| Basic Information | |
|---|---|
| Family ID | F059088 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MTLAQVRSKTERIREFSALPFLLVAGISAAGAFFRAAPQAVTGGP |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.25 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 95.52 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.612 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.925 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.090 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.716 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.36% β-sheet: 0.00% Coil/Unstructured: 61.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00330 | Aconitase | 40.30 |
| PF00106 | adh_short | 0.75 |
| PF04069 | OpuAC | 0.75 |
| PF00953 | Glycos_transf_4 | 0.75 |
| PF00694 | Aconitase_C | 0.75 |
| PF08331 | QueG_DUF1730 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0472 | UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG1600 | Epoxyqueuosine reductase QueG (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.61 % |
| All Organisms | root | All Organisms | 22.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1005526731 | 3300000364 | Soil | MTLEQVRSKTERIREFSALPFLLVAAVSLLGAIYRPAPQIVTGGAINPGDVAW |
| INPhiseqgaiiFebDRAFT_1017920651 | 3300000364 | Soil | MTLADVRSKTDRVREYSSIPFLLVAAISLAGALFRP |
| INPhiseqgaiiFebDRAFT_1055887343 | 3300000364 | Soil | MTLEQVRSKTERIREFSALPFLLLASVSVLGAIYRGAPQTVIG |
| C688J14111_102505361 | 3300001305 | Soil | MTLADVRSKTDRIREYKAIPFLLVAAVSLTGALFRPSPQAV |
| F14TB_1032576282 | 3300001431 | Soil | MTLAQVRSKTERIREFSALPFLLVAGISVAGATFRXAPEIFRRLGA |
| Ga0062589_1021590332 | 3300004156 | Soil | MTLATVRLNTKRIREFSALPFLLVAAVSIVGALYQPAPQAVTG |
| Ga0062592_1006530441 | 3300004480 | Soil | MTLADVRSKTDRIREYSAIPFLLVAAVSLAGAFFRSEPQAAT |
| Ga0066673_103085292 | 3300005175 | Soil | MTLARVRTTTDVIRGFRALPFMLVAGVSLLGAFYRPAPQAVTGGPLNSGDVAW |
| Ga0065705_104060821 | 3300005294 | Switchgrass Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVAGALFRAAPQAVTGGPLVAGDV |
| Ga0065705_109305071 | 3300005294 | Switchgrass Rhizosphere | MTLAQVRRKTERIREFSALPFLLVAGVSVLGALYRSAPQAVTGGPLNAGDVAWMLT |
| Ga0065707_104241661 | 3300005295 | Switchgrass Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVAGALFRAAPQAVTGGPLVAGDVAWML |
| Ga0070690_1004244832 | 3300005330 | Switchgrass Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSVAGVLVRPAPQA |
| Ga0066388_1005104262 | 3300005332 | Tropical Forest Soil | MTLEDVRSKTERIRGFSALPFLLLATVSLAGAFVRTAPQAVSGGPINTGDVAWMLT |
| Ga0066388_1027225652 | 3300005332 | Tropical Forest Soil | MTLAQVRSKTERIREFSALPFILVAAVSLAGALFRPAPQAQTGGPINPGDVAWML |
