NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F059087

Metagenome / Metatranscriptome Family F059087

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059087
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 51 residues
Representative Sequence LKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE
Number of Associated Samples 124
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.85 %
% of genes near scaffold ends (potentially truncated) 23.88 %
% of genes from short scaffolds (< 2000 bps) 96.27 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.672 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(7.463 % of family members)
Environment Ontology (ENVO) Unclassified
(27.612 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.045 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.46%    β-sheet: 0.00%    Coil/Unstructured: 83.54%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF04563RNA_pol_Rpb2_1 42.54
PF00542Ribosomal_L12 33.58
PF16320Ribosomal_L12_N 14.93
PF00687Ribosomal_L1 1.49
PF04997RNA_pol_Rpb1_1 0.75
PF04561RNA_pol_Rpb2_2 0.75
PF10385RNA_pol_Rpb2_45 0.75
PF00466Ribosomal_L10 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0085DNA-directed RNA polymerase, beta subunit/140 kD subunitTranscription [K] 43.28
COG0222Ribosomal protein L7/L12Translation, ribosomal structure and biogenesis [J] 33.58
COG0081Ribosomal protein L1Translation, ribosomal structure and biogenesis [J] 1.49
COG0086DNA-directed RNA polymerase, beta' subunit/160 kD subunitTranscription [K] 0.75
COG0244Ribosomal protein L10Translation, ribosomal structure and biogenesis [J] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.33 %
UnclassifiedrootN/A15.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001661|JGI12053J15887_10599584Not Available524Open in IMG/M
3300004121|Ga0058882_1764127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300004768|Ga0007762_1591201All Organisms → cellular organisms → Bacteria2328Open in IMG/M
3300004798|Ga0058859_11725459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca527Open in IMG/M
3300004800|Ga0058861_12074967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria547Open in IMG/M
3300005169|Ga0066810_10058452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria772Open in IMG/M
3300005177|Ga0066690_10145019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1557Open in IMG/M
3300005327|Ga0070658_10949959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria747Open in IMG/M
3300005328|Ga0070676_10120240All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300005331|Ga0070670_100471066All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300005332|Ga0066388_108726404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300005334|Ga0068869_100595237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria933Open in IMG/M
3300005335|Ga0070666_10885631Not Available659Open in IMG/M
3300005335|Ga0070666_11075782Not Available597Open in IMG/M
3300005337|Ga0070682_100559148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300005338|Ga0068868_100065730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2881Open in IMG/M
3300005355|Ga0070671_101935070Not Available524Open in IMG/M
3300005436|Ga0070713_100148548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2083Open in IMG/M
3300005439|Ga0070711_101701513All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri553Open in IMG/M
3300005441|Ga0070700_100815581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300005457|Ga0070662_100365541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1185Open in IMG/M
3300005459|Ga0068867_101876917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300005466|Ga0070685_10388363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria964Open in IMG/M
3300005511|Ga0077121_10342597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1077Open in IMG/M
3300005511|Ga0077121_10390922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria977Open in IMG/M
3300005513|Ga0077120_1240966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300005534|Ga0070735_10673822All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri612Open in IMG/M
3300005541|Ga0070733_10624597All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri723Open in IMG/M
