRVTIVRCQGRIVAGSESESLRTHVASLLEDRR |
| Ga0187854_100345461 | 3300017938 | Peatland | LRLSLETREVGRVTIVHCNGRIVAGGESESLRAHVSWLLRDRRSIVLHLGEVGF |
| Ga0187854_102793792 | 3300017938 | Peatland | LLLSLDTREVGRVTIVRCNGRIVAGGESESLRAHVTWLLHTRSSIVLNLG |
| Ga0187819_105465872 | 3300017943 | Freshwater Sediment | LLLSLDTREVGRVTIVRCMGRIVAGSASESLLAHIAWLLHTRSSIVL |
| Ga0187779_103060071 | 3300017959 | Tropical Peatland | MQLSLETREVGQVTIVRCNGRIVSGGESESLRSHVAWLLRD |
| Ga0187783_112092302 | 3300017970 | Tropical Peatland | VKLSLETRDIGRVTIVRCKGRLVAGEEVELLRSHIT |
| Ga0187777_108032512 | 3300017974 | Tropical Peatland | MQLSLETREVGQVTIVRCNGRIVSGGESESLRTHVAWLLRDHRAIVL |
| Ga0187816_103415481 | 3300017995 | Freshwater Sediment | VKLALETRDVGRVTIVRCKGRLVAGAEVEALRAHVAWILRDRR |
| Ga0187816_103738041 | 3300017995 | Freshwater Sediment | MRLSLDTRQVGRVTIVRCNGRIVAGSESESLRAHV |
| Ga0187873_13587712 | 3300018013 | Peatland | VSLSLDTREVGRVTIVRCNGRIVAGRASESLRAHVAWLLHDRRAIVLHLG |
| Ga0187860_11866853 | 3300018014 | Peatland | LPLSLDTREVGQVTIVHCNGRIVAGRESDSLRAHVAWLLRDRRSIVLHLGE |
| Ga0187872_100318765 | 3300018017 | Peatland | LPLSLDTREVGQVTIVHCNGRIVAGRESDSLRAHVAWLLRDRRSIVLHLGEVGF |
| Ga0187861_100091231 | 3300018020 | Peatland | LPLSLDTREVGQVTIVHCNGRIVAGRESDSLRAHVAWLLRDRRSIV |
| Ga0187861_104929732 | 3300018020 | Peatland | LLLSLDTREVGRVTIVRCNGRIVAGGESESLRAHVTWLLHTRSSIVLNLGEV |
| Ga0187882_11566231 | 3300018021 | Peatland | LPLSLDTREVGRVTIVHCNGRIVASESESLRAHVAWLLRDRRSIVLHL |
| Ga0187885_100868021 | 3300018025 | Peatland | LLLSLDTREVGRVTIVRCNGRIVAGRESESLLAHVAWLLHTRSSIVLNLGEVGFV |
| Ga0187885_102180711 | 3300018025 | Peatland | VSLSLDTREVGRVTIVRCNGRIVAGQASESLLAHVAWLLHTRSSIVLNL |
| Ga0187788_102245721 | 3300018032 | Tropical Peatland | MPLSLDTRGVGKVTIVRCNGRIVAGTETEALRSHISGL |
| Ga0187855_100153181 | 3300018038 | Peatland | LPLTLETREVGRVTIVHCNGRIIAGKESESLRAHVAWVLR |
| Ga0187862_102601881 | 3300018040 | Peatland | VSLSLDTREVGRVTIVRCNGRIVAGQASESLLAHVAW |
| Ga0187859_104438181 | 3300018047 | Peatland | LSLDTREVGRVTVVHCKGRIIGGRESESLRAHLSWLLHTRRSFVLHL |
| Ga0187858_102754641 | 3300018057 | Peatland | LPLSLDTREVGRVTIVHCNGRIVASESESLRAHVAWLLRDRRSIVLHLGE |
| Ga0187784_100649601 | 3300018062 | Tropical Peatland | MELSLETREVGRVTIVRCNGRIVSGDESESLRTHVAWLLRDRRAIVLH |
