| Basic Information | |
|---|---|
| Family ID | F059160 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQE |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.51 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.582 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.836 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.358 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF03853 | YjeF_N | 6.72 |
| PF02308 | MgtC | 5.97 |
| PF03129 | HGTP_anticodon | 5.22 |
| PF00440 | TetR_N | 4.48 |
| PF13091 | PLDc_2 | 2.99 |
| PF02518 | HATPase_c | 2.24 |
| PF13450 | NAD_binding_8 | 1.49 |
| PF07730 | HisKA_3 | 1.49 |
| PF01028 | Topoisom_I | 1.49 |
| PF02656 | DUF202 | 1.49 |
| PF08450 | SGL | 1.49 |
| PF13413 | HTH_25 | 0.75 |
| PF02558 | ApbA | 0.75 |
| PF04672 | Methyltransf_19 | 0.75 |
| PF00916 | Sulfate_transp | 0.75 |
| PF07077 | DUF1345 | 0.75 |
| PF13424 | TPR_12 | 0.75 |
| PF01872 | RibD_C | 0.75 |
| PF09363 | XFP_C | 0.75 |
| PF00391 | PEP-utilizers | 0.75 |
| PF08044 | DUF1707 | 0.75 |
| PF07274 | DUF1440 | 0.75 |
| PF04073 | tRNA_edit | 0.75 |
| PF07690 | MFS_1 | 0.75 |
| PF13977 | TetR_C_6 | 0.75 |
| PF01544 | CorA | 0.75 |
| PF03358 | FMN_red | 0.75 |
| PF13185 | GAF_2 | 0.75 |
| PF04203 | Sortase | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF12706 | Lactamase_B_2 | 0.75 |
| PF02129 | Peptidase_S15 | 0.75 |
| PF01048 | PNP_UDP_1 | 0.75 |
| PF03176 | MMPL | 0.75 |
| PF04972 | BON | 0.75 |
| PF00535 | Glycos_transf_2 | 0.75 |
| PF03050 | DDE_Tnp_IS66 | 0.75 |
| PF00282 | Pyridoxal_deC | 0.75 |
| PF08220 | HTH_DeoR | 0.75 |
| PF00196 | GerE | 0.75 |
| PF01925 | TauE | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 6.72 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 5.97 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 5.97 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 5.22 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 5.22 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.49 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.49 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.49 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 1.49 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 1.49 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.49 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.49 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.49 |
| COG3477 | Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 family | Function unknown [S] | 0.75 |
| COG3764 | Sortase (surface protein transpeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.75 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.75 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.75 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.75 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.75 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.75 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.75 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.75 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.75 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.75 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.58 % |
| Unclassified | root | N/A | 16.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_104687539 | Not Available | 515 | Open in IMG/M |
| 3300004152|Ga0062386_100009652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium URHB0048 | 6827 | Open in IMG/M |
| 3300005093|Ga0062594_101622079 | Not Available | 671 | Open in IMG/M |