| Ga0068869_1017311061 | 3300005334 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYPAIPFLLVAAVSVAGVLFRPEPQAVTGGPINAGDTAWML |
| Ga0070687_1015120971 | 3300005343 | Switchgrass Rhizosphere | MTLAQVRSKTERFREISALPFLLVAGISVAGALFRAAPQAVTGG |
| Ga0070694_1016836021 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRRKTERFREFSALPFLLVALISLAGAVFRAAPQAVTGGP |
| Ga0070663_1012517292 | 3300005455 | Corn Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGVSVAGALFHAAPQAVTGGPLVAG |
| Ga0070699_1012028681 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRSKTERFREFSALPFLLVAGISVAGALFRAAPQAVTGGALVAGDV |
| Ga0070697_1001446781 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLATVRRKTERIREFSALPFLLVAAVSVMGAFFRSAPQAVT |
| Ga0070697_1009933902 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRSKTERIREFSALPFLLLAVASMAGAFYRVAPQAVTGGPINTGDVAWMLTAT |
| Ga0066697_100909052 | 3300005540 | Soil | MTLAQVRTKTDVIRGFTALPFMLVAAVSLLGAFYRPAPQAATGGPGGDWS* |
| Ga0070672_1002340341 | 3300005543 | Miscanthus Rhizosphere | MTLAQVRSKTERFREFSALPFLLVAGISVAGALFRAAPQAVTGGPLVAGDVAWML |
| Ga0070672_1005975062 | 3300005543 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSLAGALFRSEPQAAT |
| Ga0070696_1008821882 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLATVRRKTERIREFSALPFLVIAAVSVAGAFVRQAPQTVTGGPINPGDVAWML |
| Ga0070696_1012664552 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRSKTERIREFSALPFLLLAAASLAGGFLRVAPQTVTGGPINAG |
| Ga0070704_1002771752 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLATVRRNTERIREFSALPFVLVAAVSIAGAVFRPEPQAVTGGPISAGDVAWML |
| Ga0066700_100550292 | 3300005559 | Soil | MTREQVRSKTERIREFAALPFLLMAVVSVLGVVVRPAAQPITGGPVN |
| Ga0066702_101611952 | 3300005575 | Soil | MTLEQVRSKTERIREFTALPFLLLAVVSVLGVVVRPAAQPITGGPVNSG |
| Ga0068854_1008921701 | 3300005578 | Corn Rhizosphere | MTLAAVRRKTERIREFSALPFLLVAAVSVAGALFHPAPQVATGGPINSGDLAWM |
| Ga0066706_104779251 | 3300005598 | Soil | MTLAQERSTTERIWATLPFILIAAVSLAGAFYRPAAQA |
| Ga0068852_1013173881 | 3300005616 | Corn Rhizosphere | MTLADVRSKTDRIREFSAIPFLLVAAVSVAGALFHGE |
| Ga0068859_1017633941 | 3300005617 | Switchgrass Rhizosphere | MTLAGVRSKTDRIREYSAIPFLLVAAVSLAGALFRPA |
| Ga0066903_1062947661 | 3300005764 | Tropical Forest Soil | MTLADVRSKTDRIREYPAIPFALVAAVSLAGALFRPAPPAVTGGPVNAGDTAWML |
| Ga0066903_1080248122 | 3300005764 | Tropical Forest Soil | MTLATVRRKTERIREFSALPFLLLATVSLAGALFRTQPQT |
| Ga0068860_1013389162 | 3300005843 | Switchgrass Rhizosphere | MTLATVRRGTERIRNFSALPFLLVAAVSLLGALFQPAAQAVT |
| Ga0066656_109739152 | 3300006034 | Soil | MTLAQVRPKTAVIRGFTALPFMLVAAVSLLGAFYRPAPQAATGGPGGDWS* |
