NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059160

Metagenome / Metatranscriptome Family F059160

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059160
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 45 residues
Representative Sequence MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQE
Number of Associated Samples 117
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.51 %
% of genes near scaffold ends (potentially truncated) 97.76 %
% of genes from short scaffolds (< 2000 bps) 93.28 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.582 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.836 % of family members)
Environment Ontology (ENVO) Unclassified
(28.358 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.47%    β-sheet: 0.00%    Coil/Unstructured: 48.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF03853YjeF_N 6.72
PF02308MgtC 5.97
PF03129HGTP_anticodon 5.22
PF00440TetR_N 4.48
PF13091PLDc_2 2.99
PF02518HATPase_c 2.24
PF13450NAD_binding_8 1.49
PF07730HisKA_3 1.49
PF01028Topoisom_I 1.49
PF02656DUF202 1.49
PF08450SGL 1.49
PF13413HTH_25 0.75
PF02558ApbA 0.75
PF04672Methyltransf_19 0.75
PF00916Sulfate_transp 0.75
PF07077DUF1345 0.75
PF13424TPR_12 0.75
PF01872RibD_C 0.75
PF09363XFP_C 0.75
PF00391PEP-utilizers 0.75
PF08044DUF1707 0.75
PF07274DUF1440 0.75
PF04073tRNA_edit 0.75
PF07690MFS_1 0.75
PF13977TetR_C_6 0.75
PF01544CorA 0.75
PF03358FMN_red 0.75
PF13185GAF_2 0.75
PF04203Sortase 0.75
PF00005ABC_tran 0.75
PF12706Lactamase_B_2 0.75
PF02129Peptidase_S15 0.75
PF01048PNP_UDP_1 0.75
PF03176MMPL 0.75
PF04972BON 0.75
PF00535Glycos_transf_2 0.75
PF03050DDE_Tnp_IS66 0.75
PF00282Pyridoxal_deC 0.75
PF08220HTH_DeoR 0.75
PF00196GerE 0.75
PF01925TauE 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 6.72
COG3174Membrane component of predicted Mg2+ transport system, contains DUF4010 domainInorganic ion transport and metabolism [P] 5.97
COG1285Magnesium uptake protein YhiD/SapB, involved in acid resistanceInorganic ion transport and metabolism [P] 5.97
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 5.22
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 5.22
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 5.22
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 5.22
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 1.49
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.49
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.49
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 1.49
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 1.49
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 1.49
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 1.49
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 1.49
COG3477Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 familyFunction unknown [S] 0.75
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.75
COG3436TransposaseMobilome: prophages, transposons [X] 0.75
COG4291Uncharacterized membrane proteinFunction unknown [S] 0.75
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 0.75
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.75
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.75
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 0.75
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.75
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.75
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.75
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.75
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.75
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 0.75
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.75
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.75
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.75

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.58 %
UnclassifiedrootN/A16.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_104687539Not Available515Open in IMG/M