| 3300005436|Ga0070713_100422198 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005591|Ga0070761_10927601 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005610|Ga0070763_10108980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1406 | Open in IMG/M |
| 3300005764|Ga0066903_104338313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 758 | Open in IMG/M |
| 3300006176|Ga0070765_100857029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300009698|Ga0116216_10830535 | Not Available | 554 | Open in IMG/M |
| 3300009700|Ga0116217_10874244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300010048|Ga0126373_10865527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 967 | Open in IMG/M |
| 3300010048|Ga0126373_11085503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 866 | Open in IMG/M |
| 3300010358|Ga0126370_11944676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300010362|Ga0126377_13201291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300010376|Ga0126381_101448322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300010376|Ga0126381_103734007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300010376|Ga0126381_105060809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300010379|Ga0136449_102242710 | Not Available | 795 | Open in IMG/M |
| 3300010379|Ga0136449_103250732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300012971|Ga0126369_11267290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300013296|Ga0157374_11858122 | Not Available | 628 | Open in IMG/M |
| 3300014654|Ga0181525_10025494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3598 | Open in IMG/M |
| 3300014969|Ga0157376_10391458 | Not Available | 1341 | Open in IMG/M |
| 3300015264|Ga0137403_10736212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300016319|Ga0182033_10477868 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300016445|Ga0182038_10248453 | Not Available | 1429 | Open in IMG/M |
| 3300016445|Ga0182038_11542337 | Not Available | 597 | Open in IMG/M |
| 3300017924|Ga0187820_1126056 | Not Available | 755 | Open in IMG/M |
| 3300017926|Ga0187807_1250158 | Not Available | 581 | Open in IMG/M |
| 3300017932|Ga0187814_10387073 | Not Available | 543 | Open in IMG/M |
| 3300017946|Ga0187879_10554345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300017970|Ga0187783_10631433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
| 3300017970|Ga0187783_10688510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300017972|Ga0187781_10566343 | Not Available | 818 | Open in IMG/M |
| 3300017973|Ga0187780_10417076 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300017975|Ga0187782_11437926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300018030|Ga0187869_10501116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300018035|Ga0187875_10547509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300018038|Ga0187855_10316931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 912 | Open in IMG/M |
| 3300018060|Ga0187765_11041808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300020580|Ga0210403_10994225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300020582|Ga0210395_10043216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3298 | Open in IMG/M |
| 3300021180|Ga0210396_11300481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300021180|Ga0210396_11534561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300021181|Ga0210388_11213891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300021388|Ga0213875_10636806 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300021405|Ga0210387_11264799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300021406|Ga0210386_10140509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2013 | Open in IMG/M |
