| Basic Information | |
|---|---|
| Family ID | F059119 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 51 residues |
| Representative Sequence | LLELIILVLTIYWLLSFFGQSIVPGFAHAGGFIDMLSVVIVVLIIVKFLS |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.47 % |
| % of genes near scaffold ends (potentially truncated) | 41.79 % |
| % of genes from short scaffolds (< 2000 bps) | 76.87 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.910 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.687 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.657 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (26.866 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.69% β-sheet: 0.00% Coil/Unstructured: 42.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF04972 | BON | 31.34 |
| PF12732 | YtxH | 23.13 |
| PF04226 | Transgly_assoc | 4.48 |
| PF01694 | Rhomboid | 4.48 |
| PF02325 | YGGT | 2.99 |
| PF00072 | Response_reg | 1.49 |
| PF01594 | AI-2E_transport | 1.49 |
| PF02589 | LUD_dom | 1.49 |
| PF02397 | Bac_transf | 0.75 |
| PF14721 | AIF_C | 0.75 |
| PF05532 | CsbD | 0.75 |
| PF00571 | CBS | 0.75 |
| PF12698 | ABC2_membrane_3 | 0.75 |
| PF00702 | Hydrolase | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 4.48 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 4.48 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 2.99 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.49 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.91 % |
| Unclassified | root | N/A | 32.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_11141331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1410 | Open in IMG/M |
| 2228664021|ICCgaii200_c0476257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 751 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10182230 | Not Available | 537 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1042999 | Not Available | 1104 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11262279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1578 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11483539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3936 | Open in IMG/M |
| 3300000559|F14TC_106782097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 741 | Open in IMG/M |
| 3300000787|JGI11643J11755_11612649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
| 3300000787|JGI11643J11755_11791852 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300002024|MIS_1089436 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300002026|MIS_10007163 | All Organisms → cellular organisms → Bacteria | 12083 | Open in IMG/M |
| 3300002026|MIS_10014989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8174 | Open in IMG/M |
| 3300002124|C687J26631_10014184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2830 | Open in IMG/M |
| 3300003997|Ga0055466_10079360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
| 3300003999|Ga0055469_10005141 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
| 3300004013|Ga0055465_10178137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 688 | Open in IMG/M |
| 3300004114|Ga0062593_100338138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1308 | Open in IMG/M |
| 3300004157|Ga0062590_101435906 | Not Available | 688 | Open in IMG/M |
| 3300004282|Ga0066599_101110971 | Not Available | 584 | Open in IMG/M |
| 3300004282|Ga0066599_101334440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Oceanimonas → Oceanimonas doudoroffii | 543 | Open in IMG/M |
| 3300004643|Ga0062591_100164824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1570 | Open in IMG/M |
| 3300004643|Ga0062591_102031079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300004778|Ga0062383_10195924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
