| Basic Information | |
|---|---|
| Family ID | F059087 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 51 residues |
| Representative Sequence | LKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.85 % |
| % of genes near scaffold ends (potentially truncated) | 23.88 % |
| % of genes from short scaffolds (< 2000 bps) | 96.27 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.672 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (7.463 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.612 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.46% β-sheet: 0.00% Coil/Unstructured: 83.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF04563 | RNA_pol_Rpb2_1 | 42.54 |
| PF00542 | Ribosomal_L12 | 33.58 |
| PF16320 | Ribosomal_L12_N | 14.93 |
| PF00687 | Ribosomal_L1 | 1.49 |
| PF04997 | RNA_pol_Rpb1_1 | 0.75 |
| PF04561 | RNA_pol_Rpb2_2 | 0.75 |
| PF10385 | RNA_pol_Rpb2_45 | 0.75 |
| PF00466 | Ribosomal_L10 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0085 | DNA-directed RNA polymerase, beta subunit/140 kD subunit | Transcription [K] | 43.28 |
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 33.58 |
| COG0081 | Ribosomal protein L1 | Translation, ribosomal structure and biogenesis [J] | 1.49 |
| COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.75 |
| COG0244 | Ribosomal protein L10 | Translation, ribosomal structure and biogenesis [J] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.33 % |
| Unclassified | root | N/A | 15.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10599584 | Not Available | 524 | Open in IMG/M |
| 3300004121|Ga0058882_1764127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300004768|Ga0007762_1591201 | All Organisms → cellular organisms → Bacteria | 2328 | Open in IMG/M |
| 3300004798|Ga0058859_11725459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca | 527 | Open in IMG/M |
| 3300004800|Ga0058861_12074967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
| 3300005169|Ga0066810_10058452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300005177|Ga0066690_10145019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
| 3300005327|Ga0070658_10949959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300005328|Ga0070676_10120240 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300005331|Ga0070670_100471066 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005332|Ga0066388_108726404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005334|Ga0068869_100595237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300005335|Ga0070666_10885631 | Not Available | 659 | Open in IMG/M |
| 3300005335|Ga0070666_11075782 | Not Available | 597 | Open in IMG/M |
| 3300005337|Ga0070682_100559148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300005338|Ga0068868_100065730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2881 | Open in IMG/M |
| 3300005355|Ga0070671_101935070 | Not Available | 524 | Open in IMG/M |
| 3300005436|Ga0070713_100148548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2083 | Open in IMG/M |
| 3300005439|Ga0070711_101701513 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 553 | Open in IMG/M |
| 3300005441|Ga0070700_100815581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300005457|Ga0070662_100365541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300005459|Ga0068867_101876917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
| 3300005466|Ga0070685_10388363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
| 3300005511|Ga0077121_10342597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1077 | Open in IMG/M |
| 3300005511|Ga0077121_10390922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 977 | Open in IMG/M |
| 3300005513|Ga0077120_1240966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300005534|Ga0070735_10673822 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 612 | Open in IMG/M |
| 3300005541|Ga0070733_10624597 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 723 | Open in IMG/M |
| 3300005541|Ga0070733_10749425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300005546|Ga0070696_100689072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300005547|Ga0070693_100240439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1195 | Open in IMG/M |