| 3300021406|Ga0210386_10453461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
| 3300021406|Ga0210386_10995323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300021474|Ga0210390_11613817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300021477|Ga0210398_10329904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1244 | Open in IMG/M |
| 3300021559|Ga0210409_10550001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
| 3300022512|Ga0242676_1027955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300022512|Ga0242676_1046768 | Not Available | 530 | Open in IMG/M |
| 3300025915|Ga0207693_11177525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300025929|Ga0207664_11574952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300025981|Ga0207640_11433425 | Not Available | 619 | Open in IMG/M |
| 3300027090|Ga0208604_1007802 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300027504|Ga0209114_1007680 | Not Available | 1597 | Open in IMG/M |
| 3300027692|Ga0209530_1014622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2403 | Open in IMG/M |
| 3300027729|Ga0209248_10224437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300027817|Ga0209112_10118511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300027855|Ga0209693_10559208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300027874|Ga0209465_10186479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1034 | Open in IMG/M |
| 3300027884|Ga0209275_10015950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3295 | Open in IMG/M |
| 3300027908|Ga0209006_11312351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300028731|Ga0302301_1107965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300028747|Ga0302219_10119340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
| 3300028762|Ga0302202_10084920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1867 | Open in IMG/M |
| 3300028780|Ga0302225_10081185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1592 | Open in IMG/M |
| 3300028801|Ga0302226_10237602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300028889|Ga0247827_10138318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300029943|Ga0311340_10939809 | Not Available | 715 | Open in IMG/M |
| 3300029951|Ga0311371_10658397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1328 | Open in IMG/M |
| 3300029997|Ga0302302_1146108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
| 3300030007|Ga0311338_10972442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300030013|Ga0302178_10512096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300030056|Ga0302181_10429301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300030490|Ga0302184_10013696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4576 | Open in IMG/M |
| 3300030494|Ga0310037_10234508 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300030578|Ga0210275_10135969 | Not Available | 720 | Open in IMG/M |
| 3300030740|Ga0265460_12350467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300030906|Ga0302314_11346715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300031233|Ga0302307_10613646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300031236|Ga0302324_101826010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300031236|Ga0302324_101837659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300031525|Ga0302326_11340876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 971 | Open in IMG/M |