| 3300004779|Ga0062380_10246130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 739 | Open in IMG/M |
| 3300004780|Ga0062378_10115549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 678 | Open in IMG/M |
| 3300004782|Ga0062382_10512597 | Not Available | 578 | Open in IMG/M |
| 3300005093|Ga0062594_102082301 | Not Available | 609 | Open in IMG/M |
| 3300005289|Ga0065704_10720962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300005293|Ga0065715_10131036 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300005294|Ga0065705_10003262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9044 | Open in IMG/M |
| 3300005294|Ga0065705_10376780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 894 | Open in IMG/M |
| 3300005295|Ga0065707_10518336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
| 3300005295|Ga0065707_11058584 | Not Available | 525 | Open in IMG/M |
| 3300005343|Ga0070687_101323924 | Not Available | 536 | Open in IMG/M |
| 3300005471|Ga0070698_100619298 | Not Available | 1023 | Open in IMG/M |
| 3300005518|Ga0070699_100008006 | All Organisms → cellular organisms → Bacteria | 9176 | Open in IMG/M |
| 3300005518|Ga0070699_100775233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 877 | Open in IMG/M |
| 3300005827|Ga0074478_1276786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5 | 1856 | Open in IMG/M |
| 3300005829|Ga0074479_10905305 | All Organisms → cellular organisms → Bacteria | 39119 | Open in IMG/M |
| 3300005833|Ga0074472_11016877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2565 | Open in IMG/M |
| 3300006194|Ga0075427_10105255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
| 3300006224|Ga0079037_101252426 | Not Available | 738 | Open in IMG/M |
| 3300006844|Ga0075428_100129335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2748 | Open in IMG/M |
| 3300006844|Ga0075428_100931695 | Not Available | 921 | Open in IMG/M |
| 3300006845|Ga0075421_101251034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 825 | Open in IMG/M |
| 3300006846|Ga0075430_101127594 | Not Available | 646 | Open in IMG/M |
| 3300006847|Ga0075431_101035399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 787 | Open in IMG/M |
| 3300006847|Ga0075431_101386725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 663 | Open in IMG/M |
| 3300006852|Ga0075433_11142663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
| 3300006853|Ga0075420_100652112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 908 | Open in IMG/M |
| 3300006865|Ga0073934_10115576 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300006876|Ga0079217_11013209 | Not Available | 609 | Open in IMG/M |
| 3300006880|Ga0075429_100335776 | Not Available | 1323 | Open in IMG/M |
| 3300006880|Ga0075429_100617541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 950 | Open in IMG/M |
| 3300006894|Ga0079215_10970549 | Not Available | 620 | Open in IMG/M |
| 3300006954|Ga0079219_10245928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1059 | Open in IMG/M |
| 3300006954|Ga0079219_12112211 | Not Available | 539 | Open in IMG/M |
| 3300006969|Ga0075419_10162636 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300007004|Ga0079218_10045844 | All Organisms → cellular organisms → Bacteria | 2676 | Open in IMG/M |
| 3300007004|Ga0079218_11767984 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009009|Ga0105105_10095404 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300009009|Ga0105105_10152827 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300009009|Ga0105105_10256206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