3300005541|Ga0070733_10749425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300005546|Ga0070696_100689072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria832Open in IMG/M
3300005547|Ga0070693_100240439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1195Open in IMG/M
3300005557|Ga0066704_10545933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria756Open in IMG/M
3300005560|Ga0066670_10578772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300005615|Ga0070702_101105508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300005617|Ga0068859_103023987All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri514Open in IMG/M
3300005640|Ga0075035_1090940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria857Open in IMG/M
3300005646|Ga0075040_1098178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300005650|Ga0075038_10152283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1487Open in IMG/M
3300005650|Ga0075038_11375499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300005712|Ga0070764_10357496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria855Open in IMG/M
3300005718|Ga0068866_10305031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria996Open in IMG/M
3300005827|Ga0074478_1577927All Organisms → cellular organisms → Bacteria → Proteobacteria1050Open in IMG/M
3300005834|Ga0068851_10968188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria536Open in IMG/M
3300005843|Ga0068860_101423266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria714Open in IMG/M
3300005844|Ga0068862_101508751All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri678Open in IMG/M
3300005937|Ga0081455_10349349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1044Open in IMG/M
3300005944|Ga0066788_10185405All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri538Open in IMG/M
3300005950|Ga0066787_10106930Not Available601Open in IMG/M
3300005983|Ga0081540_1111922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1152Open in IMG/M
3300005993|Ga0080027_10352202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria590Open in IMG/M
3300005994|Ga0066789_10337678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300006028|Ga0070717_11414490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300006031|Ga0066651_10811614Not Available508Open in IMG/M
3300006057|Ga0075026_100617593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300006237|Ga0097621_100378191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1264Open in IMG/M
3300006237|Ga0097621_101231634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria705Open in IMG/M
3300006358|Ga0068871_101511851Not Available634Open in IMG/M
3300006426|Ga0075037_1245266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 60021085Open in IMG/M
3300006638|Ga0075522_10391181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300009093|Ga0105240_12177374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria575Open in IMG/M
3300009101|Ga0105247_11051994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300009984|Ga0105029_118891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri569Open in IMG/M
3300010043|Ga0126380_11313628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria630Open in IMG/M
3300010047|Ga0126382_10942851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002751Open in IMG/M
3300010147|Ga0126319_1330883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria943Open in IMG/M
3300010358|Ga0126370_11146471Not Available719Open in IMG/M
3300010359|Ga0126376_11885359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri637Open in IMG/M
3300010361|Ga0126378_12431615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri598Open in IMG/M
3300010869|Ga0126359_1220054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria571Open in IMG/M
3300011120|Ga0150983_12216853Not Available667Open in IMG/M
3300011120|Ga0150983_14353785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca629Open in IMG/M
3300012212|Ga0150985_120250498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria600Open in IMG/M
3300012717|Ga0157609_1205053All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri672Open in IMG/M
3300012900|Ga0157292_10310348Not Available569Open in IMG/M
3300012924|Ga0137413_10290267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1139Open in IMG/M