| 3300031543|Ga0318516_10223064 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300031543|Ga0318516_10346890 | Not Available | 857 | Open in IMG/M |
| 3300031544|Ga0318534_10312861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300031544|Ga0318534_10794343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300031549|Ga0318571_10140250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 827 | Open in IMG/M |
| 3300031668|Ga0318542_10264839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300031668|Ga0318542_10460175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300031679|Ga0318561_10206094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1067 | Open in IMG/M |
| 3300031708|Ga0310686_105741374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis | 723 | Open in IMG/M |
| 3300031715|Ga0307476_11182476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300031719|Ga0306917_10254102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300031724|Ga0318500_10661709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300031763|Ga0318537_10319931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300031771|Ga0318546_11053415 | Not Available | 572 | Open in IMG/M |
| 3300031777|Ga0318543_10139475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1061 | Open in IMG/M |
| 3300031779|Ga0318566_10586607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
| 3300031780|Ga0318508_1021901 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300031781|Ga0318547_10361007 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031798|Ga0318523_10301927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300031805|Ga0318497_10642996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300031819|Ga0318568_10975957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300031831|Ga0318564_10232605 | Not Available | 818 | Open in IMG/M |
| 3300031890|Ga0306925_11825428 | Not Available | 581 | Open in IMG/M |
| 3300031910|Ga0306923_11438301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300031941|Ga0310912_10951112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300031954|Ga0306926_11506591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300031954|Ga0306926_11619978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300031954|Ga0306926_11767158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300032008|Ga0318562_10022901 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300032041|Ga0318549_10350250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300032043|Ga0318556_10683448 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032064|Ga0318510_10230946 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032066|Ga0318514_10505174 | Not Available | 643 | Open in IMG/M |
| 3300032068|Ga0318553_10351343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300032068|Ga0318553_10768751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300032074|Ga0308173_10432653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300032076|Ga0306924_11709799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
| 3300032089|Ga0318525_10408508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 696 | Open in IMG/M |
| 3300032160|Ga0311301_12787058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300032770|Ga0335085_11444321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300032805|Ga0335078_12437762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300032828|Ga0335080_12397856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300032895|Ga0335074_11032062 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300032896|Ga0335075_10126010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3269 | Open in IMG/M |