| 3300009009|Ga0105105_11011622 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300009100|Ga0075418_11644392 | Not Available | 698 | Open in IMG/M |
| 3300009100|Ga0075418_13055686 | Not Available | 510 | Open in IMG/M |
| 3300009131|Ga0115027_11713430 | Not Available | 523 | Open in IMG/M |
| 3300009157|Ga0105092_10268958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 959 | Open in IMG/M |
| 3300009162|Ga0075423_10185706 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300009165|Ga0105102_10385874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 742 | Open in IMG/M |
| 3300009166|Ga0105100_10937535 | Not Available | 541 | Open in IMG/M |
| 3300009168|Ga0105104_10173516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1169 | Open in IMG/M |
| 3300009171|Ga0105101_10004827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6209 | Open in IMG/M |
| 3300010040|Ga0126308_10960595 | Not Available | 597 | Open in IMG/M |
| 3300010138|Ga0115595_1192514 | Not Available | 516 | Open in IMG/M |
| 3300010357|Ga0116249_11222068 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010399|Ga0134127_10208316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1823 | Open in IMG/M |
| 3300010399|Ga0134127_10381955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1387 | Open in IMG/M |
| 3300010399|Ga0134127_10716460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1042 | Open in IMG/M |
| 3300010403|Ga0134123_10033795 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
| 3300011419|Ga0137446_1072126 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300012174|Ga0137338_1077479 | Not Available | 721 | Open in IMG/M |
| 3300015079|Ga0167657_1013154 | Not Available | 1125 | Open in IMG/M |
| 3300015372|Ga0132256_101599042 | Not Available | 762 | Open in IMG/M |
| 3300018031|Ga0184634_10505044 | Not Available | 539 | Open in IMG/M |
| 3300018051|Ga0184620_10170363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
| 3300018059|Ga0184615_10234118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1030 | Open in IMG/M |
| 3300020003|Ga0193739_1136501 | Not Available | 598 | Open in IMG/M |
| 3300020048|Ga0207193_1013034 | All Organisms → cellular organisms → Bacteria | 11305 | Open in IMG/M |
| 3300020048|Ga0207193_1054477 | All Organisms → cellular organisms → Bacteria | 4127 | Open in IMG/M |
| 3300020067|Ga0180109_1388208 | Not Available | 682 | Open in IMG/M |
| 3300021090|Ga0210377_10134499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1626 | Open in IMG/M |
| 3300021090|Ga0210377_10174040 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300021445|Ga0182009_10741019 | Not Available | 534 | Open in IMG/M |
| 3300022185|Ga0079039_1158781 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300022185|Ga0079039_1331924 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300024056|Ga0124853_1370425 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300025310|Ga0209172_10031796 | All Organisms → cellular organisms → Bacteria | 3500 | Open in IMG/M |
| 3300025313|Ga0209431_10317317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1216 | Open in IMG/M |
| 3300025318|Ga0209519_10415878 | Not Available | 766 | Open in IMG/M |
| 3300025326|Ga0209342_10959707 | Not Available | 656 | Open in IMG/M |
| 3300025327|Ga0209751_10292596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1374 | Open in IMG/M |
| 3300025918|Ga0207662_10206500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1274 | Open in IMG/M |
| 3300025936|Ga0207670_10350146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1169 | Open in IMG/M |
| 3300025942|Ga0207689_10716470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 844 | Open in IMG/M |
| 3300027543|Ga0209999_1071150 | Not Available | 667 | Open in IMG/M |