| Ga0066652_1018479941 | 3300006046 | Soil | MTLAQVRSKTERIREFSALPFLLIAGISAAGALFRAAPQAVT |
| Ga0075417_105591512 | 3300006049 | Populus Rhizosphere | MTLATVRRKTERIREFSALPFLLLAAVSVVGAVFRAAPP |
| Ga0075030_1015011391 | 3300006162 | Watersheds | MTLEQVRSKTERIREFSAVPFVLVAMVSLAGALFRAEPQAVTGGPVNSGDTAWML |
| Ga0097621_1002849152 | 3300006237 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYSAIPFVLVALVSLAGALFRPEPQAVTGGP |
| Ga0097621_1023958562 | 3300006237 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYSSIPFLLVAAVSLAGALYRPAPQAVTGGPINAGDT |
| Ga0066653_105880612 | 3300006791 | Soil | MTLATVRRKTERIREFSALPFLLIAAVSVVGAFVRQAPPVA |
| Ga0075433_117973582 | 3300006852 | Populus Rhizosphere | MTSAQVRRKTERIREFSALPFLLVAGISLAGAIVRSAPQTVTGGPI |
| Ga0075425_1005026381 | 3300006854 | Populus Rhizosphere | MTLEDVRSRTERIRGFSALPFLLLAAVSLAGAIVRTAPQSVTGGPINTGDVA |
| Ga0075425_1010350622 | 3300006854 | Populus Rhizosphere | MTLATVRRKTERIREFSALPFLLVAAVSLAGALVKPAPPLVTGGPINA |
| Ga0075425_1015232032 | 3300006854 | Populus Rhizosphere | MTLEQVRSKTERIREFSALPFLLIAAVSVFGALFSGAPQAVTGGPINAGDVAWML |
| Ga0075434_1006649341 | 3300006871 | Populus Rhizosphere | MTLAQVKRKTEQIREFSALPFLLVAGVSLLGAFLRSAPQTT |
| Ga0075429_1010393802 | 3300006880 | Populus Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISAVGALFRVAPQAVTGGPLVAGDVAWMLT |
| Ga0075424_1008696491 | 3300006904 | Populus Rhizosphere | MTLAQVRSKTERIREFSALPFLLLAAASVAGGFFRTAPQSVVGGPMN |
| Ga0075435_1002189442 | 3300007076 | Populus Rhizosphere | MAVEQVKSKTGRIRDIAALPFLLMAAVSVLGVIVRPSPQQIAGGPVN |
| Ga0075435_1018176262 | 3300007076 | Populus Rhizosphere | MTLEQVRSKTKRIREFSALPFLLVAGVSLLGALYRGAPQTVVGGAI |
| Ga0099791_104664491 | 3300007255 | Vadose Zone Soil | MTLADVRSKTERIREFSALPFLLIATVSLAGAFFRSKPQAVSGGPVNPGDV |
| Ga0099793_101621121 | 3300007258 | Vadose Zone Soil | MPTMTLATVRRKTERIREFSALPFLLVAAVSVMGAFFRSAPQAVTGGPVNTGDVAWM |
| Ga0066710_1032730321 | 3300009012 | Grasslands Soil | MTLAQVRSKTERIREFSALPFLLVVAASIGGVLFRPAPQSPVGGPINPGDVAWMLTAT |
| Ga0111539_125810082 | 3300009094 | Populus Rhizosphere | MTLAQVRRKTERIREFSALPFLLVALISVAGAVFRAAPQAVTGGPINPGDVAWML |
| Ga0105245_116144521 | 3300009098 | Miscanthus Rhizosphere | MTLATVRRNTERIRELSALPFLLVAAVSVLGALFRPAAQAATGGPINAGDTA |
| Ga0075418_128303101 | 3300009100 | Populus Rhizosphere | MTLAQVRRKTERFREFSALPFLLVALISLAGAVFRAAP |
| Ga0114129_121045542 | 3300009147 | Populus Rhizosphere | MTLAQMRSKTERIREFSALPFLFVAGVSVLGAFYRGAPQTVTGGAINSGDVAWMLT |
| Ga0111538_105593762 | 3300009156 | Populus Rhizosphere | MTLAQVRRKTERFREFSALPFLLVALISLAGAVFRAA |
| Ga0111538_109729091 | 3300009156 | Populus Rhizosphere | MTLAQVRRKTERIREFSALPFLLVALISVAGAVFRAAPQAVTGGPINPGDV |