| 3300032897|Ga0335071_10896425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 835 | Open in IMG/M |
| 3300034163|Ga0370515_0394193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.84% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 11.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.75% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1046875392 | 3300004092 | Bog Forest Soil | MTTADETIQYLQWNKDVAHHDYAAASGYLSIRFGESRAQEVSEKLQKLPVITRRAN |
| Ga0062386_10000965210 | 3300004152 | Bog Forest Soil | MTTPGEAIQYLQWRKDVAEHDYAAASGYLSIRFGERRAQEVSEKLRKLPVIQR |
| Ga0062594_1016220791 | 3300005093 | Soil | MGTAAEPKGAETASEYLRWKKDVAQHDYTAATSYLSIRFGEIHAEKVTAELRKL |
| Ga0070713_1004221981 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVTIEAAQYLKWKRDVDQHDYAAASSYLSIRFGEGRAEKI |
| Ga0070761_109276011 | 3300005591 | Soil | MATAGEAVQYLRWRKEVADHDYAAASSYLSIRYGESRAQEVS |
| Ga0070763_101089801 | 3300005610 | Soil | MTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQEVSEKLKKLPVIQ |
| Ga0066903_1043383133 | 3300005764 | Tropical Forest Soil | VNTAEVVQYLRWRKDVAHHGYAAASSYLSIRFGESRAQE |
| Ga0070765_1008570292 | 3300006176 | Soil | MTTPGEAVQYLQWRKDVADHDYAAASSYLSIRYGE |
| Ga0116216_108305351 | 3300009698 | Peatlands Soil | MTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQEVSEKLRKLPV |
| Ga0116217_108742442 | 3300009700 | Peatlands Soil | MTTAGEAIQYLRWRKDVADHDYAAASSYLSIRLGESRAQELSEKLKKLP |
| Ga0126373_108655272 | 3300010048 | Tropical Forest Soil | MSTADVISYLRWKKDVAQHDYAAAASYLSIRFGESRAKQVVED |
| Ga0126373_110855031 | 3300010048 | Tropical Forest Soil | MSTSTAEAVAYVRWKKDVDTHDYAAASSYLSIRFGESRAEEV |
| Ga0126370_119446761 | 3300010358 | Tropical Forest Soil | MSNTEAVSSYLRWKKDVAVHDYAAASSYLSIRYGQGRADKVA |
| Ga0126377_132012911 | 3300010362 | Tropical Forest Soil | MGTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGDSRAQELSEKLKKLPVI |
| Ga0126381_1014483221 | 3300010376 | Tropical Forest Soil | MTDTDTDTGAVQYLRWRKDVAKHDYAAASSYLSIRFGESR |
| Ga0126381_1037340072 | 3300010376 | Tropical Forest Soil | MGTAGVVQYLQWKKDVAKHDYAAASSYLSIRFGDRRA |
| Ga0126381_1050608091 | 3300010376 | Tropical Forest Soil | MTGKGRMTTAEAVSYLQWKRDVAKHDYAAASSYLSIR |
| Ga0136449_1022427102 | 3300010379 | Peatlands Soil | MTTADETIQYLQWNKDVAHHDYAAASGYLSIRFGESRAQEVSEKLQ |
| Ga0136449_1032507321 | 3300010379 | Peatlands Soil | MTTPGEAIQYLQWRKDVADHDYAAASSYLSIRHGESRAQEVS |
| Ga0126369_112672901 | 3300012971 | Tropical Forest Soil | MRTAEVIQYLQWKKEVAKHDYAAASSYLSIRFGESRAQEISEKLRK |
| Ga0157374_118581221 | 3300013296 | Miscanthus Rhizosphere | MATDGGVDQYLKWDKDVAHHDYAAASNYLSIRFGEGRAQ |
| Ga0181525_100254941 | 3300014654 | Bog | MSTTTEAVQYLKWKKEVAPHDYAAASSYLSIRFGESRA |
| Ga0157376_103914581 | 3300014969 | Miscanthus Rhizosphere | MATDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKL |
| Ga0137403_107362122 | 3300015264 | Vadose Zone Soil | MSTPEASAYLRWKKDVDQHDYAAASSYLSIRYGESRAGKVAAERFVTGG* |
| Ga0182033_104778682 | 3300016319 | Soil | MSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESR |
| Ga0182038_102484532 | 3300016445 | Soil | MSTAEVVQYVQWKKDVAHHDYAAASSYLSVRFGESRAQEVSKKL |
| Ga0182038_115423371 | 3300016445 | Soil | MTTTAEAVSYLRWRKDVAQHDYAAATSYLSIRYGESR |
| Ga0187820_11260561 | 3300017924 | Freshwater Sediment | MTTPDEAVPYLKWKKEVADHDYAAASSYLSIRYGESRAQEMS |