3300004152|Ga0062386_100009652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB00486827Open in IMG/M
3300005093|Ga0062594_101622079Not Available671Open in IMG/M
3300005436|Ga0070713_100422198All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300005591|Ga0070761_10927601All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005610|Ga0070763_10108980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1406Open in IMG/M
3300005764|Ga0066903_104338313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales758Open in IMG/M
3300006176|Ga0070765_100857029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300009698|Ga0116216_10830535Not Available554Open in IMG/M
3300009700|Ga0116217_10874244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300010048|Ga0126373_10865527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii967Open in IMG/M
3300010048|Ga0126373_11085503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium866Open in IMG/M
3300010358|Ga0126370_11944676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300010362|Ga0126377_13201291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300010376|Ga0126381_101448322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300010376|Ga0126381_103734007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300010376|Ga0126381_105060809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300010379|Ga0136449_102242710Not Available795Open in IMG/M
3300010379|Ga0136449_103250732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300012971|Ga0126369_11267290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300013296|Ga0157374_11858122Not Available628Open in IMG/M
3300014654|Ga0181525_10025494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3598Open in IMG/M
3300014969|Ga0157376_10391458Not Available1341Open in IMG/M
3300015264|Ga0137403_10736212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300016319|Ga0182033_10477868All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300016445|Ga0182038_10248453Not Available1429Open in IMG/M
3300016445|Ga0182038_11542337Not Available597Open in IMG/M
3300017924|Ga0187820_1126056Not Available755Open in IMG/M
3300017926|Ga0187807_1250158Not Available581Open in IMG/M
3300017932|Ga0187814_10387073Not Available543Open in IMG/M
3300017946|Ga0187879_10554345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300017970|Ga0187783_10631433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300017970|Ga0187783_10688510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300017972|Ga0187781_10566343Not Available818Open in IMG/M
3300017973|Ga0187780_10417076All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300017975|Ga0187782_11437926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300018030|Ga0187869_10501116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300018035|Ga0187875_10547509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300018038|Ga0187855_10316931All Organisms → cellular organisms → Bacteria → Terrabacteria group912Open in IMG/M
3300018060|Ga0187765_11041808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300020580|Ga0210403_10994225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300020582|Ga0210395_10043216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3298Open in IMG/M
3300021180|Ga0210396_11300481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300021180|Ga0210396_11534561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300021181|Ga0210388_11213891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300021388|Ga0213875_10636806All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300021405|Ga0210387_11264799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia639Open in IMG/M
3300021406|Ga0210386_10140509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2013Open in IMG/M