3300012929|Ga0137404_12063682All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri532Open in IMG/M
3300012971|Ga0126369_11546718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300013297|Ga0157378_12271270All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri594Open in IMG/M
3300013297|Ga0157378_12706853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri548Open in IMG/M
3300013306|Ga0163162_12176552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium636Open in IMG/M
3300014501|Ga0182024_10027294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales9995Open in IMG/M
3300016422|Ga0182039_11288117All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300016445|Ga0182038_11366524All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri634Open in IMG/M
3300017792|Ga0163161_11493283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 6002593Open in IMG/M
3300017973|Ga0187780_10685849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300018476|Ga0190274_12315559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria634Open in IMG/M
3300019377|Ga0190264_10111153All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1315Open in IMG/M
3300020027|Ga0193752_1028828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2559Open in IMG/M
3300020060|Ga0193717_1033367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1981Open in IMG/M
3300020580|Ga0210403_11097033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium618Open in IMG/M
3300021181|Ga0210388_11322925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300021372|Ga0213877_10265184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria574Open in IMG/M
3300021401|Ga0210393_11445132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aurantiaca548Open in IMG/M
3300021475|Ga0210392_11491009Not Available505Open in IMG/M
3300022506|Ga0242648_1037198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300022509|Ga0242649_1012749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria918Open in IMG/M
3300022711|Ga0242674_1058196Not Available545Open in IMG/M
3300025901|Ga0207688_10096356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1704Open in IMG/M
3300025906|Ga0207699_10608388Not Available796Open in IMG/M
3300025911|Ga0207654_11282419All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri534Open in IMG/M
3300025915|Ga0207693_10409329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1060Open in IMG/M
3300025925|Ga0207650_11717084Not Available532Open in IMG/M
3300025928|Ga0207700_10763520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri864Open in IMG/M
3300026089|Ga0207648_10373129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SEMIA 60021289Open in IMG/M
3300026557|Ga0179587_10845282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri604Open in IMG/M
3300026881|Ga0207739_1009321All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri1111Open in IMG/M
3300027517|Ga0209113_1020682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria879Open in IMG/M
3300027853|Ga0209274_10377729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales731Open in IMG/M
3300027986|Ga0209168_10155047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1159Open in IMG/M
3300028379|Ga0268266_11007058All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri806Open in IMG/M
3300029989|Ga0311365_11238201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri643Open in IMG/M
3300030520|Ga0311372_11766907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria740Open in IMG/M
3300030872|Ga0265723_1032839Not Available509Open in IMG/M
3300030888|Ga0265769_106129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria749Open in IMG/M
3300030916|Ga0075386_12075421All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri529Open in IMG/M
3300031057|Ga0170834_108397784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1275Open in IMG/M
3300031234|Ga0302325_11494926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria870Open in IMG/M
3300031247|Ga0265340_10451506Not Available566Open in IMG/M
3300031484|Ga0314822_100692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1873Open in IMG/M
3300031487|Ga0314823_101253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1927Open in IMG/M