| Ga0111538_109928252 | 3300009156 | Populus Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVAGALFRAAPQAVTGGALVAGDVAWMLT |
| Ga0075423_108500062 | 3300009162 | Populus Rhizosphere | MTLAQVRRKTERFREFSALPFLLVALISLAGAVFRAAPQAVTGGPI |
| Ga0075423_114879782 | 3300009162 | Populus Rhizosphere | MTLEQMRSKTVRIRGFSALPFLLIAGVSLLGAFLRPAPQTV |
| Ga0105242_115361442 | 3300009176 | Miscanthus Rhizosphere | MTLTQVRRKTERIREFSALPFLLVALISVAGAVFRAAPQAV |
| Ga0105248_108343392 | 3300009177 | Switchgrass Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSLAGALFRPAAQAVTGGPINAGD |
| Ga0126313_110815401 | 3300009840 | Serpentine Soil | MTLASVRRKTERIREFSALPFLLVAAVSVLGVLYRPAPQAVAGGPI |
| Ga0134082_101972071 | 3300010303 | Grasslands Soil | MTLAQVRSKTERIREFSALPFLLIAAASLMGAFYRPAPQAVTGGP |
| Ga0134125_107929512 | 3300010371 | Terrestrial Soil | MTLAMVRRKTERIREFSALPFLLVAAVSVAGALFR |
| Ga0134127_121154121 | 3300010399 | Terrestrial Soil | MTLATVRRNTERIREFSALPFVLVAAVSIAGAVFRPEPQAVAGGPISAGDVAWMLTA |
| Ga0134122_131771502 | 3300010400 | Terrestrial Soil | MTLATVRRRTERIREFSALPFVLVAAVSIAGAVFRPEP |
| Ga0134123_118093323 | 3300010403 | Terrestrial Soil | MTLATVRRRTERIREFSALPFVLVAAVSIAGAVFRPEPQAVTGGPI |
| Ga0105246_121058402 | 3300011119 | Miscanthus Rhizosphere | MTLEQVRSKTARIRTYRAVPFLLVAAVSAGGAMFRGAPQTVAGGPI |
| Ga0137457_12382242 | 3300011443 | Soil | MTLATVRRKTERIREFSALPFLLVAAVSIAGAVFRPAPQAVTGGPISPGDVAWM |
| Ga0137383_108574982 | 3300012199 | Vadose Zone Soil | MTLAQERSTTERICATLPFILIATVSLAGAFYRPAAQAVTGGPVNTGDVAWMLT |
| Ga0137374_104672022 | 3300012204 | Vadose Zone Soil | MTLAQVRRKTERIREFSALPFLLVAAVSLAGAFFRAAPQAVTGGPLNSGDVAWML |
| Ga0137361_105413592 | 3300012362 | Vadose Zone Soil | MTLAQERSTRERIWATLPFILIAAVSLAGAFYRPAAQAVTGGPVNTGDVAWMLTAT |
| Ga0157282_103023712 | 3300012904 | Soil | MTLAQVRRKTERIREFSALPFLLVALVSLAGAVFRAAP |
| Ga0137419_114530272 | 3300012925 | Vadose Zone Soil | MTLADVRSKTDRIREYPAIPFLLVAGVSLLGAFFRPAPQAVTGGPINAGDTAWM |
| Ga0126369_100125632 | 3300012971 | Tropical Forest Soil | MTLATVRQKTERIREFSALPFLLIIAASLGGALFRSQPQTVAAVR* |
| Ga0157375_121677331 | 3300013308 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYSAIPFVLVALVSLAGALFRPEPQAVTGGPINAGDTA |
| Ga0157379_122862802 | 3300014968 | Switchgrass Rhizosphere | MTLATVRRNTERIRELSALPFLLVAAVSVLGALFRPAAQAATGGPINAGDTAWMLT |
| Ga0182007_101699232 | 3300015262 | Rhizosphere | MTLADVRSKTERIREFSALPFLLVAAVSLAGALFRPQPQSVTGGPINAGD |
| Ga0132257_1001504762 | 3300015373 | Arabidopsis Rhizosphere | MTLEQVRSKTERIREFSALPFLLVAAVSLLGAIYRPAGQIVTGG |