| 3300027723|Ga0209703_1311821 | Not Available | 556 | Open in IMG/M |
| 3300027743|Ga0209593_10090184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1136 | Open in IMG/M |
| 3300027762|Ga0209288_10300701 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300027775|Ga0209177_10326741 | Not Available | 593 | Open in IMG/M |
| 3300027792|Ga0209287_10171119 | Not Available | 826 | Open in IMG/M |
| 3300027880|Ga0209481_10064104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1725 | Open in IMG/M |
| 3300027880|Ga0209481_10439334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 671 | Open in IMG/M |
| 3300027886|Ga0209486_10032627 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300027952|Ga0209889_1095780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300028649|Ga0302162_10005424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2879 | Open in IMG/M |
| 3300030571|Ga0247652_1134661 | Not Available | 583 | Open in IMG/M |
| 3300030987|Ga0308155_1006952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 846 | Open in IMG/M |
| 3300031228|Ga0299914_10019773 | All Organisms → cellular organisms → Bacteria | 5432 | Open in IMG/M |
| 3300032002|Ga0307416_101697701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 736 | Open in IMG/M |
| 3300032005|Ga0307411_11530478 | Not Available | 614 | Open in IMG/M |
| 3300032173|Ga0315268_10008728 | All Organisms → cellular organisms → Bacteria | 10556 | Open in IMG/M |
| 3300032173|Ga0315268_10513031 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300032173|Ga0315268_11872400 | Not Available | 613 | Open in IMG/M |
| 3300032420|Ga0335397_10002441 | All Organisms → cellular organisms → Bacteria | 25322 | Open in IMG/M |
| 3300033420|Ga0316608_1011603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2840 | Open in IMG/M |
| 3300033482|Ga0316627_100621551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 988 | Open in IMG/M |
| 3300033482|Ga0316627_101509666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 680 | Open in IMG/M |
| 3300033485|Ga0316626_10811740 | Not Available | 821 | Open in IMG/M |
| 3300033487|Ga0316630_11625193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
| 3300033489|Ga0299912_11120526 | Not Available | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.70% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.99% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.99% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.24% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 2.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.24% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.24% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.49% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.49% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 1.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.49% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.49% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.49% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.49% |
| Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Sediment → Microbial Mat | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300000233 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10 | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002024 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k | Environmental | Open in IMG/M |
| 3300002026 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+ | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300033420 | Microbial mat bacterial communities from Middle Island sinkhole, Lake Huron, Michigan, United States - MIS.2016.152B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0954.00005800 | 2162886012 | Miscanthus Rhizosphere | LLALIILAVAMYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY |
| ICCgaii200_04762572 | 2228664021 | Soil | LVLTVYWLLSFFGKSIVPGISHTAGFIDMLAGVIVVLIIMKFLS |
| TB_PC08_66DRAFT_101822302 | 3300000228 | Groundwater | MLALIILLLTMQWLLSLFGQSTFPGVPHTGGFIYMLSVLIVVLIITRFLTYGI* |
| TB_FS06_10DRAFT_10429993 | 3300000233 | Groundwater | MLELIILALTAQLLFSFFGQTIFPRVPHTGGFIYMLSIAIVSLIILKFLMWS* |
| ICChiseqgaiiFebDRAFT_112622793 | 3300000363 | Soil | GGVRTPDEKISVLALIILALTAYWLLSFFGQSIVPCIPHTGGFIYLLAVVIVLLIIIKFLWQV* |
| ICChiseqgaiiFebDRAFT_114835392 | 3300000363 | Soil | LLQVIILVLTGYWLFSFFGKSIVPGISHPSGFVDVLSVIILILIIIKFLSW* |
| F14TC_1067820972 | 3300000559 | Soil | KVSLLELIILILSVYWLLSFFGQSIIPGIPHTGGFIYMLAIVIVILLIMKFLSQV* |
| JGI11643J11755_116126492 | 3300000787 | Soil | TPDEKISVLALIILALTAYWLLSFFGQSIVPCIPHTGGFIYLLAVVIVLLIIIKFLWQV* |
| JGI11643J11755_117918522 | 3300000787 | Soil | LLQVIILVLTGYWLFSFFGKSIVPGISHPSGFVDVLSVIILILIIXKFLSX* |
| MIS_10894363 | 3300002024 | Sinkhole Freshwater | MLELIILLLTMQWLLSFFGQSIFPGVPHTGSFIYILSVLIVVLIITKFLTYGI* |
| MIS_1000716310 | 3300002026 | Sinkhole Freshwater | MLEFIILVLTAQLLLSFFGQSIFPGVPHTGSFIYILSVLIVVLIMMKFLMLSM* |
| MIS_100149898 | 3300002026 | Sinkhole Freshwater | MFELIILVLTAQLLLSFFGQSAFPGVPHTGSFIYILSVLIVLLIIMKFLTDGI* |
| C687J26631_100141848 | 3300002124 | Soil | LLELIILVLTMHWLLSFFGQSIVPGLPHTAGFIDLLSVVIVVLIIISFWS* |
| Ga0055466_100793602 | 3300003997 | Natural And Restored Wetlands | LLEVIILIATMYWLLSFFGQSIVPGIPHTGGFIDMLSVVIVVLIIIHFVS* |
| Ga0055469_100051414 | 3300003999 | Natural And Restored Wetlands | LLALILMLAIYWLLSFFGQSIVRCVSHTSGFIDMLSVIIVLLIIIRFLA* |
| Ga0055465_101781372 | 3300004013 | Natural And Restored Wetlands | MLAIYWLLSFFGQSIVRCVSHTSGFIDMLSVIIVLLIIIRFLA* |
| Ga0062593_1003381382 | 3300004114 | Soil | ELIILILTAQWLFSFFGQSIVPGIPHTGGFIYLLAVVIVVLIIIRFLS* |
| Ga0062590_1014359061 | 3300004157 | Soil | LLELIILILTAQWLFSFFGQSIVPGIPHTGGFIYLLAVVIVVLIIIRFLS |
| Ga0066599_1011109711 | 3300004282 | Freshwater | MFELIILVLTAQLLLSFFGQSIFPGVPHTGSFIYMLSVLIVVLIITKFLTYGI* |
| Ga0066599_1013344401 | 3300004282 | Freshwater | LFVLIILLLTTQLALSYFGQSVFPGISHTGGFIYLLSVLIVALIIMKFLSQL* |
| Ga0062591_1001648242 | 3300004643 | Soil | LLELIILILTAQWLFSFFGQSIVPGIPHTGGFIYLLAVVIVVLIIIRFLS* |
| Ga0062591_1020310791 | 3300004643 | Soil | KKFSLLGLIILALTAYWLLGFFGQSIVPGVQHTSSFIDFLCVVIVLLIIVKFLT* |
| Ga0062383_101959241 | 3300004778 | Wetland Sediment | RSIQKKKRNPVLKLIILVLTAQWLLSFFGQSFFPGIPHTGGFLYMLSVVIVAMIAMIFLS |
| Ga0062380_102461302 | 3300004779 | Wetland Sediment | VLKLIILVLTAQWLLSFFGQSFFPGIPHTGGFLYMLSVVIVAMIAMIFLS* |
| Ga0062378_101155491 | 3300004780 | Wetland Sediment | ARSIQKKKRNPVLKLIILVLTAQWLLSFFGQSFFPGIPHTGGFLYMLSVVIVAMIAVIFLS* |
| Ga0062382_105125971 | 3300004782 | Wetland Sediment | LLVLIILVLTVHWLLSFFGQSIFPGVPHTGGFIDMLSLVIVVLIIVRFLS* |
| Ga0062594_1020823012 | 3300005093 | Soil | LLALIILALAIYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY* |
| Ga0065704_107209622 | 3300005289 | Switchgrass Rhizosphere | IRPKIWPDGVSIPDKRICLMELIILGLTLHWLLSFFGQSTVPRIVHTSRFIDMLSVVIVVLIIIKFLS* |
| Ga0065715_101310364 | 3300005293 | Miscanthus Rhizosphere | LLALIILAVAMYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY* |
| Ga0065705_1000326217 | 3300005294 | Switchgrass Rhizosphere | LLQLIILVLTVHWLLSFFGQAIVPGKFHKGYFTDVLSVVILVLIIIRFLSFIHYQ* |
| Ga0065705_103767802 | 3300005294 | Switchgrass Rhizosphere | VSIPDKRICLMELIILGLTLHWLLSFFGQSTVPRIVHTSRFIDMLSVVIVVLIIIKFLS* |
| Ga0065707_105183362 | 3300005295 | Switchgrass Rhizosphere | VLTIYWLLSFFGQSIVPGIPHTGSFIYMLAVLIVVLIIIKFLSQV* |
| Ga0065707_110585842 | 3300005295 | Switchgrass Rhizosphere | LLELFILVLTVQWLLGFFGQSIFPQILHMGGFIDILAIIIVVLIGVQFLSWL* |