3300021406|Ga0210386_10453461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300021406|Ga0210386_10995323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300021474|Ga0210390_11613817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300021477|Ga0210398_10329904All Organisms → cellular organisms → Bacteria → Terrabacteria group1244Open in IMG/M
3300021559|Ga0210409_10550001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300022512|Ga0242676_1027955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300022512|Ga0242676_1046768Not Available530Open in IMG/M
3300025915|Ga0207693_11177525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300025929|Ga0207664_11574952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300025981|Ga0207640_11433425Not Available619Open in IMG/M
3300027090|Ga0208604_1007802All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300027504|Ga0209114_1007680Not Available1597Open in IMG/M
3300027692|Ga0209530_1014622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2403Open in IMG/M
3300027729|Ga0209248_10224437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300027817|Ga0209112_10118511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300027855|Ga0209693_10559208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300027874|Ga0209465_10186479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1034Open in IMG/M
3300027884|Ga0209275_10015950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3295Open in IMG/M
3300027908|Ga0209006_11312351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300028731|Ga0302301_1107965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300028747|Ga0302219_10119340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1002Open in IMG/M
3300028762|Ga0302202_10084920All Organisms → cellular organisms → Bacteria → Terrabacteria group1867Open in IMG/M
3300028780|Ga0302225_10081185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1592Open in IMG/M
3300028801|Ga0302226_10237602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia774Open in IMG/M
3300028889|Ga0247827_10138318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300029943|Ga0311340_10939809Not Available715Open in IMG/M
3300029951|Ga0311371_10658397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1328Open in IMG/M
3300029997|Ga0302302_1146108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia926Open in IMG/M
3300030007|Ga0311338_10972442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300030013|Ga0302178_10512096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300030056|Ga0302181_10429301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300030490|Ga0302184_10013696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4576Open in IMG/M
3300030494|Ga0310037_10234508All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300030578|Ga0210275_10135969Not Available720Open in IMG/M
3300030740|Ga0265460_12350467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300030906|Ga0302314_11346715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300031233|Ga0302307_10613646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300031236|Ga0302324_101826010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300031236|Ga0302324_101837659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria768Open in IMG/M
3300031525|Ga0302326_11340876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia971Open in IMG/M
3300031543|Ga0318516_10223064All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300031543|Ga0318516_10346890Not Available857Open in IMG/M
3300031544|Ga0318534_10312861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
3300031544|Ga0318534_10794343All Organisms → cellular organisms → Bacteria → Terrabacteria group532Open in IMG/M
3300031549|Ga0318571_10140250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria827Open in IMG/M
3300031668|Ga0318542_10264839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria876Open in IMG/M