| 3300005557|Ga0066704_10545933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300005560|Ga0066670_10578772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 685 | Open in IMG/M |
| 3300005615|Ga0070702_101105508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300005617|Ga0068859_103023987 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 514 | Open in IMG/M |
| 3300005640|Ga0075035_1090940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300005646|Ga0075040_1098178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300005650|Ga0075038_10152283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1487 | Open in IMG/M |
| 3300005650|Ga0075038_11375499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300005712|Ga0070764_10357496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
| 3300005718|Ga0068866_10305031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 996 | Open in IMG/M |
| 3300005827|Ga0074478_1577927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300005834|Ga0068851_10968188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
| 3300005843|Ga0068860_101423266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300005844|Ga0068862_101508751 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 678 | Open in IMG/M |
| 3300005937|Ga0081455_10349349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1044 | Open in IMG/M |
| 3300005944|Ga0066788_10185405 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 538 | Open in IMG/M |
| 3300005950|Ga0066787_10106930 | Not Available | 601 | Open in IMG/M |
| 3300005983|Ga0081540_1111922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1152 | Open in IMG/M |
| 3300005993|Ga0080027_10352202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 590 | Open in IMG/M |
| 3300005994|Ga0066789_10337678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300006028|Ga0070717_11414490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
| 3300006031|Ga0066651_10811614 | Not Available | 508 | Open in IMG/M |
| 3300006057|Ga0075026_100617593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300006237|Ga0097621_100378191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1264 | Open in IMG/M |
| 3300006237|Ga0097621_101231634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300006358|Ga0068871_101511851 | Not Available | 634 | Open in IMG/M |
| 3300006426|Ga0075037_1245266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002 | 1085 | Open in IMG/M |
| 3300006638|Ga0075522_10391181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300009093|Ga0105240_12177374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 575 | Open in IMG/M |
| 3300009101|Ga0105247_11051994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
| 3300009984|Ga0105029_118891 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 569 | Open in IMG/M |
| 3300010043|Ga0126380_11313628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300010047|Ga0126382_10942851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002 | 751 | Open in IMG/M |
| 3300010147|Ga0126319_1330883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300010358|Ga0126370_11146471 | Not Available | 719 | Open in IMG/M |
| 3300010359|Ga0126376_11885359 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 637 | Open in IMG/M |
| 3300010361|Ga0126378_12431615 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 598 | Open in IMG/M |
| 3300010869|Ga0126359_1220054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300011120|Ga0150983_12216853 | Not Available | 667 | Open in IMG/M |
| 3300011120|Ga0150983_14353785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca | 629 | Open in IMG/M |
| 3300012212|Ga0150985_120250498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 600 | Open in IMG/M |
| 3300012717|Ga0157609_1205053 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 672 | Open in IMG/M |
| 3300012900|Ga0157292_10310348 | Not Available | 569 | Open in IMG/M |
| 3300012924|Ga0137413_10290267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300012929|Ga0137404_12063682 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 532 | Open in IMG/M |
| 3300012971|Ga0126369_11546718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300013297|Ga0157378_12271270 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 594 | Open in IMG/M |
| 3300013297|Ga0157378_12706853 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 548 | Open in IMG/M |