3300031708|Ga0310686_102217514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium558Open in IMG/M
3300031708|Ga0310686_105970409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria865Open in IMG/M
3300031708|Ga0310686_108966549Not Available584Open in IMG/M
3300031718|Ga0307474_10944345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri683Open in IMG/M
3300031718|Ga0307474_11441577Not Available542Open in IMG/M
3300031722|Ga0311351_11126391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria602Open in IMG/M
3300031740|Ga0307468_100470086All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri986Open in IMG/M
3300031852|Ga0307410_10859797Not Available775Open in IMG/M
3300031879|Ga0306919_10892596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri682Open in IMG/M
3300031912|Ga0306921_11416598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales763Open in IMG/M
3300032017|Ga0310899_10410697Not Available651Open in IMG/M
3300032174|Ga0307470_11006436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300032896|Ga0335075_10914413Not Available802Open in IMG/M
3300033180|Ga0307510_10518443All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri636Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.48%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil3.73%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.73%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.99%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.24%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.24%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.24%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.49%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.49%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.49%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.49%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.75%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.75%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.75%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.75%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.75%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.75%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.75%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.75%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004768Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005511Combined assembly of arab plate scrape MF_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005513Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005640Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005646Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_057 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005650Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009984Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026881Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 15 (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030888Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031484Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031487Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J15887_1059958423300001661Forest SoilLKNSVCVHISFTHPPSALRSPMGAVAFAIGLKLLVPTPGKNGSPAVKDLFE*
Ga0058882_176412723300004121Forest SoilLKSRAVVHISFTHPPSASLAPMGAVVFAIGLKLLVPTPGKHGFLAAKDFIG*
Ga0007762_159120113300004768Freshwater LakeLKNSVCVLNSFTHPPSVIRSPMGEVAFAIGLKLLVPTPGKNGSRAAKDTLE*
Ga0058859_1172545923300004798Host-AssociatedLKSRVVVHISFTHPPSAELPLMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0058861_1207496723300004800Host-AssociatedLKNSERVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG*
Ga0066810_1005845223300005169SoilLKNSVCVHISFTHPPSANAKPMGAVAFAIGMKLLVPTPGKHGFTAVKDLHG*
Ga0066690_1014501933300005177SoilLKSRAVVHISFTHPPSANARSMGSVAFAIGLKLLVPTPGKHGLAAVKDFIE*
Ga0070658_1094995923300005327Corn RhizosphereLKNSVCVHISFTHPPSANPKPMGAVAFAIGMKLLVPTPGKHGLAAVKDFIE*
Ga0070676_1012024023300005328Miscanthus RhizosphereLKSRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE*
Ga0070670_10047106613300005331Switchgrass RhizosphereKGAPGLKNSVCVHISFTHPPSASRSPMGAVAFAIGLKLLVPTPGKHGFSP*
Ga0066388_10872640423300005332Tropical Forest SoilLKHRVSVHISFTHHPIGEKPSPMGAVAFAIGMKLLVPTPGKHGLTAVKDLFE*