| Ga0187807_12501582 | 3300017926 | Freshwater Sediment | MSTTTASATTTAAAVSYLRWKKDVAKHDYAAASSYLSIRFGESRAQEVVAKLEKLPVISRRAN |
| Ga0187814_103870731 | 3300017932 | Freshwater Sediment | MTTPGEAVQYLRWRKDVAEHDYAAASGYLSIRFGERRAQELSEKLRKLP |
| Ga0187879_105543452 | 3300017946 | Peatland | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRA |
| Ga0187783_106314331 | 3300017970 | Tropical Peatland | MTGEAVQYVRWRKDVAAHDYAAAASYLSIRFGESRAQEVSEQLKKLPV |
| Ga0187783_106885102 | 3300017970 | Tropical Peatland | MTSTGEAVQYLRWRKDVADHDYAAASSYLSIRYGENRA |
| Ga0187781_105663432 | 3300017972 | Tropical Peatland | MATDEIVSYVRWRKDVADHDYAAASSYLSIRFGESRAQEVS |
| Ga0187780_104170763 | 3300017973 | Tropical Peatland | MSTADVVQYLQWKKDVDHHDYAAASSYLSIRFGESKAEQVAAELRKLPV |
| Ga0187782_114379261 | 3300017975 | Tropical Peatland | MTDTDTGAFQYLRWRKDVAKHDYAAAASYLSIRFGESRARELSDKLEKLQV |
| Ga0187869_105011162 | 3300018030 | Peatland | MTTAGEAVQYLRWRKDVANHDYAAASSYLSIRFGENRA |
| Ga0187875_105475091 | 3300018035 | Peatland | MTTTGQAVQYLRWTKDVADHDYAAASSYLSIRFGEKRAQEVSE |
| Ga0187855_103169312 | 3300018038 | Peatland | MTTAGEAVQYLRWRKDVASHDYAAASSYLSIRFGESRAQEVSKKLRQLPVIHRRA |
| Ga0187765_110418081 | 3300018060 | Tropical Peatland | MTDTDTDTDTGAIQYVRWRKDVAKHDYAAASSYLSIRFGDSRARELSDK |
| Ga0210403_109942251 | 3300020580 | Soil | MSTEEAVSYLHWRPDVAEHDYAAASSYLSIRFGENRAATVAAELRKL |
| Ga0210395_100432161 | 3300020582 | Soil | MSSEAVVSYLKWKKDVAEHDYAAASSYLSIRFGEHRA |
| Ga0210396_113004811 | 3300021180 | Soil | MSTEEVVSYLHWREDVAEHDYAAASSYLSIRFGEVRAATV |
| Ga0210396_115345612 | 3300021180 | Soil | MSADGAVHYLRWKKDVAEHDYAAASSYLSIRFGEGRAEKIAAELRKL |
| Ga0210388_112138912 | 3300021181 | Soil | MTVAGGAVQYLRWRKDVADHDYAAASSYLSIRFGEKRAQEVSDKL |
| Ga0213875_106368061 | 3300021388 | Plant Roots | MSTPEADSYLRWRKDVAEHDYAAASSYLSIRYGQDRADEVAAKLRKLPVIT |
| Ga0210387_112647991 | 3300021405 | Soil | MSTPAVGSYLRWKRDVAEHDYTAASSYLSIRFGQD |
| Ga0210386_101405093 | 3300021406 | Soil | MSTAETVSYLHWKKEVAEHDYAAASSYLSIRFGERRAGQVAA |
| Ga0210386_104534611 | 3300021406 | Soil | VDTAEAVSYLHWKKDVDEHDYAAASSYLSIRFGERRAGEVAAALRKLPVISRRAND |
| Ga0210386_109953231 | 3300021406 | Soil | MTTAGAAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQ |
| Ga0210390_116138172 | 3300021474 | Soil | MTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQEVSE |
| Ga0210398_103299042 | 3300021477 | Soil | MSNDTVVTYLRWRKDVADHDYAAASSYLSIRYGDDRAKEVADKLS |
| Ga0210409_105500011 | 3300021559 | Soil | MTTTEAAVQYLRWRKDVADHDYAAASSYLSIRFGESR |
| Ga0242676_10279552 | 3300022512 | Soil | MTTAEAVSYLQWKKDVSHHDYVAASGYLSIRFGAGRAEKIAAELRKLP |
| Ga0242676_10467682 | 3300022512 | Soil | MTPDQAVQYLRWRKDVAEHDYAAASGYLSIRFGENRA |
| Ga0207693_111775252 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTIAGEAIQYVHWKKDVANHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIHRRA |
| Ga0207664_115749522 | 3300025929 | Agricultural Soil | MGTATEPKDAASQYMRWKKDVAQHDYAAASSYLSIRF |
| Ga0207640_114334251 | 3300025981 | Corn Rhizosphere | MATDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKLQKLPVMH |
| Ga0208604_10078022 | 3300027090 | Forest Soil | MTTAAEAVQYLQWRKDVADHDYAAASGYLSIRFGESRAQEVSKKLQK |
| Ga0209114_10076803 | 3300027504 | Forest Soil | MTSAEGAIQYLRWRKDVAEHDYAAASSYLSIRYGESRSREVSKQLRKLPVIQRRA |
| Ga0209530_10146221 | 3300027692 | Forest Soil | MTTAAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSEKLKKLPVIQ |
| Ga0209248_102244371 | 3300027729 | Bog Forest Soil | MTTAGAAIQYLKWRKDVADHDYAAASSYLSIRFGESRAQ |
| Ga0209112_101185112 | 3300027817 | Forest Soil | MSTAQDDQYLHWKKDVAAADYDAASSYLSIRFGESRAAQVAAELRKLP |