| 3300013306|Ga0163162_12176552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 636 | Open in IMG/M |
| 3300014501|Ga0182024_10027294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9995 | Open in IMG/M |
| 3300016422|Ga0182039_11288117 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300016445|Ga0182038_11366524 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 634 | Open in IMG/M |
| 3300017792|Ga0163161_11493283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002 | 593 | Open in IMG/M |
| 3300017973|Ga0187780_10685849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 738 | Open in IMG/M |
| 3300018476|Ga0190274_12315559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300019377|Ga0190264_10111153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1315 | Open in IMG/M |
| 3300020027|Ga0193752_1028828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2559 | Open in IMG/M |
| 3300020060|Ga0193717_1033367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1981 | Open in IMG/M |
| 3300020580|Ga0210403_11097033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 618 | Open in IMG/M |
| 3300021181|Ga0210388_11322925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300021372|Ga0213877_10265184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300021401|Ga0210393_11445132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca | 548 | Open in IMG/M |
| 3300021475|Ga0210392_11491009 | Not Available | 505 | Open in IMG/M |
| 3300022506|Ga0242648_1037198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300022509|Ga0242649_1012749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
| 3300022711|Ga0242674_1058196 | Not Available | 545 | Open in IMG/M |
| 3300025901|Ga0207688_10096356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1704 | Open in IMG/M |
| 3300025906|Ga0207699_10608388 | Not Available | 796 | Open in IMG/M |
| 3300025911|Ga0207654_11282419 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 534 | Open in IMG/M |
| 3300025915|Ga0207693_10409329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
| 3300025925|Ga0207650_11717084 | Not Available | 532 | Open in IMG/M |
| 3300025928|Ga0207700_10763520 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 864 | Open in IMG/M |
| 3300026089|Ga0207648_10373129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002 | 1289 | Open in IMG/M |
| 3300026557|Ga0179587_10845282 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 604 | Open in IMG/M |
| 3300026881|Ga0207739_1009321 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 1111 | Open in IMG/M |
| 3300027517|Ga0209113_1020682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300027853|Ga0209274_10377729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
| 3300027986|Ga0209168_10155047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300028379|Ga0268266_11007058 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 806 | Open in IMG/M |
| 3300029989|Ga0311365_11238201 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 643 | Open in IMG/M |
| 3300030520|Ga0311372_11766907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
| 3300030872|Ga0265723_1032839 | Not Available | 509 | Open in IMG/M |
| 3300030888|Ga0265769_106129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300030916|Ga0075386_12075421 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 529 | Open in IMG/M |
| 3300031057|Ga0170834_108397784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300031234|Ga0302325_11494926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
| 3300031247|Ga0265340_10451506 | Not Available | 566 | Open in IMG/M |
| 3300031484|Ga0314822_100692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1873 | Open in IMG/M |
| 3300031487|Ga0314823_101253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1927 | Open in IMG/M |
| 3300031708|Ga0310686_102217514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 558 | Open in IMG/M |
| 3300031708|Ga0310686_105970409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300031708|Ga0310686_108966549 | Not Available | 584 | Open in IMG/M |
| 3300031718|Ga0307474_10944345 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 683 | Open in IMG/M |
| 3300031718|Ga0307474_11441577 | Not Available | 542 | Open in IMG/M |