3300031668|Ga0318542_10460175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300031679|Ga0318561_10206094All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1067Open in IMG/M
3300031708|Ga0310686_105741374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis723Open in IMG/M
3300031715|Ga0307476_11182476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300031719|Ga0306917_10254102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1347Open in IMG/M
3300031724|Ga0318500_10661709All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300031763|Ga0318537_10319931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300031771|Ga0318546_11053415Not Available572Open in IMG/M
3300031777|Ga0318543_10139475All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1061Open in IMG/M
3300031779|Ga0318566_10586607All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300031780|Ga0318508_1021901All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300031781|Ga0318547_10361007All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300031798|Ga0318523_10301927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300031805|Ga0318497_10642996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300031819|Ga0318568_10975957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300031831|Ga0318564_10232605Not Available818Open in IMG/M
3300031890|Ga0306925_11825428Not Available581Open in IMG/M
3300031910|Ga0306923_11438301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300031941|Ga0310912_10951112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300031954|Ga0306926_11506591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300031954|Ga0306926_11619978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300031954|Ga0306926_11767158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300032008|Ga0318562_10022901All Organisms → cellular organisms → Bacteria3265Open in IMG/M
3300032041|Ga0318549_10350250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300032043|Ga0318556_10683448All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300032064|Ga0318510_10230946All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300032066|Ga0318514_10505174Not Available643Open in IMG/M
3300032068|Ga0318553_10351343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300032068|Ga0318553_10768751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300032074|Ga0308173_10432653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300032076|Ga0306924_11709799All Organisms → cellular organisms → Bacteria → Terrabacteria group659Open in IMG/M
3300032089|Ga0318525_10408508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia696Open in IMG/M
3300032160|Ga0311301_12787058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300032770|Ga0335085_11444321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300032805|Ga0335078_12437762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300032828|Ga0335080_12397856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300032895|Ga0335074_11032062All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300032896|Ga0335075_10126010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3269Open in IMG/M
3300032897|Ga0335071_10896425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii835Open in IMG/M
3300034163|Ga0370515_0394193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.84%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa11.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.97%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.49%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.75%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027090Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028731Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10468753923300004092Bog Forest SoilMTTADETIQYLQWNKDVAHHDYAAASGYLSIRFGESRAQEVSEKLQKLPVITRRAN
Ga0062386_100009652103300004152Bog Forest SoilMTTPGEAIQYLQWRKDVAEHDYAAASGYLSIRFGERRAQEVSEKLRKLPVIQR