| Ga0209693_105592081 | 3300027855 | Soil | MTTAGGAVQYLRWRKDVADHDYEAASSYLSIRYGEKRAQ |
| Ga0209465_101864792 | 3300027874 | Tropical Forest Soil | MSTADVISYLRWKKDVAQHDYAAAASYLSIRFGESRAKQVVEDLRKLPVI |
| Ga0209275_100159501 | 3300027884 | Soil | MTTAGGGAVQYLRWRKDVADHDYAAASSYLSIRYGESRAQEVSEKLHKLPVIQR |
| Ga0209006_113123512 | 3300027908 | Forest Soil | MTTPGGAVQYLKWRKDVADHDYAAAASYLSIRYGESRAKEFSA |
| Ga0302301_11079651 | 3300028731 | Palsa | MTTAGEAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPV |
| Ga0302219_101193402 | 3300028747 | Palsa | MTTAGEAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIQRR |
| Ga0302202_100849201 | 3300028762 | Bog | MTTAGETIQYLRWRKDVANHDYAAASSYLSIRFGESQAQEVSEKLQKLPVIQRRAND |
| Ga0302225_100811852 | 3300028780 | Palsa | MTTAEGPVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEVSEKLKKLPVIQRRA |
| Ga0302226_102376021 | 3300028801 | Palsa | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRYGEKRAQ |
| Ga0247827_101383182 | 3300028889 | Soil | MVTDRETGQYLRWEKDVAQHDYAAATNYLSIRFGEDRAQEVSKKLQKQQ |
| Ga0311340_109398091 | 3300029943 | Palsa | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSAKLKKLPVIQRR |
| Ga0311371_106583973 | 3300029951 | Palsa | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSAKLKKLP |
| Ga0302302_11461082 | 3300029997 | Palsa | MTTAGEAVQYLRWRKDVADHDYAAASGYLSIRFGESRAEEVSKKL |
| Ga0311338_109724421 | 3300030007 | Palsa | MSTDAAADPYLRWRKDVAEHDYAAASSYLSIRFGEKRAGEVAA |
| Ga0302178_105120961 | 3300030013 | Palsa | MTTAVGPIQYLRWRKDVADHDYAAASSYLSIRYGESRAQEVSKKLQKLP |
| Ga0302181_104293011 | 3300030056 | Palsa | MSTNAAADPYLRWRKDVAEHDYAAASSYLSIRFGEKRAGEVA |
| Ga0302184_100136967 | 3300030490 | Palsa | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESR |
| Ga0310037_102345082 | 3300030494 | Peatlands Soil | MTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQE |
| Ga0210275_101359691 | 3300030578 | Soil | MTAPGQAVQYLRWRKDVAEHDYAAASSYLSIRFGESRAQEVSAKLRKLP |
| Ga0265460_123504671 | 3300030740 | Soil | MTTAGAPVQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSRKLQKLPVNQPPANE |
| Ga0302314_113467151 | 3300030906 | Palsa | MTTAEGPVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEVSEKLKKLPVIQR |
| Ga0302307_106136461 | 3300031233 | Palsa | MTTAGGAVQYLRWRKDVADHDYAAASSYLSIRFGESRAQE |
| Ga0302324_1018260102 | 3300031236 | Palsa | MTTAEGPVQYLRWRKDVADHDYAAASSYLSIRYGESR |
| Ga0302324_1018376592 | 3300031236 | Palsa | MTTAGQAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKLQKLPVIQ |
| Ga0302326_113408761 | 3300031525 | Palsa | MTTAEGAVQYLRWRKDVAGHDYAAASSYLSIRFGEKRAEEV |
| Ga0318516_102230641 | 3300031543 | Soil | MSTAEAASYLQWKKDVDQHDYAAATSYLSIRFGESKAEKVAAELRKLPV |
| Ga0318516_103468901 | 3300031543 | Soil | MTTPDAVSYLQWKKDVEHHDYAAASTYLSIRFGESRA |
| Ga0318534_103128611 | 3300031544 | Soil | MSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPVI |
| Ga0318534_107943432 | 3300031544 | Soil | MSTAEAASYLRWKKDVDHHDYAAATSYLSIRFGEGRAQQVAEELQK |
| Ga0318571_101402502 | 3300031549 | Soil | MSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKL |
| Ga0318542_102648391 | 3300031668 | Soil | MSTADAASYLRWKKDVDNHDYAAASSYLSIRFGESRAQQVAEELQKL |
| Ga0318542_104601752 | 3300031668 | Soil | MSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSE |
| Ga0318561_102060941 | 3300031679 | Soil | MSTAEIVQYLRWSKDVAHHDYAAASSYLSVSMGESRAQ |
| Ga0310686_1057413742 | 3300031708 | Soil | MSTAEAVPYLHWKKEVAEHDYAAASSYLSIRFEIGRAHV |
| Ga0307476_111824762 | 3300031715 | Hardwood Forest Soil | MSTAEAVSYLRWKKDVAEHDYAAASSYLSIRFGARRAEKVAEEL |