| Ga0187772_106516561 | 3300018085 | Tropical Peatland | MLLSLDTREVGRVTIVRCQGRIVAGRESDSLREHVASLLQDRRSIILH |
| Ga0187771_110459721 | 3300018088 | Tropical Peatland | MMLSLETREIGRVTIVRCQGRIVAGSASEELRAHITWLLRDRRAIVLHLG |
| Ga0193722_10405492 | 3300019877 | Soil | LRLSLDTREVGHVTIVRCNGRITAGDECESLRSHVTWLLRDRRAIVLHMGDV |
| Ga0193726_10857853 | 3300020021 | Soil | VRLTLETREVGRVTIVHCRGRIIAGSETESLHNHLAR |
| Ga0210403_115085512 | 3300020580 | Soil | LRLSLDTRDVGRVTIVRCNGRIVAGGESEALRAHVDWLLRDRRSI |
| Ga0210399_100807945 | 3300020581 | Soil | LPLSLDTREVGRVTIVRCNGRIVAGGESESLRAHIDRLLLDRRSIILHMGEV |
| Ga0210401_106517011 | 3300020583 | Soil | LKLLLETRDVGRVTIVRCKGRLVAGSEVEALRAHVAWILRDR |
| Ga0210405_110534551 | 3300021171 | Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRSHVTW |
| Ga0210405_110745722 | 3300021171 | Soil | LGLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWL |
| Ga0210396_116803531 | 3300021180 | Soil | MRLALETREVGRVTIVRCNGRIVAGSESESLRSHVTWLLRD |
| Ga0210388_110644341 | 3300021181 | Soil | LRLSLDTRDVGRVTIVHCNGRIVAGGESESLRAHVAWLLRDRRSIVLHLGEVG |
| Ga0210385_108520463 | 3300021402 | Soil | MKLSLETRDVGKVTIVRCKGRLVAGGEVESLKSHISHLL |
| Ga0210385_109514691 | 3300021402 | Soil | LLLSLDTREVGRVTIVRCNGRIVAGGESDSLRSHVTWLLRDRRD |
| Ga0210386_116720901 | 3300021406 | Soil | LRLTLETRDVGRVTIVRCKGRLVAGGEVEALRAHVA |
| Ga0210394_112226072 | 3300021420 | Soil | LRLSLDTREVGRVTIVRCNGRIVAGGESESLRSHVSWLLRDRRSIV |
| Ga0210384_117364951 | 3300021432 | Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRSHVTWLLRD |
| Ga0210391_105597231 | 3300021433 | Soil | LRLSLDTRDVGRVTIVHCNGRIVAGGESESLRTHVAWLLRDRRSIVLHLGEV |
| Ga0210390_108077651 | 3300021474 | Soil | LRLSLDTRDIGRVTIVHCNGRIVAGSESESLRAHV |
| Ga0210392_106180172 | 3300021475 | Soil | MALALQTREVGKVTIIECRGRIVAGTETESLHAHLNW |
| Ga0210409_117346591 | 3300021559 | Soil | LPLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVAWLLHTRRSIVLNLGKV |
| Ga0126371_112239141 | 3300021560 | Tropical Forest Soil | MELLLETREVGQVTIVRCNGRIVSGGESESLRTHVA |
| Ga0222728_10653381 | 3300022508 | Soil | LRLTLETRDVGRVTIVRCKGRLVAGGEVEALRAHVAHVLRDR |
| Ga0242678_10758522 | 3300022715 | Soil | VGKVTIVRCKGRLVAGGEVESLKSHISHLLRDRRAIVLHLGEVVFID |
| Ga0224558_10078624 | 3300023090 | Soil | LLLSLDTREVGRVTIVRCNGRIVAGSASESLRAHVAWL |