Ga0062594_10162207913300005093SoilMGTAAEPKGAETASEYLRWKKDVAQHDYTAATSYLSIRFGEIHAEKVTAELRKL
Ga0070713_10042219813300005436Corn, Switchgrass And Miscanthus RhizosphereMSVTIEAAQYLKWKRDVDQHDYAAASSYLSIRFGEGRAEKI
Ga0070761_1092760113300005591SoilMATAGEAVQYLRWRKEVADHDYAAASSYLSIRYGESRAQEVS
Ga0070763_1010898013300005610SoilMTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQEVSEKLKKLPVIQ
Ga0066903_10433831333300005764Tropical Forest SoilVNTAEVVQYLRWRKDVAHHGYAAASSYLSIRFGESRAQE
Ga0070765_10085702923300006176SoilMTTPGEAVQYLQWRKDVADHDYAAASSYLSIRYGE
Ga0116216_1083053513300009698Peatlands SoilMTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQEVSEKLRKLPV
Ga0116217_1087424423300009700Peatlands SoilMTTAGEAIQYLRWRKDVADHDYAAASSYLSIRLGESRAQELSEKLKKLP
Ga0126373_1086552723300010048Tropical Forest SoilMSTADVISYLRWKKDVAQHDYAAAASYLSIRFGESRAKQVVED
Ga0126373_1108550313300010048Tropical Forest SoilMSTSTAEAVAYVRWKKDVDTHDYAAASSYLSIRFGESRAEEV
Ga0126370_1194467613300010358Tropical Forest SoilMSNTEAVSSYLRWKKDVAVHDYAAASSYLSIRYGQGRADKVA
Ga0126377_1320129113300010362Tropical Forest SoilMGTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGDSRAQELSEKLKKLPVI
Ga0126381_10144832213300010376Tropical Forest SoilMTDTDTDTGAVQYLRWRKDVAKHDYAAASSYLSIRFGESR
Ga0126381_10373400723300010376Tropical Forest SoilMGTAGVVQYLQWKKDVAKHDYAAASSYLSIRFGDRRA
Ga0126381_10506080913300010376Tropical Forest SoilMTGKGRMTTAEAVSYLQWKRDVAKHDYAAASSYLSIR
Ga0136449_10224271023300010379Peatlands SoilMTTADETIQYLQWNKDVAHHDYAAASGYLSIRFGESRAQEVSEKLQ
Ga0136449_10325073213300010379Peatlands SoilMTTPGEAIQYLQWRKDVADHDYAAASSYLSIRHGESRAQEVS
Ga0126369_1126729013300012971Tropical Forest SoilMRTAEVIQYLQWKKEVAKHDYAAASSYLSIRFGESRAQEISEKLRK
Ga0157374_1185812213300013296Miscanthus RhizosphereMATDGGVDQYLKWDKDVAHHDYAAASNYLSIRFGEGRAQ
Ga0181525_1002549413300014654BogMSTTTEAVQYLKWKKEVAPHDYAAASSYLSIRFGESRA
Ga0157376_1039145813300014969Miscanthus RhizosphereMATDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKL
Ga0137403_1073621223300015264Vadose Zone SoilMSTPEASAYLRWKKDVDQHDYAAASSYLSIRYGESRAGKVAAERFVTGG*
Ga0182033_1047786823300016319SoilMSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESR
Ga0182038_1024845323300016445SoilMSTAEVVQYVQWKKDVAHHDYAAASSYLSVRFGESRAQEVSKKL
Ga0182038_1154233713300016445SoilMTTTAEAVSYLRWRKDVAQHDYAAATSYLSIRYGESR
Ga0187820_112605613300017924Freshwater SedimentMTTPDEAVPYLKWKKEVADHDYAAASSYLSIRYGESRAQEMS
Ga0187807_125015823300017926Freshwater SedimentMSTTTASATTTAAAVSYLRWKKDVAKHDYAAASSYLSIRFGESRAQEVVAKLEKLPVISRRAN
Ga0187814_1038707313300017932Freshwater SedimentMTTPGEAVQYLRWRKDVAEHDYAAASGYLSIRFGERRAQELSEKLRKLP
Ga0187879_1055434523300017946PeatlandMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRA
Ga0187783_1063143313300017970Tropical PeatlandMTGEAVQYVRWRKDVAAHDYAAAASYLSIRFGESRAQEVSEQLKKLPV
Ga0187783_1068851023300017970Tropical PeatlandMTSTGEAVQYLRWRKDVADHDYAAASSYLSIRYGENRA
Ga0187781_1056634323300017972Tropical PeatlandMATDEIVSYVRWRKDVADHDYAAASSYLSIRFGESRAQEVS
Ga0187780_1041707633300017973Tropical PeatlandMSTADVVQYLQWKKDVDHHDYAAASSYLSIRFGESKAEQVAAELRKLPV
Ga0187782_1143792613300017975Tropical PeatlandMTDTDTGAFQYLRWRKDVAKHDYAAAASYLSIRFGESRARELSDKLEKLQV
Ga0187869_1050111623300018030PeatlandMTTAGEAVQYLRWRKDVANHDYAAASSYLSIRFGENRA
Ga0187875_1054750913300018035PeatlandMTTTGQAVQYLRWTKDVADHDYAAASSYLSIRFGEKRAQEVSE
Ga0187855_1031693123300018038PeatlandMTTAGEAVQYLRWRKDVASHDYAAASSYLSIRFGESRAQEVSKKLRQLPVIHRRA
Ga0187765_1104180813300018060Tropical PeatlandMTDTDTDTDTGAIQYVRWRKDVAKHDYAAASSYLSIRFGDSRARELSDK
Ga0210403_1099422513300020580SoilMSTEEAVSYLHWRPDVAEHDYAAASSYLSIRFGENRAATVAAELRKL
Ga0210395_1004321613300020582SoilMSSEAVVSYLKWKKDVAEHDYAAASSYLSIRFGEHRA
Ga0210396_1130048113300021180SoilMSTEEVVSYLHWREDVAEHDYAAASSYLSIRFGEVRAATV
Ga0210396_1153456123300021180SoilMSADGAVHYLRWKKDVAEHDYAAASSYLSIRFGEGRAEKIAAELRKL
Ga0210388_1121389123300021181SoilMTVAGGAVQYLRWRKDVADHDYAAASSYLSIRFGEKRAQEVSDKL