| Ga0306917_102541022 | 3300031719 | Soil | MSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQ |
| Ga0318500_106617092 | 3300031724 | Soil | MSTAEAASYLRWKKDVDNHDYAAASSYLSIRFGESRAQQVAEELQ |
| Ga0318537_103199311 | 3300031763 | Soil | MSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEKLKKLPVIT |
| Ga0318546_110534152 | 3300031771 | Soil | MTTTAEAVSYLRWRKDVAQHDYAAATSYLSIRYGES |
| Ga0318543_101394751 | 3300031777 | Soil | MSTAEIVQYLRWSKDVAHHDYAAASSYLSVSMGESRAQEASQKLE |
| Ga0318566_105866071 | 3300031779 | Soil | MSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPV |
| Ga0318508_10219011 | 3300031780 | Soil | MSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEKLKKLPVITRCAN |
| Ga0318547_103610072 | 3300031781 | Soil | MSTAEAASYLQWKKDVDPHDYAAATSYLSIRFGESKAEKVAAELRKLPVIT |
| Ga0318523_103019271 | 3300031798 | Soil | MSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESR |
| Ga0318497_106429961 | 3300031805 | Soil | MTTPDAVSYLQWKKDVEHHDYAAASTYLSIRFGESRAQKVAKDL |
| Ga0318568_109759571 | 3300031819 | Soil | MTTAEEAVQYVRWKKDVADHDYAAASSYLSIRFGE |
| Ga0318564_102326051 | 3300031831 | Soil | MSTAEVVQYVQWKKDVAHHDYAAASSYLSVRFGESRAQEVSKKLQ |
| Ga0306925_118254281 | 3300031890 | Soil | MTTPEAVSYVQWKKDVAPHDYAAASSYLSIRYGESKAQEVSAKLKKLPVIT |
| Ga0306923_114383011 | 3300031910 | Soil | MSTAEAASYLQWKKDVEHHDYDAATSYLSIRFGEKRA |
| Ga0310912_109511122 | 3300031941 | Soil | MSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEM |
| Ga0306926_115065912 | 3300031954 | Soil | MSTAEVVQYLQWKKDVAKHDYAAASSYLSIRFGESRAQEMSEELKKLPVIT |
| Ga0306926_116199781 | 3300031954 | Soil | MTDAEAVSYLQWKKDVEHHDYAAASTYLSIRFGESRAQKVAEDLQKLP |
| Ga0306926_117671581 | 3300031954 | Soil | MSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLP |
| Ga0318562_100229015 | 3300032008 | Soil | MSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQKLP |
| Ga0318549_103502501 | 3300032041 | Soil | MSTAEVVQYLQWKKDVARHDYAAASSYLSIRFGESRAQEVSEKLQKLPV |
| Ga0318556_106834482 | 3300032043 | Soil | MSTAEAASYLQWKKDVDQHDYAAATSYLSIRFGESKAEKVAAELRKVPVIT |
| Ga0318510_102309461 | 3300032064 | Soil | MSTAEVVQYVRWKKHVAHHDYAAASSYLSVRFGESRAQEVSEKLQKLPIIT |
| Ga0318514_105051741 | 3300032066 | Soil | MSTAEILQYLRWSKDVAHHDYAAASSYLSVSMGET |
| Ga0318553_103513431 | 3300032068 | Soil | MSTAEGASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQV |
| Ga0318553_107687512 | 3300032068 | Soil | MTTPTVESYLRWKKDVAEHDYTAAASYLSIRFGQD |
| Ga0308173_104326531 | 3300032074 | Soil | MSTIDISRYLRWKKDVDAHDYAAASSYLSFRFGERLAEMEAAELRKLPVITRRAND |
| Ga0306924_117097991 | 3300032076 | Soil | MSTAEAASYLRWKKDVDQHDYAAASSYLSIRFGESRAQQVAEELQKLPV |
| Ga0318525_104085081 | 3300032089 | Soil | MTTAGEAVQYLQWKKDVAHHDYAAASSYLSIRFGESRAQEVSEKLQKLP |
| Ga0311301_127870582 | 3300032160 | Peatlands Soil | MTTADGTIQYLQWKKDVADHDYAAASGYLSIRFGESRAQ |
| Ga0335085_114443211 | 3300032770 | Soil | MTTAGEAVQYVRWKKDVADHDYAAASSYLSIRFGASRAREVSEHLQKLPIVH |
| Ga0335078_124377622 | 3300032805 | Soil | MSTTEVVQYLKWKTDVAAHDYAAASSYLSIRFGESRAEKVAAELRKLPVIT |
| Ga0335080_123978561 | 3300032828 | Soil | MTAVGEAVQYLQWKKDVDHHDYAAASSYLSIRFGEGRAQEVSDKLQK |
| Ga0335074_110320621 | 3300032895 | Soil | MTTTGDAIQYLRWRKDVADHDYAAASSYLSIRFGESHAQ |
| Ga0335075_101260104 | 3300032896 | Soil | MSTTEVVSYLRWRKDVAEHDYTAASSYLSIRYGQDQA |
| Ga0335071_108964251 | 3300032897 | Soil | MNTTDISRYLRWKKDVAAHDYAAASSYLSIRFGESRAEKAAAELRKLPIITRR |
| Ga0370515_0394193_448_582 | 3300034163 | Untreated Peat Soil | MTTAGQAIQYLRWRKDVADHDYAAASSYLSIRFGESRAQEVSKKL |
| ⦗Top⦘ |