Ga0068869_10059523723300005334Miscanthus RhizosphereLKSRVSVHISFTHPPSANLSPVGPVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0070666_1088563113300005335Switchgrass RhizosphereLKSRVSVHISFTHPPSANLSPMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0070666_1107578223300005335Switchgrass RhizosphereLKSRVVVHISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0070682_10055914823300005337Corn RhizosphereLKSRVVVHISFTHPPSAEPPPVGSVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0068868_10006573023300005338Miscanthus RhizosphereLKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVTTPGKHGLTAVKDFIE*
Ga0070671_10193507013300005355Switchgrass RhizosphereLKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGF
Ga0070713_10014854833300005436Corn, Switchgrass And Miscanthus RhizosphereLKNRVSVHISFTHHPIGGTPSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE*
Ga0070711_10170151323300005439Corn, Switchgrass And Miscanthus RhizosphereLKNRVSVHISFTHHPIGETQPVGAVAFAIGLKLLVPTPGKHGFTAVKDLHE*
Ga0070700_10081558123300005441Corn, Switchgrass And Miscanthus RhizosphereLKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE*
Ga0070662_10036554123300005457Corn RhizosphereLKSRVVVHISFTHPPSAEPPLMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0068867_10187691723300005459Miscanthus RhizosphereLKNSVCVHISFTHPPSANTKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE*
Ga0070685_1038836323300005466Switchgrass RhizosphereLKNSVCVHISFTHPPSAKQAPMGAVAFAIGLKLLVPTPGNNGFRAVKDFIE*
Ga0077121_1034259723300005511Arabidopsis RhizosphereLKSRMSVHISFTHHPIGKPLPVGAVAFAIGLKLLVPTPGKHGLVAVKDLHE*
Ga0077121_1039092223300005511Arabidopsis RhizosphereLKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGNNGFRAVKDFIE*
Ga0077120_124096623300005513Arabidopsis RhizosphereLKSRVVVHISFTHPPSADHPPMGAVAFAIGLKLLVPTPGKHGSWAVKDFIG*
Ga0070735_1067382223300005534Surface SoilLKSRAVVHISFTHHPSAISTPMGQVAFAIGLKLLVPTPGKLGPSAVKDFIG*
Ga0070733_1062459713300005541Surface SoilLKSRVVVHTSFTHPPSANQAPMGPVAFAIGLKLKVPTPGKLGSLAVKDLHG*
Ga0070733_1074942523300005541Surface SoilLKSRVVVHISFTHHPSANLSPMGPVAFAIGLKLLVPTPGKHGHSAVKDFIG*
Ga0070696_10068907223300005546Corn, Switchgrass And Miscanthus RhizosphereLKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0070693_10024043933300005547Corn, Switchgrass And Miscanthus RhizosphereLKSRVSVHISFTHPPSANPSPVGSVAFAIGLKLLVPTPGKHGLAAVKDLHG*
Ga0066704_1054593323300005557SoilLKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE*
Ga0066670_1057877223300005560SoilLKNSESVHISFTHPPSANARSMGSVAFAIGLKLLVPTPGKHGLAAVKDFIE*
Ga0070702_10110550823300005615Corn, Switchgrass And Miscanthus RhizosphereLKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGSRAVKDFIE*
Ga0068859_10302398713300005617Switchgrass RhizosphereLKSRMSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE*
Ga0075035_109094023300005640Permafrost SoilLKNSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE*
Ga0075040_109817823300005646Permafrost SoilLKNSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGLRAVKDTIE*
Ga0075038_1015228323300005650Permafrost SoilLKNSVCVHISFTHSPSAFAKPVGAVAFAIGLKLLVPTPGKNGSRAVKDTIE*
Ga0075038_1137549923300005650Permafrost SoilLKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDLSA*
Ga0070764_1035749623300005712SoilLKSRVVVHISFTHPPSANLSPMGAVVFAIGLKLLVPTPGKHGFPAVKDFIE*
Ga0068866_1030503123300005718Miscanthus RhizosphereLKRRVRVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE*
Ga0074478_157792723300005827Sediment (Intertidal)LKNSVCVHISFTHPPSANHPPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE*
Ga0068851_1096818823300005834Corn RhizosphereLKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHG
Ga0068860_10142326623300005843Switchgrass RhizosphereLKSRVSVHISFTHHPIGASPPMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0068862_10150875123300005844Switchgrass RhizosphereLKNRMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE*
Ga0081455_1034934923300005937Tabebuia Heterophylla RhizosphereLKSRVVVHISFTHHPIGKTLPVGAVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0066788_1018540513300005944SoilVCVHISFTHPPSANARPMGAVAFAIGLKLLVPTPGKNGSRAVKDFFE*
Ga0066787_1010693023300005950SoilLKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTLE*
Ga0081540_111192223300005983Tabebuia Heterophylla RhizosphereLKSRMSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0080027_1035220223300005993Prmafrost SoilLKNSVCVHISFTHPPSANARPMGAVAFAIGLKLLVPTPGKNGSRAVKDFFE*