Ga0213875_1063680613300021388Plant RootsMSTPEADSYLRWRKDVAEHDYAAASSYLSIRYGQDRADEVAAKLRKLPVIT
Ga0210387_1126479913300021405SoilMSTPAVGSYLRWKRDVAEHDYTAASSYLSIRFGQD
Ga0210386_1014050933300021406SoilMSTAETVSYLHWKKEVAEHDYAAASSYLSIRFGERRAGQVAA
Ga0210386_1045346113300021406SoilVDTAEAVSYLHWKKDVDEHDYAAASSYLSIRFGERRAGEVAAALRKLPVISRRAND
Ga0210386_1099532313300021406SoilMTTAGAAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQ
Ga0210390_1161381723300021474SoilMTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQEVSE
Ga0210398_1032990423300021477SoilMSNDTVVTYLRWRKDVADHDYAAASSYLSIRYGDDRAKEVADKLS
Ga0210409_1055000113300021559SoilMTTTEAAVQYLRWRKDVADHDYAAASSYLSIRFGESR
Ga0242676_102795523300022512SoilMTTAEAVSYLQWKKDVSHHDYVAASGYLSIRFGAGRAEKIAAELRKLP
Ga0242676_104676823300022512SoilMTPDQAVQYLRWRKDVAEHDYAAASGYLSIRFGENRA
Ga0207693_1117752523300025915Corn, Switchgrass And Miscanthus RhizosphereMTIAGEAIQYVHWKKDVANHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIHRRA
Ga0207664_1157495223300025929Agricultural SoilMGTATEPKDAASQYMRWKKDVAQHDYAAASSYLSIRF
Ga0207640_1143342513300025981Corn RhizosphereMATDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKLQKLPVMH
Ga0208604_100780223300027090Forest SoilMTTAAEAVQYLQWRKDVADHDYAAASGYLSIRFGESRAQEVSKKLQK
Ga0209114_100768033300027504Forest SoilMTSAEGAIQYLRWRKDVAEHDYAAASSYLSIRYGESRSREVSKQLRKLPVIQRRA
Ga0209530_101462213300027692Forest SoilMTTAAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSEKLKKLPVIQ
Ga0209248_1022443713300027729Bog Forest SoilMTTAGAAIQYLKWRKDVADHDYAAASSYLSIRFGESRAQ
Ga0209112_1011851123300027817Forest SoilMSTAQDDQYLHWKKDVAAADYDAASSYLSIRFGESRAAQVAAELRKLP
Ga0209693_1055920813300027855SoilMTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQ
Ga0209465_1018647923300027874Tropical Forest SoilMSTADVISYLRWKKDVAQHDYAAAASYLSIRFGESRAKQVVEDLRKLPVI
Ga0209275_1001595013300027884SoilMTTAGGGAVQYLRWRKDVADHDYAAASSYLSIRYGESRAQEVSEKLHKLPVIQR
Ga0209006_1131235123300027908Forest SoilMTTPGGAVQYLKWRKDVADHDYAAAASYLSIRYGESRAKEFSA
Ga0302301_110796513300028731PalsaMTTAGEAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPV
Ga0302219_1011934023300028747PalsaMTTAGEAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIQRR
Ga0302202_1008492013300028762BogMTTAGETIQYLRWRKDVANHDYAAASSYLSIRFGESQAQEVSEKLQKLPVIQRRAND
Ga0302225_1008118523300028780PalsaMTTAEGPVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEVSEKLKKLPVIQRRA
Ga0302226_1023760213300028801PalsaMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRYGEKRAQ
Ga0247827_1013831823300028889SoilMVTDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKLQKQQ
Ga0311340_1093980913300029943PalsaMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSAKLKKLPVIQRR
Ga0311371_1065839733300029951PalsaMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSAKLKKLP
Ga0302302_114610823300029997PalsaMTTAGEAVQYLRWRKDVADHDYAAASGYLSIRFGESRAEEVSKKL
Ga0311338_1097244213300030007PalsaMSTDAAADPYLRWRKDVAEHDYAAASSYLSIRFGEKRAGEVAA
Ga0302178_1051209613300030013PalsaMTTAVGPIQYLRWRKDVADHDYAAASSYLSIRYGESRAQEVSKKLQKLP
Ga0302181_1042930113300030056PalsaMSTNAAADPYLRWRKDVAEHDYAAASSYLSIRFGEKRAGEVA
Ga0302184_1001369673300030490PalsaMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESR
Ga0310037_1023450823300030494Peatlands SoilMTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQE
Ga0210275_1013596913300030578SoilMTAPGQAVQYLRWRKDVAEHDYAAASSYLSIRFGESRAQEVSAKLRKLP
Ga0265460_1235046713300030740SoilMTTAGAPVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSRKLQKLPVNQPPANE
Ga0302314_1134671513300030906PalsaMTTAEGPVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEVSEKLKKLPVIQR
Ga0302307_1061364613300031233PalsaMTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQE
Ga0302324_10182601023300031236PalsaMTTAEGPVQYLRWRKDVADHDYAAASSYLSIRYGESR
Ga0302324_10183765923300031236PalsaMTTAGQAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIQ
Ga0302326_1134087613300031525PalsaMTTAEGAVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEV
Ga0318516_1022306413300031543SoilMSTAEAASYLQWKKDVDQHDYAAATSYLSIRFGESKAEKVAAELRKLPV
Ga0318516_1034689013300031543SoilMTTPDAVSYLQWKKDVEHHDYAAASTYLSIRFGESRA
Ga0318534_1031286113300031544SoilMSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPVI
Ga0318534_1079434323300031544SoilMSTAEAASYLRWKKDVDHHDYAAATSYLSIRFGEGRAQQVAEELQK
Ga0318571_1014025023300031549SoilMSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKL
Ga0318542_1026483913300031668SoilMSTADAASYLRWKKDVDNHDYAAASSYLSIRFGESRAQQVAEELQKL
Ga0318542_1046017523300031668SoilMSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSE
Ga0318561_1020609413300031679SoilMSTAEIVQYLRWSKDVAHHDYAAASSYLSVSMGESRAQ
Ga0310686_10574137423300031708SoilMSTAEAVPYLHWKKEVAEHDYAAASSYLSIRFEIGRAHV
Ga0307476_1118247623300031715Hardwood Forest SoilMSTAEAVSYLRWKKDVAEHDYAAASSYLSIRFGARRAEKVAEEL
Ga0306917_1025410223300031719SoilMSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQ
Ga0318500_1066170923300031724SoilMSTAEAASYLRWKKDVDNHDYAAASSYLSIRFGESRAQQVAEELQ
Ga0318537_1031993113300031763SoilMSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEKLKKLPVIT
Ga0318546_1105341523300031771SoilMTTTAEAVSYLRWRKDVAQHDYAAATSYLSIRYGES
Ga0318543_1013947513300031777SoilMSTAEIVQYLRWSKDVAHHDYAAASSYLSVSMGESRAQEASQKLE
Ga0318566_1058660713300031779SoilMSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPV
Ga0318508_102190113300031780SoilMSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEKLKKLPVITRCAN
Ga0318547_1036100723300031781SoilMSTAEAASYLQWKKDVDPHDYAAATSYLSIRFGESKAEKVAAELRKLPVIT
Ga0318523_1030192713300031798SoilMSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESR
Ga0318497_1064299613300031805SoilMTTPDAVSYLQWKKDVEHHDYAAASTYLSIRFGESRAQKVAKDL
Ga0318568_1097595713300031819SoilMTTAEEAVQYVRWKKDVADHDYAAASSYLSIRFGE
Ga0318564_1023260513300031831SoilMSTAEVVQYVQWKKDVAHHDYAAASSYLSVRFGESRAQEVSKKLQ
Ga0306925_1182542813300031890SoilMTTPEAVSYVQWKKDVAPHDYAAASSYLSIRYGESKAQEVSAKLKKLPVIT
Ga0306923_1143830113300031910SoilMSTAEAASYLQWKKDVEHHDYDAATSYLSIRFGEKRA
Ga0310912_1095111223300031941SoilMSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEM
Ga0306926_1150659123300031954SoilMSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEELKKLPVIT
Ga0306926_1161997813300031954SoilMTDAEAVSYLQWKKDVEHHDYAAASTYLSIRFGESRAQKVAEDLQKLP
Ga0306926_1176715813300031954SoilMSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLP
Ga0318562_1002290153300032008SoilMSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQKLP
Ga0318549_1035025013300032041SoilMSTAEVVQYLQWKKDVARHDYAAASSYLSIRFGESRAQEVSEKLQKLPV
Ga0318556_1068344823300032043SoilMSTAEAASYLQWKKDVDQHDYAAATSYLSIRFGESKAEKVAAELRKVPVIT
Ga0318510_1023094613300032064SoilMSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQKLPIIT
Ga0318514_1050517413300032066SoilMSTAEILQYLRWSKDVAHHDYAAASSYLSVSMGET
Ga0318553_1035134313300032068SoilMSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQV
Ga0318553_1076875123300032068SoilMTTPTVESYLRWKKDVAEHDYTAAASYLSIRFGQD
Ga0308173_1043265313300032074SoilMSTIDISRYLRWKKDVDAHDYAAASSYLSFRFGERLAEMEAAELRKLPVITRRAND
Ga0306924_1170979913300032076SoilMSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPV
Ga0318525_1040850813300032089SoilMTTAGEAVQYLQWKKDVAHHDYAAASSYLSIRFGESRAQEVSEKLQKLP
Ga0311301_1278705823300032160Peatlands SoilMTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQ
Ga0335085_1144432113300032770SoilMTTAGEAVQYVRWKKDVADHDYAAASSYLSIRFGASRAREVSEHLQKLPIVH
Ga0335078_1243776223300032805SoilMSTTEVVQYLKWKTDVAAHDYAAASSYLSIRFGESRAEKVAAELRKLPVIT
Ga0335080_1239785613300032828SoilMTAVGEAVQYLQWKKDVDHHDYAAASSYLSIRFGEGRAQEVSDKLQK
Ga0335074_1103206213300032895SoilMTTTGDAIQYLRWRKDVADHDYAAASSYLSIRFGESHAQ
Ga0335075_1012601043300032896SoilMSTTEVVSYLRWRKDVAEHDYTAASSYLSIRYGQDQA
Ga0335071_1089642513300032897SoilMNTTDISRYLRWKKDVAAHDYAAASSYLSIRFGESRAEKAAAELRKLPIITRR
Ga0370515_0394193_448_5823300034163Untreated Peat SoilMTTAGQAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.