| Ga0132257_1037843401 | 3300015373 | Arabidopsis Rhizosphere | MTLAQVKRKTERFREFSALPFLLVALISVAGVVFRTAPQAVTGG |
| Ga0132255_1058559691 | 3300015374 | Arabidopsis Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVAGALVRAA |
| Ga0182037_118703192 | 3300016404 | Soil | MTLEQVRSKTGRIREFSALPFLLVATVSLLGAFFRAQPQTVTGGPVNTG |
| Ga0182038_120848141 | 3300016445 | Soil | MTLADVRSKTDRIREYPAIPFVLVAAVSLAGALFRPAPQAVT |
| Ga0184621_102640912 | 3300018054 | Groundwater Sediment | MTLAQVRSKTERIREFSALPFLVLAGVSVAGAFFRSAPQTVTGGPLVA |
| Ga0184640_104907881 | 3300018074 | Groundwater Sediment | MTLAQVRSKTERIREFSALPFLLVAGISAAGAFFRAAPQAVTGGP |
| Ga0066662_120333251 | 3300018468 | Grasslands Soil | MTLAQVRSKTERIREFSALPFLLVVAASVGGAFFRPAPQAVVGGPINP |
| Ga0190274_127775631 | 3300018476 | Soil | MTLEQVRSKTERIREFSALPFLLLASISVLGALFRGAPQVVTGGPINSGDVA |
| Ga0210382_104012921 | 3300021080 | Groundwater Sediment | MTLATVRRNTERIREFSALPFLLVAAVSVVGALYQPAAQAVTGG |
| Ga0207932_10065663 | 3300025495 | Arctic Peat Soil | MTLAMVRRKTERIREFSAIPFLLIAGVSLLGAFFRPAPQTTTGGPVST |
| Ga0207699_112489792 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAMVRRKTERIREFSAFPFLLLAAVSLAGAFVRPQPQAVTGGPVNAGDVAWMLPAT |
| Ga0207684_110226362 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRSKAERIREFSALPFLLVAGVSVAGAVFRA |
| Ga0207684_110583702 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLEQVRSKTKRIREFTALPFLLMAVVSVLGVVVRPAAQPTAGGPVNSGDV |
| Ga0207646_105016072 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAMVRRKTERIREFSALPFLLVAAVSVAGAWLRPQPQAMTGGPVNAG |
| Ga0207681_118559992 | 3300025923 | Switchgrass Rhizosphere | MTLATVRRGTERIREFSALPFLLVAAVSIGGVLFRPAPQAVTGGPISAG |
| Ga0207650_117718791 | 3300025925 | Switchgrass Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSLAGAIVR |
| Ga0207701_102114825 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAQVRRKTERIREFSALPFLLLAGVSVLGAVLRSAPQTVTGGPLNTGD |
| Ga0207644_115521411 | 3300025931 | Switchgrass Rhizosphere | MTLATVRRKTERIREFSALPFLLVAAVSVAGALFRPQPQS |
| Ga0207686_111061412 | 3300025934 | Miscanthus Rhizosphere | MTLATVRRNTERIREFSALPFVLVAAVSIAGAVFRP |
| Ga0207665_108648391 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSVAGVLFRPAPQAVTGGPINAG |
| Ga0207691_111844252 | 3300025940 | Miscanthus Rhizosphere | MTLADVRSKTDRIREYSAIPFLLVAAVSLAGALFRSEPQAATGGPINAG |
| Ga0207711_113491481 | 3300025941 | Switchgrass Rhizosphere | MTLATVRRNTERIREFSALPFLLVAVVSIAGAVSRPAPQAVTGGPISAGDVAW |
| Ga0207712_103026641 | 3300025961 | Switchgrass Rhizosphere | MTLATVRRGTERIREFSALPFLLVAAVSIGGVLFRPAPQTVTGGPISAGD |
| Ga0207677_118705992 | 3300026023 | Miscanthus Rhizosphere | LRNQVRSKTERIREFSALPFLLVAGVSVAGALFHAAPQAVTGGPL |