| Ga0070687_1013239242 | 3300005343 | Switchgrass Rhizosphere | LLALIILALAMYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY* |
| Ga0070698_1006192983 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLALIILALAMYWVLSFFGQSIVPGVPHTAHFVDLLAVLIVVLIIVKFLLY* |
| Ga0070699_10000800612 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LLELIILILSVYWLLSFFGQSIIPGIPHTGGFIYMLAIVIVILLIMKFLSQV* |
| Ga0070699_1007752331 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGLIILALTAYWLLGFFGQSIVPGVQHTSSFIDFLCVVIVLLIIVKFLT* |
| Ga0070695_1008622711 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LLALIILTLAIYWVLSFFGRSIVPDVPHTARFIDLLAVVI |
| Ga0068864_1005995021 | 3300005618 | Switchgrass Rhizosphere | VLELIILALTGYWLLSFFGRSVIPGVPHTARFIDLLAVVIV |
| Ga0074478_12767863 | 3300005827 | Sediment (Intertidal) | MFELIILVLSAQLLLSFFGQSIFPGVPHTGGFIYMLSVLIVVLIITKFLVYGI* |
| Ga0074479_1090530512 | 3300005829 | Sediment (Intertidal) | LFELIILVLTVQWLLSFFGQKTFPRIPHSGTFIYLLSVLIVGLIITKFLIWL* |
| Ga0074472_110168771 | 3300005833 | Sediment (Intertidal) | IILVLTVHWLFSFFGQSIFPGVPHTAGFIDMLSLVIVVLIIVGVLS* |
| Ga0075427_101052551 | 3300006194 | Populus Rhizosphere | FGCGGVRTPDEKIFVLALIILALTAYWLLSFFGQSIVPCIPHTGGFIYMLAVVIVLLIIIKFLWQV* |
| Ga0079037_1012524262 | 3300006224 | Freshwater Wetlands | VLELIILVLTVQWLLSFFGQSIVPGILHTGGFIYMLSVLIVVLMIVRFLS* |
| Ga0075428_1001293354 | 3300006844 | Populus Rhizosphere | LLYLIILVLTVYWLLSFFGKSIVPGIPPTAGFIDMLSAVIVALIIMKFLSQ* |
| Ga0075428_1009316953 | 3300006844 | Populus Rhizosphere | LFELIILVLTIYWLLSFFGQSIIPGLTHTGGFIDMLSFVIVVLIIIKFLS* |
| Ga0075421_1012510341 | 3300006845 | Populus Rhizosphere | SLLELIILVLTVHWLFSFFGKSIVPGIPHSGGFIDMLSVVIVLLIIFRFLS* |
| Ga0075430_1011275942 | 3300006846 | Populus Rhizosphere | LLTLILMLTIYWLLSFFGQSIVRGASHTSGFIDMLSIIIVALIIIRFLS* |
| Ga0075431_1010353991 | 3300006847 | Populus Rhizosphere | LLELIIRVLTIYWLLSFFGQSIVPGFAHAGGFIDMLSVVIVVLIIVKFLS* |
| Ga0075431_1013867252 | 3300006847 | Populus Rhizosphere | MVLTVYWLLSFFGQSTFPGIPHSGGFIDMLSVLIVLLSIIRYL |
| Ga0075433_111426632 | 3300006852 | Populus Rhizosphere | LLALTILALVIYWVLSFFGQSIIPGVAHTTRFIDLLAVIIILLIIVKFLSY* |
| Ga0075420_1006521122 | 3300006853 | Populus Rhizosphere | LLELIILVLTIYWLLSFFGQSIVPGFAHAGGFIDMLSVVIVVLIIVKFLS* |
| Ga0073934_101155764 | 3300006865 | Hot Spring Sediment | LFELIILLLTVYWFLSFFGRSMIPNITHTGGFIDMLSIAIVVLIIIRFLS* |
| Ga0079217_110132091 | 3300006876 | Agricultural Soil | LFVELIILVLTIYWVLSFFGQSIVHGIPHMGGFIDMLSVVIVALIIIRFLS* |
| Ga0075429_1003357764 | 3300006880 | Populus Rhizosphere | LLELIILILTIYWLLSFFGQSIVPGFAHAGGFIDMLSVVIVVLIIVKFLS* |
| Ga0075429_1006175411 | 3300006880 | Populus Rhizosphere | ILVLTVYWLLSFFGKSIVPGISHTAGFIDMLAGVIVVLIIMKFLS* |
| Ga0079215_109705492 | 3300006894 | Agricultural Soil | LLQLIILVLAGYWLLSFFGQSIVPGMRQTGSFIDVLAVVIVALIIIRFLS* |
| Ga0079219_102459282 | 3300006954 | Agricultural Soil | LLALIILALAMYWVLSFFGQSIVPGVPHTARSIDLLAVLIVVLILVKFLLY* |
| Ga0079219_121122112 | 3300006954 | Agricultural Soil | VLKVIILLLIGQWLLSFFGQRIAPGIPHSGGFIYLLSLVIVILIAMSFLL* |
| Ga0075419_101626362 | 3300006969 | Populus Rhizosphere | LLQVIILVLTGYWLFSFFGKSIVPGISHTSGFVDVLSVIILILIIIKFLSW* |
| Ga0079218_100458443 | 3300007004 | Agricultural Soil | LLDLIILVLTVYWLLSFFGQSIIPGIPHTGGFIDMLSVMIVFLIIIRFLS* |
| Ga0079218_117679842 | 3300007004 | Agricultural Soil | MILVLTVYWLLSFFGKSIVSGIQHTEGFINLLSVLIVVLIMFRFLA* |
| Ga0105105_100954042 | 3300009009 | Freshwater Sediment | VLELLILALTAQLLFSFFGQTIFPGVPHTGSFIYLLSVLIVVLIIMKFVS* |
| Ga0105105_101528271 | 3300009009 | Freshwater Sediment | MLALIILLLTTQWLLSLFGQTIFPGVPHTGSFIYILSVLIVVLI |
| Ga0105105_102562061 | 3300009009 | Freshwater Sediment | MLELIVLVLTMQWLLSFFGQSIFPGLPHTGGFIYMLSVLIVVLIMMKFVS* |