| Ga0208192_10488841 | 3300025477 | Peatland | LPLTLETREVGRVTIVHCNGRIIAGKESESLRAHVAWVLRDRRSIVLHLGDVGF |
| Ga0208688_10355371 | 3300025480 | Peatland | LLLSLDTREVGRVTIVRCNGRIVAGRESESLLAHVAWLLHTRSSIVLNLGEVGF |
| Ga0209236_11473983 | 3300026298 | Grasslands Soil | VRLSLETRGVGDVTIIRCNGRIVAGSETELLHAHVNRLMQDGTDIVLHLGDVV |
| Ga0208859_10049012 | 3300027069 | Forest Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRSHVTWL |
| Ga0209735_10452391 | 3300027562 | Forest Soil | LPLSLDTREVGRVTIVRCNGRIVAGGESESLRAHIDRLLLDRRSIILHMGEVG |
| Ga0208044_10608572 | 3300027625 | Peatlands Soil | METRDVGRVTIVRCKGRLVAGAEVEALRAHIAHLLRDRRSIV |
| Ga0208827_11238012 | 3300027641 | Peatlands Soil | LSLSLDTREVGCVTIVRCNGRIVAGSASESLLAHVAWLLHTRSS |
| Ga0208827_12042281 | 3300027641 | Peatlands Soil | LRLSLDTRKVGRVTIVRCNGRIVAGSESESLRTHVAWLLRDRRAIVLHLGDV |
| Ga0209011_12217741 | 3300027678 | Forest Soil | LPLSLDTREVGRVTIVRCNGRIVAGGESESLRAHIDRLLLDRRSIILH |
| Ga0208696_12888551 | 3300027696 | Peatlands Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRSHVTWLLRDRRAIVLH |
| Ga0209139_101443621 | 3300027795 | Bog Forest Soil | MRLSLDTREVGRVTIVRCNGRIVAGGESESLREHVTWLLRDRRSIVLD |
| Ga0209590_107856361 | 3300027882 | Vadose Zone Soil | VRYPTGNPLRLTLETREVGRVTIVRCKGRIVAGGETEALRAHVTHLLR |
| Ga0209275_100152561 | 3300027884 | Soil | LRLSLDTREVGRVTIVCCNGRIIAGGEAESLLAHVAWLLRDRRAIVLHL |
| Ga0209006_112469471 | 3300027908 | Forest Soil | MLLALETRMVGRVTIVRCNGRIVSGKESDSLREHVAWLLRDR |
| Ga0302301_11345931 | 3300028731 | Palsa | MSVRPSNPLRLTLDTREVGRVTIVHCKGRIVAGGEAEALRA |
| Ga0302233_100835393 | 3300028746 | Palsa | VRLSLDTRKVGHVTIVRCNGRIVAGGESDSLRAHVTWLLRDRRAIVLHMGEVEFI |
| Ga0302279_103617972 | 3300028783 | Bog | MRLALDTRQVGRVTIVSCNGRIVSGGESEALLAHVSWLLH |
| Ga0308309_106121622 | 3300028906 | Soil | LRLSLDTREVGRVTIVRCKGRIVSGGESESLRTHVAWLLRD |
| Ga0247275_10496081 | 3300029817 | Soil | LLLSLDTREVGRVTIVRCNGRIVAGGESESLRAHVTWLLHTRSSIVL |
| Ga0311338_100766195 | 3300030007 | Palsa | LNLSLDTRKVGRVTIVRCAGRIVAGGESESLREHVTWLLRD |
| Ga0302177_102546661 | 3300030053 | Palsa | LKLSLETREVGRVTIVRCKGRLVSGGETEALRAHVNHLLRDRRSIVLHLGEI |
| Ga0302181_104640451 | 3300030056 | Palsa | LRLSLDTRKVGRVTIVRCNGRIVAGSESESLRAHVAWLLHDR |