| 3300031722|Ga0311351_11126391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300031740|Ga0307468_100470086 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 986 | Open in IMG/M |
| 3300031852|Ga0307410_10859797 | Not Available | 775 | Open in IMG/M |
| 3300031879|Ga0306919_10892596 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 682 | Open in IMG/M |
| 3300031912|Ga0306921_11416598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 763 | Open in IMG/M |
| 3300032017|Ga0310899_10410697 | Not Available | 651 | Open in IMG/M |
| 3300032174|Ga0307470_11006436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300032896|Ga0335075_10914413 | Not Available | 802 | Open in IMG/M |
| 3300033180|Ga0307510_10518443 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.48% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 3.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.73% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.24% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.49% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.49% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.49% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.75% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.75% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.75% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004768 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005513 | Combined assembly of arab plate scrape CL_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005640 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005646 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026881 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 15 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031484 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031487 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_105995842 | 3300001661 | Forest Soil | LKNSVCVHISFTHPPSALRSPMGAVAFAIGLKLLVPTPGKNGSPAVKDLFE* |
| Ga0058882_17641272 | 3300004121 | Forest Soil | LKSRAVVHISFTHPPSASLAPMGAVVFAIGLKLLVPTPGKHGFLAAKDFIG* |
| Ga0007762_15912011 | 3300004768 | Freshwater Lake | LKNSVCVLNSFTHPPSVIRSPMGEVAFAIGLKLLVPTPGKNGSRAAKDTLE* |
| Ga0058859_117254592 | 3300004798 | Host-Associated | LKSRVVVHISFTHPPSAELPLMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0058861_120749672 | 3300004800 | Host-Associated | LKNSERVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG* |
| Ga0066810_100584522 | 3300005169 | Soil | LKNSVCVHISFTHPPSANAKPMGAVAFAIGMKLLVPTPGKHGFTAVKDLHG* |
| Ga0066690_101450193 | 3300005177 | Soil | LKSRAVVHISFTHPPSANARSMGSVAFAIGLKLLVPTPGKHGLAAVKDFIE* |
| Ga0070658_109499592 | 3300005327 | Corn Rhizosphere | LKNSVCVHISFTHPPSANPKPMGAVAFAIGMKLLVPTPGKHGLAAVKDFIE* |
| Ga0070676_101202402 | 3300005328 | Miscanthus Rhizosphere | LKSRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE* |
| Ga0070670_1004710661 | 3300005331 | Switchgrass Rhizosphere | KGAPGLKNSVCVHISFTHPPSASRSPMGAVAFAIGLKLLVPTPGKHGFSP* |
| Ga0066388_1087264042 | 3300005332 | Tropical Forest Soil | LKHRVSVHISFTHHPIGEKPSPMGAVAFAIGMKLLVPTPGKHGLTAVKDLFE* |
| Ga0068869_1005952372 | 3300005334 | Miscanthus Rhizosphere | LKSRVSVHISFTHPPSANLSPVGPVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0070666_108856311 | 3300005335 | Switchgrass Rhizosphere | LKSRVSVHISFTHPPSANLSPMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0070666_110757822 | 3300005335 | Switchgrass Rhizosphere | LKSRVVVHISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0070682_1005591482 | 3300005337 | Corn Rhizosphere | LKSRVVVHISFTHPPSAEPPPVGSVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0068868_1000657302 | 3300005338 | Miscanthus Rhizosphere | LKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVTTPGKHGLTAVKDFIE* |
| Ga0070671_1019350701 | 3300005355 | Switchgrass Rhizosphere | LKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGF |
| Ga0070713_1001485483 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LKNRVSVHISFTHHPIGGTPSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE* |
| Ga0070711_1017015132 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LKNRVSVHISFTHHPIGETQPVGAVAFAIGLKLLVPTPGKHGFTAVKDLHE* |
| Ga0070700_1008155812 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE* |