| Ga0105105_110116222 | 3300009009 | Freshwater Sediment | LIILALTAQLLFSFFGQTVFPGVPHTGGFIYMLSVLIVVLIIMKFLVEFL* |
| Ga0075418_116443921 | 3300009100 | Populus Rhizosphere | VLELIILALTGYWSLSFFGQSIVPSIPHTGGFIDMLAVVIVVLIIIKFLSHV* |
| Ga0075418_130556861 | 3300009100 | Populus Rhizosphere | LLELIILALTLYWLLSFFGQSIVRGISPTGGFIDMLSVVIVVLILVKFLS* |
| Ga0115027_117134302 | 3300009131 | Wetland | LTMQWLLSFFGQSVFPGVPHTGGFIYMLSVLIVALIIVRFLS* |
| Ga0105092_102689582 | 3300009157 | Freshwater Sediment | LFELIILLLTVYWLLSFFGHSIIPSLAHTGGFIDMLSVVIVVLIIMKFLS* |
| Ga0075423_101857062 | 3300009162 | Populus Rhizosphere | LLALIILAVAMYWVLSFFGQSIIPGVAHTTRFIDLLAVIIILLIIVKFLSY* |
| Ga0105102_103858741 | 3300009165 | Freshwater Sediment | LLELIILVLTAQLLFSFFGQSTFPGVPHTGGFIYILSVLIVV |
| Ga0105100_109375351 | 3300009166 | Freshwater Sediment | LLELIILILTVYWLLSFFGQSVVSIPHTGDFLYMLSVVIV |
| Ga0105104_101735162 | 3300009168 | Freshwater Sediment | MSTQKKIPLLELIVLVLTVYWLLSLFGRSIISGIPHTGGFIDMLSVIIVVLIIVKFLS* |
| Ga0105101_1000482711 | 3300009171 | Freshwater Sediment | LLELIILILTVYWLLSFFGQSVVSIPHTGDFLYMLSVVIVVLIIMKFLS* |
| Ga0126308_109605952 | 3300010040 | Serpentine Soil | LLELIILVLTLYWLLSFFGRSIFPGIPHTARFIDLLAVVIVILIIMKFLSYESSQTF |
| Ga0115595_11925142 | 3300010138 | Wetland | LLLSIILLLTAQWLFSLFGQSNFPSVLHTGGFIYMLSAFIVVLIIMKFL |
| Ga0116249_112220683 | 3300010357 | Anaerobic Digestor Sludge | VSEFIILALTTQWLFSFFGQLIFPGIPHTGSFIYMLA |
| Ga0134127_102083161 | 3300010399 | Terrestrial Soil | LLALIILALTAHWLLSFFGQSIVPGISQTGGFIDMLSVIIVVLIIVKFLS* |
| Ga0134127_103819551 | 3300010399 | Terrestrial Soil | RKVRLLELIILVLTLYWLLSFFGRSIVRGISPTGGFIDLLSVVIVVLILMKFLS* |
| Ga0134127_107164602 | 3300010399 | Terrestrial Soil | ILVLTVQWLFSFFGQSFVPRVLHAGGFIDVLTVVIVLLIIMQFLS* |
| Ga0134123_100337952 | 3300010403 | Terrestrial Soil | MISFLEFIILVLTVQWLFSFFGQSFVPRVLHAGGFIDVLTVVIVLLIIMQFLS* |
| Ga0137446_10721262 | 3300011419 | Soil | MLELIILALTAQWLFSFFGQSIFPGVPHSGGFIYMLSALIVVLIIINSLT* |
| Ga0137338_10774791 | 3300012174 | Soil | LLELISLVLTVHWLLSFFGQSIVPGIPHADGFIDILSVVIVLLIMVTFLS |
| Ga0167657_10131541 | 3300015079 | Glacier Forefield Soil | MVSLFELIIMGLVTQSLLSFFGQSLLPGLPHSGAFIYLLSALIVVLIIMKTQVSL* |
| Ga0132256_1015990421 | 3300015372 | Arabidopsis Rhizosphere | LLELIILALTIYWLLSFFGWSIVPGVPHTARFIDLLAIVIIGLIIVKFLLY* |
| Ga0184634_105050441 | 3300018031 | Groundwater Sediment | LLELIILVLTVQWLLSFFGQSIVAGIPHTGAFIYMLSVLIVVLI |
| Ga0184620_101703632 | 3300018051 | Groundwater Sediment | LIILALTAHWLLSFFGQSIVPGISHTGGFIDVLSVIIVVLIIVKFLS |
| Ga0184615_102341181 | 3300018059 | Groundwater Sediment | VYCLLSFFGKSIVPGISHTAGFIDMLSGVIVVLIMMKFLS |
| Ga0193739_11365013 | 3300020003 | Soil | MSAQKKIPLLELIILVLTVHWLLSYFGQSIVPGIPHTDGFIDMLSVVLVVMIIMKFLS |
| Ga0207193_101303410 | 3300020048 | Freshwater Lake Sediment | MLEFIILVLTAQLLLSFFGQSIFPGVPHTGSFIYILSVLIVVLIMMKFLMLSM |
| Ga0207193_105447711 | 3300020048 | Freshwater Lake Sediment | MLELIILLLTMQWLLSFFGQSTFPGVPHTGSFIYMLSVLIVVLIIMKFLVEFL |
| Ga0180109_13882082 | 3300020067 | Groundwater Sediment | LELIILVLTIYWLLSFFGQSIVPGIPHTGRFIDMLSV |
| Ga0210377_101344991 | 3300021090 | Groundwater Sediment | MLELIILVLTTQWLLSFFGQSIFPGIPHSGGFIYMLSVLIVVLIM |
| Ga0210377_101740403 | 3300021090 | Groundwater Sediment | SLLVLIILLLTTQWLLSFFGQSIFPGVPHTGGFIYMLSALIVVLIIMKFLS |
| Ga0182009_107410192 | 3300021445 | Soil | LLELIILALAMYWVLSFFGQSILPGVPHTARFVDLLAVVIVVLILVKFVMY |
| Ga0079039_11587816 | 3300022185 | Freshwater Wetlands | LFELIILALTVQCLLSFFGQSTFPGIPHTDGFIYMLSALIVALIIMKFMSDLY |
| Ga0079039_13319241 | 3300022185 | Freshwater Wetlands | MLELIILILIVQLLVSFFGQSIFPGVPHTGGFIYMLSIVIVGLIIIKFLSWL |
| Ga0124853_13704252 | 3300024056 | Freshwater Wetlands | VNIYFLFHKEDPLLELIILVLTVQWLLSFFGRSLIPGIPHTGGFIYLLAVVIDSLIIVRFLT |