| Ga0207675_1023842992 | 3300026118 | Switchgrass Rhizosphere | MTLAQVRRNTERIREFSALPFLLVAGVSVLGALYRSAPQAVTGGPLNAGDVAWMLTA |
| Ga0209154_10369642 | 3300026317 | Soil | MTLEQMRSKTERIREFAALPFLLMAVVSVLGVVVRPAAQPITGGPVN |
| Ga0209577_101832562 | 3300026552 | Soil | MTLATVRRKTERIREFSALPFLLIAAVSVAGALVQPAPPAR |
| Ga0209577_107131561 | 3300026552 | Soil | MTLEQVRSKTERIREFTALPFLLLAVVSVLGVVVRPAAQPI |
| Ga0209579_107971202 | 3300027869 | Surface Soil | MTLSQVRSKTERIREFSALPFLLVVAASLAGALFRPQP |
| Ga0209814_101467912 | 3300027873 | Populus Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVLGALFRAAPQA |
| Ga0207428_105733952 | 3300027907 | Populus Rhizosphere | MTLAQVRSKTERIREFSALPFLLVAGISVAGALFRAAPQAVTGGALVAGDV |
| Ga0247662_10134771 | 3300028293 | Soil | MTLADVRTKTDRIREYSAIPFLLVAAVSLAGALFRPAA |
| Ga0268265_105901051 | 3300028380 | Switchgrass Rhizosphere | MTLATVRRNTERIREFSALPFVLVAAVSIAGAVFRPEPQA |
| Ga0268265_123586611 | 3300028380 | Switchgrass Rhizosphere | MTLAQVRRKTERIREFSALPFLAVAGVSVLGAVYRSAPAPVTGGPLNA |
| Ga0307503_104484541 | 3300028802 | Soil | MTLADVRTKTDRIREYSAIPFLLVATVSLAGALFRPA |
| Ga0307281_101765872 | 3300028803 | Soil | MTLATVRRNTERIRELSALPFLLIAAVSVLGALFRPAA |
| Ga0307312_102068691 | 3300028828 | Soil | MTLATVRRKTERIREFSALPFLLIAVVSLLGAFYRTAPQTV |
| Ga0307304_102770712 | 3300028885 | Soil | MTLATVRRSTERIREFSALPFLLVAAVSLAGALFRPAPQAVTGGPISA |
| Ga0170824_1160653472 | 3300031231 | Forest Soil | MTLETVRRNTGRIRELSALPFVVVAAVSLLGALYKPAPQTIAGGPINSGDVAWMLT |
| Ga0307408_1006545511 | 3300031548 | Rhizosphere | MTLAQVRSKTERIRQFSALPFLLVAGISAVGAFFRVAPQAVTGGPLVAGDVAWMLT |
| Ga0310813_119621081 | 3300031716 | Soil | MTLAMVRRKTERIRAFSALPFLLIAAVSLGGALFRPQPQSVTGGPINAGDVAWMLTA |
| Ga0310813_121182891 | 3300031716 | Soil | MTLAQVRRKTERIREFSAFPFLLVAAVSVVGAFFRPAPQTVTGGPINP |
| Ga0307468_1020713021 | 3300031740 | Hardwood Forest Soil | MTLATVRRNTERIRELSALPFLLVAAVSVLGALFRPAAQAVTGGAINAGDTAWMLTAT |
| Ga0318537_103234091 | 3300031763 | Soil | MTLEQVRSKTGRIREFSALPFLLVATVSLLGAFFRAQPQTVTGGPVNTGDVAWML |
| Ga0318535_103620142 | 3300031764 | Soil | MTLEQVRSKTGRIREFSALPFLLVATVSLLGAFFRAQPQTVTGGPVNTGDVAWM |
| Ga0306922_115348751 | 3300032001 | Soil | MTLEQVRSKTGRIREFSALPFLLVATVSLLGAFFRAQPQTVTGGPVN |
| Ga0307470_105874841 | 3300032174 | Hardwood Forest Soil | MTLEQVRSKTERIREFSALPFLIVAGVSVLGAVFRG |
| Ga0307471_1024712892 | 3300032180 | Hardwood Forest Soil | MTLAMVRRKTERIREFSALPFLLIAAVSVAGALVRPAPQTVTGGPINPGDVA |
| Ga0310812_100977022 | 3300032421 | Soil | MTLADVRSKTDRIREYSAIPFLLVAAVSVAGAFFRSEPQAVTGGPINAGDTAWML |
| Ga0310810_110196292 | 3300033412 | Soil | MTLAMVRRKTERIRAFSALPFLLIAAVSLGGALFRPQPQSVTG |
| ⦗Top⦘ |