| Ga0070662_1003655412 | 3300005457 | Corn Rhizosphere | LKSRVVVHISFTHPPSAEPPLMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0068867_1018769172 | 3300005459 | Miscanthus Rhizosphere | LKNSVCVHISFTHPPSANTKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE* |
| Ga0070685_103883632 | 3300005466 | Switchgrass Rhizosphere | LKNSVCVHISFTHPPSAKQAPMGAVAFAIGLKLLVPTPGNNGFRAVKDFIE* |
| Ga0077121_103425972 | 3300005511 | Arabidopsis Rhizosphere | LKSRMSVHISFTHHPIGKPLPVGAVAFAIGLKLLVPTPGKHGLVAVKDLHE* |
| Ga0077121_103909222 | 3300005511 | Arabidopsis Rhizosphere | LKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGNNGFRAVKDFIE* |
| Ga0077120_12409662 | 3300005513 | Arabidopsis Rhizosphere | LKSRVVVHISFTHPPSADHPPMGAVAFAIGLKLLVPTPGKHGSWAVKDFIG* |
| Ga0070735_106738222 | 3300005534 | Surface Soil | LKSRAVVHISFTHHPSAISTPMGQVAFAIGLKLLVPTPGKLGPSAVKDFIG* |
| Ga0070733_106245971 | 3300005541 | Surface Soil | LKSRVVVHTSFTHPPSANQAPMGPVAFAIGLKLKVPTPGKLGSLAVKDLHG* |
| Ga0070733_107494252 | 3300005541 | Surface Soil | LKSRVVVHISFTHHPSANLSPMGPVAFAIGLKLLVPTPGKHGHSAVKDFIG* |
| Ga0070696_1006890722 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0070693_1002404393 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSRVSVHISFTHPPSANPSPVGSVAFAIGLKLLVPTPGKHGLAAVKDLHG* |
| Ga0066704_105459332 | 3300005557 | Soil | LKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE* |
| Ga0066670_105787722 | 3300005560 | Soil | LKNSESVHISFTHPPSANARSMGSVAFAIGLKLLVPTPGKHGLAAVKDFIE* |
| Ga0070702_1011055082 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGSRAVKDFIE* |
| Ga0068859_1030239871 | 3300005617 | Switchgrass Rhizosphere | LKSRMSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE* |
| Ga0075035_10909402 | 3300005640 | Permafrost Soil | LKNSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE* |
| Ga0075040_10981782 | 3300005646 | Permafrost Soil | LKNSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGLRAVKDTIE* |
| Ga0075038_101522832 | 3300005650 | Permafrost Soil | LKNSVCVHISFTHSPSAFAKPVGAVAFAIGLKLLVPTPGKNGSRAVKDTIE* |
| Ga0075038_113754992 | 3300005650 | Permafrost Soil | LKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDLSA* |
| Ga0070764_103574962 | 3300005712 | Soil | LKSRVVVHISFTHPPSANLSPMGAVVFAIGLKLLVPTPGKHGFPAVKDFIE* |
| Ga0068866_103050312 | 3300005718 | Miscanthus Rhizosphere | LKRRVRVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE* |
| Ga0074478_15779272 | 3300005827 | Sediment (Intertidal) | LKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE* |
| Ga0068851_109681882 | 3300005834 | Corn Rhizosphere | LKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHG |
| Ga0068860_1014232662 | 3300005843 | Switchgrass Rhizosphere | LKSRVSVHISFTHHPIGASPPMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0068862_1015087512 | 3300005844 | Switchgrass Rhizosphere | LKNRMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE* |
| Ga0081455_103493492 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LKSRVVVHISFTHHPIGKTLPVGAVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0066788_101854051 | 3300005944 | Soil | VCVHISFTHPPSANARPMGAVAFAIGLKLLVPTPGKNGSRAVKDFFE* |
| Ga0066787_101069302 | 3300005950 | Soil | LKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTLE* |
| Ga0081540_11119222 | 3300005983 | Tabebuia Heterophylla Rhizosphere | LKSRMSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0080027_103522022 | 3300005993 | Prmafrost Soil | LKNSVCVHISFTHPPSANARPMGAVAFAIGLKLLVPTPGKNGSRAVKDFFE* |
| Ga0066789_103376782 | 3300005994 | Soil | LKNSVCVHISFTHPPSANARPMGAVPFAIGLKLLVPTPGKNGSRAVKDFFE* |
| Ga0070717_114144902 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LKNSVCVHISFTHPPSAKQAPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE* |
| Ga0066651_108116141 | 3300006031 | Soil | LKSRVVVHISFTHPPSAEPPPVGSVAFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0075026_1006175932 | 3300006057 | Watersheds | LKNRLSVHISFTHPPSAILSPMGSVAFAIGLKLLVPTPGKHGSWAVKDFIG* |
| Ga0097621_1003781912 | 3300006237 | Miscanthus Rhizosphere | LKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE* |
| Ga0097621_1012316342 | 3300006237 | Miscanthus Rhizosphere | LKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVTTPGKHGLTAVKDFIG* |
| Ga0068871_1015118511 | 3300006358 | Miscanthus Rhizosphere | LKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHG |
| Ga0075037_12452661 | 3300006426 | Permafrost Soil | NSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGLRAVKDTIE* |