| Ga0302179_100332203 | 3300030058 | Palsa | MAGPLRLVLDTREVGRVTIVRCNGRIVAGGESELLRSHVSWLLRDRRSIVLHLG |
| Ga0311349_115523161 | 3300030294 | Fen | MTIAVNTKMRLSLETRDVGRVTIVRCNGRIVTGEESESLRTHVA |
| Ga0311353_103823271 | 3300030399 | Palsa | VRLSLDTREVGRVTIVHCNGRIVAGGESEALREHIVHLLRDRR |
| Ga0302275_102228952 | 3300030518 | Bog | LRLTLETREAGRVAIVRCKGRIVAGGEAESLGTHIENLLPLHRAVV |
| Ga0302275_106467121 | 3300030518 | Bog | LRLSLDTRRVGDVTIVRCNGRIVAGGESESLRAHVTWLLRDRRAIVLHLGEVE |
| Ga0316363_100788143 | 3300030659 | Peatlands Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRAHMTWLLRDRRAIVLHLG |
| Ga0302307_106598421 | 3300031233 | Palsa | LLLSFDTREVGRVTIVRCNGRIVAGSESESLRAHV |
| Ga0302325_128341331 | 3300031234 | Palsa | LNLSLDTRKVGRVTIVRCAGRIVAGGESESLREHVTWLLRDRRAILLHLG |
| Ga0302324_1029676311 | 3300031236 | Palsa | LLLSLDTRQVGRVTIVRCQGRIVAGNESESLRAHVAWLLRDRRSIVLH |
| Ga0265340_101380542 | 3300031247 | Rhizosphere | MGDPLPLSLDIREVGRVTIVRCNGRIVAGAESDSLRAHVAWLLRDRRSI |
| Ga0302320_101860466 | 3300031524 | Bog | MRLALDTRQVGRVTIVSCNGRIVSGGESEALLAHVSWLLHDRRSIVLHLGDVAFID |
| Ga0310686_1057690232 | 3300031708 | Soil | MRLSLETREGGRVTIVRCNGRIVAGSESESLRSHVT |
| Ga0310686_1071399562 | 3300031708 | Soil | LRLSLDTREVGRVTIVRCNGRIVAGGESESLRSHVSWLLRDRRSIVLHLGDVGFIDSS |
| Ga0310686_1188053831 | 3300031708 | Soil | MRLSLETREVGRVTIVRCNGRIVAGSESESLRSHVTWLLRDRRAIVLHLGEVG |
| Ga0307474_104897421 | 3300031718 | Hardwood Forest Soil | MRLSLDTREVGRVTIVRCNGRIVAGSESESLRAHVTWLLRDRR |
| Ga0307478_104325303 | 3300031823 | Hardwood Forest Soil | MRLSLDTRQVGRVTIVRCNGRIVAGSESESLRAHVTWLLRDRRAIVLHLG |
| Ga0307478_115044311 | 3300031823 | Hardwood Forest Soil | MRLSLETRDVGRVTIVRCNGRIVAGSESESLRSHVTWLLRDRRAIVL |
| Ga0310909_104481852 | 3300031947 | Soil | MELSLETREVGQVTIVRCNGRIVSGLESESLRTHVAWLLRDRRAIVLHLGDV |
| Ga0335078_117961811 | 3300032805 | Soil | LPLSLDTREVGRVTIVRCNGRIVAGRESESLHSHVTWLLRDHRAIVLHLGEIEFVDSSG |
| Ga0335081_105728131 | 3300032892 | Soil | MELSLETREVGQVTIVRCNGRIVSGGESESLRTHVAWL |
| Ga0335076_113178951 | 3300032955 | Soil | LLLAFDTRDVGRVTVVRCQGRIVAGGESESLRSHVT |
| Ga0335073_107418201 | 3300033134 | Soil | VRLTLETRDVGRVTIVRCKGRLVAGGEVEALREHITWLLRDRRAIVL |
| Ga0314861_0274782_1_156 | 3300033977 | Peatland | MRLSLETREVGRVTIVRCNGRIVTGDESESLRAHVAWLLRDRRAIVLHLGEV |
| ⦗Top⦘ |