Ga0066789_1033767823300005994SoilLKNSVCVHISFTHPPSANARPMGAVPFAIGLKLLVPTPGKNGSRAVKDFFE*
Ga0070717_1141449023300006028Corn, Switchgrass And Miscanthus RhizosphereLKNSVCVHISFTHPPSAKQAPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE*
Ga0066651_1081161413300006031SoilLKSRVVVHISFTHPPSAEPPPVGSVAFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0075026_10061759323300006057WatershedsLKNRLSVHISFTHPPSAILSPMGSVAFAIGLKLLVPTPGKHGSWAVKDFIG*
Ga0097621_10037819123300006237Miscanthus RhizosphereLKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIE*
Ga0097621_10123163423300006237Miscanthus RhizosphereLKNSVCVHISFTHPPSANAKPMGAVAFAIGLKLLVTTPGKHGLTAVKDFIG*
Ga0068871_10151185113300006358Miscanthus RhizosphereLKNRMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHG
Ga0075037_124526613300006426Permafrost SoilNSVCVHISFTHPPSAFAKPMGAVAFAIGLKLLVPTPGKNGLRAVKDTIE*
Ga0075522_1039118123300006638Arctic Peat SoilLKNSVCVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTLE*
Ga0105240_1217737423300009093Corn RhizosphereLKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIA*
Ga0105247_1105199423300009101Switchgrass RhizosphereMSVHISFTPPPFGGHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE*
Ga0105029_11889113300009984Switchgrass RhizosphereGVHISFTHPPSANRSPMGAVAFAIGLKLLVPTPGKNGFRAVKDTIE*
Ga0126380_1131362823300010043Tropical Forest SoilLKSRVSVHISFTHHPIGGQTPPVGAVAFAIGLKLLVPTPGKHGFTAVKDLIA*
Ga0126382_1094285113300010047Tropical Forest SoilRRRQGRVEVTRRLSGLKSRMSVHISFTHPPSAKRSPMGAVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0126319_133088323300010147SoilLKSRAVVHISFTHPPSAIPSPMGAVVFAIGLKLLVPTPGKHGLTAVKDFIE*
Ga0126370_1114647123300010358Tropical Forest SoilLKRRVVVHISFTHHPSAMLSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG*
Ga0126376_1188535923300010359Tropical Forest SoilLKSRVSVHISFTHHPIGDNPPVGAVEFAIGLKLLVPTPGKHGLTAVKDLHE*
Ga0126378_1243161523300010361Tropical Forest SoilLKSRVSVHISFTHPSPAGRLPVSAVAFAIGLKLLVPTPGKHGFPAVKDFIG*
Ga0126359_122005423300010869Boreal Forest SoilLKIREVVHISFTRPPRLIRPVEGLAAPAIGLKLLVPTPGKNGSRAVKDTLE*
Ga0150983_1221685313300011120Forest SoilLKSRVSVHISFTHHPIGGTQPVGAVAFAIGLKLLVPTPGKHGSWAVKDFIE*
Ga0150983_1435378513300011120Forest SoilLKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGFSAVKDFIG*
Ga0150985_12025049823300012212Avena Fatua RhizosphereMSVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGFWAVKDFIG*
Ga0157609_120505323300012717FreshwaterCVLNSFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGFRAVKDIIE*
Ga0157292_1031034813300012900SoilSGLKNRVSVHISFAHPPSAILSPEGSVAFAIGLKLLVPTPGKHGFRAVKDFIE*
Ga0137413_1029026733300012924Vadose Zone SoilMGVHISFTPPPFGIHPPEGPVAFAIGLKLLVPTPGKHGLTAVKDFIE*
Ga0137404_1206368223300012929Vadose Zone SoilMGVHISFTPPPFGVHPPEGPVAFAIGLKLLVPTPGKHGFSAVKDLHE*
Ga0126369_1154671823300012971Tropical Forest SoilLKRRAVVHISFTHHPSAILSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG*
Ga0157378_1227127023300013297Miscanthus RhizosphereVCVHISFTHPPSANAKPMGAVAFAIGLKLLVPTPGKHGLTAVKDFIG*
Ga0157378_1270685323300013297Miscanthus RhizosphereVCVHISFTHPPSANTKPMGAVAFAIGLKLLVPTPGKHGLAAVKDLHE*
Ga0163162_1217655223300013306Switchgrass RhizosphereLKSRVSVHISFTHHPTGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIA*
Ga0182024_1002729493300014501PermafrostLKSRAVVHISFTHPPSARQAPVGAVAFAIGLKLLVTTPGKHGFAAVKDFIE*
Ga0182039_1128811723300016422SoilLKSRVSVHISFTHPPSAKPSPVGSVAFAIGLKLLVPTPGKHSLTAVKDLHA
Ga0182038_1136652413300016445SoilRGLKRRVGVHISLTHHPSAIPSPVGPVAFAIGLKLLVPTPGKHGFPAVKDFIG
Ga0163161_1149328313300017792Switchgrass RhizosphereRVEVTRRHRGLKSRVVVHISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLTAVKDFI
Ga0187780_1068584923300017973Tropical PeatlandLKSRVVVHILFTHPPSASASPVGVVAFAIGLKLLVPTLGKHGWLAVKDFIG
Ga0190274_1231555923300018476SoilMSVHISFTHPPSAIRSPMGVVAFAIGLKLLVPTPGKNGSRAVKDTIE
Ga0190264_1011115333300019377SoilMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE
Ga0193752_102882823300020027SoilMGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSRAVKDTIE
Ga0193717_103336743300020060SoilLKNRMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE
Ga0210403_1109703323300020580SoilLKSRVSVHISFTHHPIGGTQPVGAVAFAIGLKLLVPTPGKHGSWAVKDFIE
Ga0210388_1132292523300021181SoilLKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGFSAVKDFIG
Ga0213877_1026518413300021372Bulk SoilLKSRAVVHISFTHPPSASLSPVGAVAFAIGLKLKVPTPGKHGSSAVKDLH
Ga0210393_1144513223300021401SoilLKSRVVVHISFTHPPSAKLPPMGAVAFAIGLKLLVPTPGKHGFAAVKDFI
Ga0210392_1149100923300021475SoilKPRERTYFVHPPPHRRKTPPVGPVAFAIGLKLLVPTPGKHGLTAVKDFIE
Ga0242648_103719823300022506SoilLKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFPAVKDIIG
Ga0242649_101274923300022509SoilLKNRKAVHISFTHPPSASPSPMGAVVFAIGLKLLVPTPGKHGFSAVKDFIG
Ga0242674_105819613300022711SoilLKNRKAVHISFTHPPSASPSPMGAVVFAIGLKLLVPTPGKHGFAAVKDFIG
Ga0207688_1009635633300025901Corn, Switchgrass And Miscanthus RhizosphereLKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFTAVKDLHE
Ga0207699_1060838833300025906Corn, Switchgrass And Miscanthus RhizosphereLKSRVSVHISFTHHPIGKNQPVGAVAFAIGLKLLVPTPGKHGLTAVKDLHE
Ga0207654_1128241923300025911Corn RhizosphereRVSVHISFTHPPSANLSPMGSVAFAIGLKLLVPTPGKHGLAAVKDLHE
Ga0207693_1040932933300025915Corn, Switchgrass And Miscanthus RhizosphereLKSRVSVHISFTHHPIGETQPVGAVAFAIGLKLLVPTPGKHGCWP
Ga0207650_1171708413300025925Switchgrass RhizosphereCQDQEAARRCWRQGRVEVTRRHRGLKSRAVVHISFTHPPSAIHPPMGAVAFAIGLKLLVPTPGKHGFWAVKDFIE
Ga0207700_1076352013300025928Corn, Switchgrass And Miscanthus RhizosphereRVEVTRRLSGLKSRVSVHISFTHHPIGGTPSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLFE
Ga0207648_1037312923300026089Miscanthus RhizosphereLKSRVVVHISFTHPPSAEPPLMGPVAFAIGLKLLVPTPGKHGLTAVKDLHE
Ga0179587_1084528223300026557Vadose Zone SoilVVHISFTHPPSAIAKPMGAVAFAIGLKLLVPTPGKHGLAAVKDFIE
Ga0207739_100932123300026881Tropical Forest SoilHISFTHPPSAEPPLMGSVAFAIGLKLLVPTPGKHGLTAVKDLHE
Ga0209113_102068223300027517Forest SoilLKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIG
Ga0209274_1037772923300027853SoilLKNRGVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFSAVKDFIG
Ga0209168_1015504723300027986Surface SoilLKSRAVVHISFTHHPSAISTPMGQVAFAIGLKLLVPTPGKLGPSAVKDFIG
Ga0268266_1100705823300028379Switchgrass RhizosphereKGAAGLKNSVRVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG
Ga0311365_1123820123300029989FenGLKNSVCVHISFTHPPSAIRSPMGVVAFAIGLKLLVPTPGKNGSRAVKDLFE
Ga0311372_1176690723300030520PalsaLKNRKAVHISFTHPPSASPSPMGAMVFAIGLKLLVPTPGKHGSSAVKDFIG
Ga0265723_103283933300030872SoilLKNRVVLHISFTHPPSARQAPVGAVVFAIGLKLLVPTPGKHGFTAVKDFIE
Ga0265769_10612923300030888SoilLKNRVVVHISFTHPPSARQAPVGAVVFAIGLKLLVPTPGKHGFTAVKDFIE
Ga0075386_1207542113300030916SoilRQGRVEVTRRHRGLKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGLTAVKDLIE
Ga0170834_10839778423300031057Forest SoilLKSRVSVHISFTHHPIGGKLPPVGAVAFAIGLKLLVPTPGKHGLTAVKDLIE
Ga0302325_1149492633300031234PalsaLKRRAVVHISFTHPPSAIDAPMGAVVFAIGLKLLVPTPGKHGYWAVKDLYE
Ga0265340_1045150623300031247RhizosphereLKSRAVVHISFTHPPSAKNPPMGAVAFAIGLKLLVPTPGKHGFWAVKDTLE
Ga0314822_10069223300031484SoilMGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE
Ga0314823_10125343300031487SoilMGVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE
Ga0310686_10221751413300031708SoilQGRVEVARRLGGLKNRMAVHISFTHPPSASSSPMGAVVFAIGLKLLVPTPGKHGSSAVKDFIG
Ga0310686_10597040923300031708SoilLKRRAVVHISFTHPPSAKLSPMGGVVFAIGLKLLVPTPGKHGSWAVKDFIE
Ga0310686_10896654913300031708SoilLKRRAVVHISFTHPPSAIDAPVGAMVFAIGLKLLLPTPGKHGLWAVKDLHE
Ga0307474_1094434513300031718Hardwood Forest SoilKSRVVVHISFTHPPSAFLSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIE
Ga0307474_1144157723300031718Hardwood Forest SoilLKSRVVVHISFTHPPSAFLSPMGAVAFAIGLKLLVPTPGKHGS
Ga0311351_1112639123300031722FenLKNSERVHISFTHPPSAILSPMGAVAFAIGLKLLVPTPGKNGLTAVKDLHG
Ga0307468_10047008613300031740Hardwood Forest SoilGLKNSVCVHISFTHPPSANLSPMGAVAFAIGLKLLVPTPGKHGFRAVKDFIE
Ga0307410_1085979723300031852RhizosphereMSVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE
Ga0306919_1089259623300031879SoilSRVVVHISFTHPPSASPSPMGAVAFAIGLKLLVPTPGKHGFPAVKDFIG
Ga0306921_1141659823300031912SoilLKRRVVVHISFTHHPSASLSPMGSVAFAIGLKLLVPTPGKHGFPAVKDFIG
Ga0310899_1041069723300032017SoilLKRRVSVHISFTHHPSAKASPMGPVAFAIGLKLLVPTPGKHGFRAVKDFIE
Ga0307470_1100643623300032174Hardwood Forest SoilLKSRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGSWAVKDFIG
Ga0335075_1091441323300032896SoilLKNRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKHGLLAVKDLHE
Ga0307510_1051844323300033180EctomycorrhizaLKSRAVVHISFTHPPSAIRSPMGAVAFAIGLKLLVPTPGKNGSWAVKDTIE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.