| Ga0075522_103911812 | 3300006638 | Arctic Peat Soil | LKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTLE* |
| Ga0105240_121773742 | 3300009093 | Corn Rhizosphere | LKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIA* |
| Ga0105247_110519942 | 3300009101 | Switchgrass Rhizosphere | MSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE* |
| Ga0105029_1188911 | 3300009984 | Switchgrass Rhizosphere | GVHISFTHPPSANRSPMGAVAFAIGLKLLVPTPGKNGFRAVKDTIE* |
| Ga0126380_113136282 | 3300010043 | Tropical Forest Soil | LKSRVSVHISFTHHPIGGQTPPVGAVAFAIGLKLLVPTPGKHGFTAVKDLIA* |
| Ga0126382_109428511 | 3300010047 | Tropical Forest Soil | RRRQGRVEVTRRLSGLKSRMSVHISFTHPPSAKRSPMGAVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0126319_13308832 | 3300010147 | Soil | LKSRAVVHISFTHPPSAIPSPMGAVVFAIGLKLLVPTPGKHGLTAVKDFIE* |
| Ga0126370_111464712 | 3300010358 | Tropical Forest Soil | LKRRVVVHISFTHHPSAMLSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG* |
| Ga0126376_118853592 | 3300010359 | Tropical Forest Soil | LKSRVSVHISFTHHPIGDNPPVGAVEFAIGLKLLVPTPGKHGLTAVKDLHE* |
| Ga0126378_124316152 | 3300010361 | Tropical Forest Soil | LKSRVSVHISFTHPSPAGRLPVSAVAFAIGLKLLVPTPGKHGFPAVKDFIG* |
| Ga0126359_12200542 | 3300010869 | Boreal Forest Soil | LKIREVVHISFTRPPRLIRPVEGLAAPAIGLKLLVPTPGKNGSRAVKDTLE* |
| Ga0150983_122168531 | 3300011120 | Forest Soil | LKSRVSVHISFTHHPIGGTQPVGAVAFAIGLKLLVPTPGKHGSWAVKDFIE* |
| Ga0150983_143537851 | 3300011120 | Forest Soil | LKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGFSAVKDFIG* |
| Ga0150985_1202504982 | 3300012212 | Avena Fatua Rhizosphere | MSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGFWAVKDFIG* |
| Ga0157609_12050532 | 3300012717 | Freshwater | CVLNSFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGFRAVKDIIE* |
| Ga0157292_103103481 | 3300012900 | Soil | SGLKNRVSVHISFAHPPSAILSPEGSVAFAIGLKLLVPTPGKHGFRAVKDFIE* |
| Ga0137413_102902673 | 3300012924 | Vadose Zone Soil | MGVHISFTPPPFGIHPPEGPVAFAIGLKLLVPTPGKHGLTAVKDFIE* |
| Ga0137404_120636822 | 3300012929 | Vadose Zone Soil | MGVHISFTPPPFGVHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE* |
| Ga0126369_115467182 | 3300012971 | Tropical Forest Soil | LKRRAVVHISFTHHPSAILSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG* |
| Ga0157378_122712702 | 3300013297 | Miscanthus Rhizosphere | VCVHISFTHPPSANAKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIG* |
| Ga0157378_127068532 | 3300013297 | Miscanthus Rhizosphere | VCVHISFTHPPSANTKPMGAVAFAIGLKLLVPTPGKHGLAAVKDLHE* |
| Ga0163162_121765522 | 3300013306 | Switchgrass Rhizosphere | LKSRVSVHISFTHHPTGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIA* |
| Ga0182024_100272949 | 3300014501 | Permafrost | LKSRAVVHISFTHPPSARQAPVGAVAFAIGLKLLVTTPGKHGFAAVKDFIE* |
| Ga0182039_112881172 | 3300016422 | Soil | LKSRVSVHISFTHPPSAKPSPVGSVAFAIGLKLLVPTPGKHSLTAVKDLHA |
| Ga0182038_113665241 | 3300016445 | Soil | RGLKRRVGVHISLTHHPSAIPSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG |
| Ga0163161_114932831 | 3300017792 | Switchgrass Rhizosphere | RVEVTRRHRGLKSRVVVHISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLTAVKDFI |
| Ga0187780_106858492 | 3300017973 | Tropical Peatland | LKSRVVVHILFTHPPSASASPVGVVAFAIGLKLLVPTLGKHGWLAVKDFIG |
| Ga0190274_123155592 | 3300018476 | Soil | MSVHISFTHPPSAIRSPMGVVAFAIGLKLLVPTPGKNGSRAVKDTIE |
| Ga0190264_101111533 | 3300019377 | Soil | MSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE |
| Ga0193752_10288282 | 3300020027 | Soil | MGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE |
| Ga0193717_10333674 | 3300020060 | Soil | LKNRMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE |
| Ga0210403_110970332 | 3300020580 | Soil | LKSRVSVHISFTHHPIGGTQPVGAVAFAIGLKLLVPTPGKHGSWAVKDFIE |
| Ga0210388_113229252 | 3300021181 | Soil | LKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGFSAVKDFIG |
| Ga0213877_102651841 | 3300021372 | Bulk Soil | LKSRAVVHISFTHPPSASLSPVGAVAFAIGLKLKVPTPGKHGSSAVKDLH |
| Ga0210393_114451322 | 3300021401 | Soil | LKSRVVVHISFTHPPSAKLPPMGAVAFAIGLKLLVPTPGKHGFAAVKDFI |
| Ga0210392_114910092 | 3300021475 | Soil | KPRERTYFVHPPPHRRKTPPVGPVAFAIGLKLLVPTPGKHGLTAVKDFIE |
| Ga0242648_10371982 | 3300022506 | Soil | LKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFPAVKDIIG |
| Ga0242649_10127492 | 3300022509 | Soil | LKNRKAVHISFTHPPSASPSPMGAVVFAIGLKLLVPTPGKHGFSAVKDFIG |