| Ga0209172_100317963 | 3300025310 | Hot Spring Sediment | LLTVIILLLVGQWLLSFFGQSVTPGITHTGGFIYLLSLAIVVLIATSFLLLLGR |
| Ga0209431_103173172 | 3300025313 | Soil | LLELIILVLTMHWLLSFFGQSIVPGLPHTAGFIDLLSVVIVVLIIISFWS |
| Ga0209519_104158783 | 3300025318 | Soil | VLELIILVLTAQWLLSFFGQSIVPGIPHTGGFIYMLSVV |
| Ga0209342_109597073 | 3300025326 | Soil | VLELIILVLTAQWLLSFFGQSIVPGIPHTGGFIYMLSVVIVVLIT |
| Ga0209751_102925963 | 3300025327 | Soil | LLELIILVLTMHWLLSFFGQSIVPGIPHTAGFIDLLSVVIVVLIIISFWS |
| Ga0207662_102065002 | 3300025918 | Switchgrass Rhizosphere | LLALIILALAMYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY |
| Ga0207670_103501462 | 3300025936 | Switchgrass Rhizosphere | LLALIILALAIYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFLMY |
| Ga0207689_107164704 | 3300025942 | Miscanthus Rhizosphere | LLALIILALAMYWVLSFFGQSIVPGVPHTARFVDLLAVVIVVLILVKFL |
| Ga0209999_10711501 | 3300027543 | Arabidopsis Thaliana Rhizosphere | LLELIIVVLTIHWLLSFFGQSTFPGIPHSDGFIDVLSVV |
| Ga0209703_13118213 | 3300027723 | Freshwater Sediment | LLELIILVLTVYWLLGFFGQSVVQSVVSIPHTGDFLYMLSVVIVVLIIMKFLS |
| Ga0209593_100901842 | 3300027743 | Freshwater Sediment | MSTQKKIPLLELIVLVLTVYWLLSLFGRSIISGIPHTGGFIDMLSVIIVVLIIVKFLS |
| Ga0209288_103007011 | 3300027762 | Freshwater Sediment | KAPLLELIILALTAQLLFSFFGQTVFPGVPHTGGFIYMLSVLIVVLIIMKFLVEFL |
| Ga0209177_103267412 | 3300027775 | Agricultural Soil | VLKVIILLLIGQWLLSFFGQRIAPGIPHSGGFIYLLSLVIVILIAMSFLL |
| Ga0209287_101711192 | 3300027792 | Freshwater Sediment | LLELIILVLTAQLLFSFFGQSTFPGVPHTGGFIYILSVLIVALI |
| Ga0209481_100641042 | 3300027880 | Populus Rhizosphere | LLYLIILVLTVYWLLSFFGKSIVPGIPPTAGFIDMLSAVIVALIIMKFLSQ |
| Ga0209481_104393342 | 3300027880 | Populus Rhizosphere | LFELIILVLTIYWLLSFFGQSIVPGFAHAGGFIDMLSVVIVVLIIVKFLS |
| Ga0209486_100326273 | 3300027886 | Agricultural Soil | LLDLIILVLTVYWLLSFFGQSIIPGIPHTGGFIDMLSVMIVFLIIIRFLS |
| Ga0209889_10957802 | 3300027952 | Groundwater Sand | GASTPDKKASLLELIILVLTINWLLSFFGQSIVPGIPHTSYFIDMLSVVIVVLILIRFLS |
| Ga0302162_100054244 | 3300028649 | Fen | IILLLTAQWLFSFFGQSILPGVPYTGSFIYMLSILIVILIIMKFLSQV |
| Ga0247652_11346611 | 3300030571 | Soil | LLELIILVLTVHWLLSFFGQSTFPGIPHSGGFIDMLAVVIVLLILIR |
| Ga0308155_10069522 | 3300030987 | Soil | RIIDKKISLLALIILALTAHWLLSFFGQSIVPGISHTGGFIDMLSVIIVVLIIVKFLS |
| Ga0299914_100197738 | 3300031228 | Soil | LLELIILVLTIYWLRSFFGQSIVPGIRHTEGFIDMLSVVIVILIIMKFLA |
| Ga0302322_1003123781 | 3300031902 | Fen | LIELIILLLTIQWLLSFFGQSIFPRILHSDAFIYILSVLIVGLIINRFLFWA |
| Ga0307416_1016977012 | 3300032002 | Rhizosphere | SLFELTILVLTAYWCLYFFGQSMIPGMTHMAGFIDLLSIAIVALIIIKFLS |
| Ga0307411_115304781 | 3300032005 | Rhizosphere | LLALILMLTTYWALSFFGQLVVGVSHTSGFIDVLSVIIVVLIIIRFLS |
| Ga0315268_100087286 | 3300032173 | Sediment | LLELIILLLTLHWLLSYFGQSILPGMPHSGGFIYLLSIAIIVLIIMEFLSYL |
| Ga0315268_105130313 | 3300032173 | Sediment | FNGRFSVLELIILALTMQWLISFFGQSTFPGVPHTGSFIYMLAVAIVSLIIIKFLSWTL |
| Ga0315268_118724001 | 3300032173 | Sediment | IKEPPLLELIILLLTVHWLLSYFGQLVLPGLPHSGGFIYLLSIAIVVLIIMEFLSHL |
| Ga0335397_1000244116 | 3300032420 | Freshwater | LLELIILALTVQWLLSFFGQSLFPGVPHTGGFIYMLSALIVLLIIVKFLSQV |
| Ga0316608_10116031 | 3300033420 | Microbial Mat | MLELIILVLTAQLLLSFFGQFAFPGVPHTAGFIYILS |
| Ga0316627_1006215511 | 3300033482 | Soil | PGDNCILHEKVPLLELIILVLTAQLLFSFFGQSAFPGVPHTGGFIYMLSVLIVLLIIMKFVS |
| Ga0316627_1015096661 | 3300033482 | Soil | LLELIILVLTAQLLFSFFGQSAFPGVPHTGGFIYML |
| Ga0316626_108117401 | 3300033485 | Soil | LLELIILVLTVQWLLSFFGQSIVPGILHTGGFIYMLSVLIVVLMIVRFLS |
| Ga0316630_116251931 | 3300033487 | Soil | KLIQRKVSLLELIILILIAQWLLSFFGQSILPGILHTGGFIYMLSVIIVVLIFMKFLSQS |
| Ga0299912_111205262 | 3300033489 | Soil | VFELILLVLIVQLLFSFFGQSIFPGIPHTGGFIYMLSVAI |
| ⦗Top⦘ |