| Ga0242674_10581961 | 3300022711 | Soil | LKNRKAVHISFTHPPSASPSPMGAVVFAIGLKLLVPTPGKHGFAAVKDFIG |
| Ga0207688_100963563 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE |
| Ga0207699_106083883 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSRVSVHISFTHHPIGKNQPVGAVAFAIGLKLLVPTPGKHGLTAVKDLHE |
| Ga0207654_112824192 | 3300025911 | Corn Rhizosphere | RVSVHISFTHPPSANLSPMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE |
| Ga0207693_104093293 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSRVSVHISFTHHPIGETQPVGAVAFAIGLKLLVPTPGKHGCWP |
| Ga0207650_117170841 | 3300025925 | Switchgrass Rhizosphere | CQDQEAARRCWRQGRVEVTRRHRGLKSRAVVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGFWAVKDFIE |
| Ga0207700_107635201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RVEVTRRLSGLKSRVSVHISFTHHPIGGTPSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE |
| Ga0207648_103731292 | 3300026089 | Miscanthus Rhizosphere | LKSRVVVHISFTHPPSAEPPLMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE |
| Ga0179587_108452822 | 3300026557 | Vadose Zone Soil | VVHISFTHPPSAIAKPMGAVAFAIGLKLLVPTPGKHGLAAVKDFIE |
| Ga0207739_10093212 | 3300026881 | Tropical Forest Soil | HISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLTAVKDLHE |
| Ga0209113_10206822 | 3300027517 | Forest Soil | LKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIG |
| Ga0209274_103777292 | 3300027853 | Soil | LKNRGVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFSAVKDFIG |
| Ga0209168_101550472 | 3300027986 | Surface Soil | LKSRAVVHISFTHHPSAISTPMGQVAFAIGLKLLVPTPGKLGPSAVKDFIG |
| Ga0268266_110070582 | 3300028379 | Switchgrass Rhizosphere | KGAAGLKNSVRVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG |
| Ga0311365_112382012 | 3300029989 | Fen | GLKNSVCVHISFTHPPSAIRSPMGVVAFAIGLKLLVPTPGKNGSRAVKDLFE |
| Ga0311372_117669072 | 3300030520 | Palsa | LKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGSSAVKDFIG |
| Ga0265723_10328393 | 3300030872 | Soil | LKNRVVLHISFTHPPSARQAPVGAVVFAIGLKLLVPTPGKHGFTAVKDFIE |
| Ga0265769_1061292 | 3300030888 | Soil | LKNRVVVHISFTHPPSARQAPVGAVVFAIGLKLLVPTPGKHGFTAVKDFIE |
| Ga0075386_120754211 | 3300030916 | Soil | RQGRVEVTRRHRGLKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLIE |
| Ga0170834_1083977842 | 3300031057 | Forest Soil | LKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIE |
| Ga0302325_114949263 | 3300031234 | Palsa | LKRRAVVHISFTHPPSAIDAPMGAVVFAIGLKLLVPTPGKHGYWAVKDLYE |
| Ga0265340_104515062 | 3300031247 | Rhizosphere | LKSRAVVHISFTHPPSAKNPPMGAVAFAIGLKLLVPTPGKHGFWAVKDTLE |
| Ga0314822_1006922 | 3300031484 | Soil | MGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE |
| Ga0314823_1012534 | 3300031487 | Soil | MGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE |
| Ga0310686_1022175141 | 3300031708 | Soil | QGRVEVARRLGGLKNRMAVHISFTHPPSASSSPMGAVVFAIGLKLLVPTPGKHGSSAVKDFIG |
| Ga0310686_1059704092 | 3300031708 | Soil | LKRRAVVHISFTHPPSAKLSPMGGVVFAIGLKLLVPTPGKHGSWAVKDFIE |
| Ga0310686_1089665491 | 3300031708 | Soil | LKRRAVVHISFTHPPSAIDAPVGAMVFAIGLKLLLPTPGKHGLWAVKDLHE |
| Ga0307474_109443451 | 3300031718 | Hardwood Forest Soil | KSRVVVHISFTHPPSAFLSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIE |
| Ga0307474_114415772 | 3300031718 | Hardwood Forest Soil | LKSRVVVHISFTHPPSAFLSPMGAVAFAIGLKLLVPTPGKHGS |
| Ga0311351_111263912 | 3300031722 | Fen | LKNSERVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG |
| Ga0307468_1004700861 | 3300031740 | Hardwood Forest Soil | GLKNSVCVHISFTHPPSANLSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE |
| Ga0307410_108597972 | 3300031852 | Rhizosphere | MSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE |
| Ga0306919_108925962 | 3300031879 | Soil | SRVVVHISFTHPPSASPSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIG |
| Ga0306921_114165982 | 3300031912 | Soil | LKRRVVVHISFTHHPSASLSPMGSVAFAIGLKLLVPTPGKHGFPAVKDFIG |
| Ga0310899_104106972 | 3300032017 | Soil | LKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFRAVKDFIE |
| Ga0307470_110064362 | 3300032174 | Hardwood Forest Soil | LKSRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGSWAVKDFIG |
| Ga0335075_109144132 | 3300032896 | Soil | LKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGLLAVKDLHE |
| Ga0307510_105184432 | 3300033180 | Ectomycorrhiza | LKSRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE |
| ⦗Top⦘ |