| Basic Information | |
|---|---|
| Family ID | F059081 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 38 residues |
| Representative Sequence | IGVVEHVFAADAAHAAEEFAAELYSAQFDARRLMLE |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.76 % |
| % of genes near scaffold ends (potentially truncated) | 95.52 % |
| % of genes from short scaffolds (< 2000 bps) | 93.28 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.328 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.687 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.343 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.06% β-sheet: 0.00% Coil/Unstructured: 60.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 2.24 |
| PF06441 | EHN | 0.75 |
| PF00420 | Oxidored_q2 | 0.75 |
| PF03486 | HI0933_like | 0.75 |
| PF00140 | Sigma70_r1_2 | 0.75 |
| PF04545 | Sigma70_r4 | 0.75 |
| PF03349 | Toluene_X | 0.75 |
| PF05598 | DUF772 | 0.75 |
| PF00005 | ABC_tran | 0.75 |
| PF07786 | HGSNAT_cat | 0.75 |
| PF04542 | Sigma70_r2 | 0.75 |
| PF09413 | DUF2007 | 0.75 |
| PF03979 | Sigma70_r1_1 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.24 |
| COG0493 | NADPH-dependent glutamate synthase beta chain or related oxidoreductase | Amino acid transport and metabolism [E] | 1.49 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.49 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
| COG3634 | Alkyl hydroperoxide reductase subunit AhpF | Defense mechanisms [V] | 0.75 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.75 |
| COG2509 | FAD-dependent dehydrogenase | General function prediction only [R] | 0.75 |
| COG2081 | Predicted flavoprotein YhiN | General function prediction only [R] | 0.75 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 0.75 |
| COG2067 | Long-chain fatty acid transport protein | Lipid transport and metabolism [I] | 0.75 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
| COG1249 | Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductase | Energy production and conversion [C] | 0.75 |
| COG0029 | Aspartate oxidase | Coenzyme transport and metabolism [H] | 0.75 |
| COG1053 | Succinate dehydrogenase/fumarate reductase, flavoprotein subunit | Energy production and conversion [C] | 0.75 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.75 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.75 |
| COG0492 | Thioredoxin reductase | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
| COG0446 | NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductase | Lipid transport and metabolism [I] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.33 % |
| Unclassified | root | N/A | 15.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN01DU14K | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100233638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100372384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100403095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300000886|AL3A1W_1700907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300000955|JGI1027J12803_105301482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300000956|JGI10216J12902_117748264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300001664|P5cmW16_1055399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300004157|Ga0062590_101270830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300005187|Ga0066675_10434713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300005336|Ga0070680_100752219 | Not Available | 839 | Open in IMG/M |
| 3300005458|Ga0070681_10307783 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300005549|Ga0070704_100786981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300005556|Ga0066707_10157331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
| 3300005561|Ga0066699_10672195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300005574|Ga0066694_10480626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300005576|Ga0066708_10100136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1720 | Open in IMG/M |
| 3300005616|Ga0068852_102675283 | Not Available | 518 | Open in IMG/M |
| 3300005842|Ga0068858_101845711 | Not Available | 597 | Open in IMG/M |
| 3300005843|Ga0068860_101782192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300005894|Ga0075270_1043947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300005896|Ga0075282_1014326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 980 | Open in IMG/M |
| 3300005905|Ga0075269_10015042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1187 | Open in IMG/M |
| 3300006028|Ga0070717_10389272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1251 | Open in IMG/M |
| 3300006028|Ga0070717_10660064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300006032|Ga0066696_10431462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 862 | Open in IMG/M |
| 3300006032|Ga0066696_10514438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300006032|Ga0066696_10935805 | Not Available | 551 | Open in IMG/M |
| 3300006237|Ga0097621_101211572 | Not Available | 711 | Open in IMG/M |
| 3300006580|Ga0074049_12381801 | Not Available | 660 | Open in IMG/M |
| 3300006800|Ga0066660_10327434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1234 | Open in IMG/M |
| 3300006804|Ga0079221_11474002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300006806|Ga0079220_11922035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300006846|Ga0075430_101384037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300006904|Ga0075424_101167197 | Not Available | 820 | Open in IMG/M |
| 3300009094|Ga0111539_12892778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300009137|Ga0066709_101381965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
| 3300009146|Ga0105091_10253267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300009156|Ga0111538_10071808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4408 | Open in IMG/M |
| 3300009162|Ga0075423_11034778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300010039|Ga0126309_11250534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300010044|Ga0126310_11064131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300010111|Ga0127491_1128521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
| 3300010119|Ga0127452_1022246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300010326|Ga0134065_10094404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
| 3300010329|Ga0134111_10398445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300010335|Ga0134063_10065546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1608 | Open in IMG/M |
| 3300010335|Ga0134063_10652443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300010360|Ga0126372_12834737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300010362|Ga0126377_10627400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1122 | Open in IMG/M |
| 3300010371|Ga0134125_12476819 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010371|Ga0134125_12856621 | Not Available | 525 | Open in IMG/M |
| 3300010398|Ga0126383_12282736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300010399|Ga0134127_11881766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300010866|Ga0126344_1170673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300011119|Ga0105246_11295822 | Not Available | 675 | Open in IMG/M |
| 3300012204|Ga0137374_10132555 | Not Available | 2265 | Open in IMG/M |
| 3300012204|Ga0137374_11216118 | Not Available | 526 | Open in IMG/M |
| 3300012206|Ga0137380_11209280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300012207|Ga0137381_10335309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
| 3300012208|Ga0137376_11348714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300012210|Ga0137378_11101649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300012210|Ga0137378_11393945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300012211|Ga0137377_10241542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1735 | Open in IMG/M |
| 3300012211|Ga0137377_11481160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300012212|Ga0150985_100854639 | Not Available | 809 | Open in IMG/M |
| 3300012212|Ga0150985_117108307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300012362|Ga0137361_10064619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3074 | Open in IMG/M |
| 3300012469|Ga0150984_107668568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300012469|Ga0150984_121364333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300012532|Ga0137373_11174790 | Not Available | 543 | Open in IMG/M |
| 3300012906|Ga0157295_10335720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300012908|Ga0157286_10348413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300012929|Ga0137404_11050061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
| 3300012941|Ga0162652_100050260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300012960|Ga0164301_10398318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300012961|Ga0164302_10091464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1654 | Open in IMG/M |
| 3300012989|Ga0164305_12234041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300013105|Ga0157369_11860964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300013297|Ga0157378_12211152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300013770|Ga0120123_1085633 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300014325|Ga0163163_10682540 | Not Available | 1091 | Open in IMG/M |
| 3300015053|Ga0137405_1320260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1672 | Open in IMG/M |
| 3300015241|Ga0137418_10851147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300015371|Ga0132258_11959085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300015373|Ga0132257_100156337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2675 | Open in IMG/M |
| 3300017792|Ga0163161_10072976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Luteibacter → Luteibacter rhizovicinus | 2514 | Open in IMG/M |
| 3300018027|Ga0184605_10013190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3209 | Open in IMG/M |
| 3300018061|Ga0184619_10371121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300018431|Ga0066655_10886352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300018468|Ga0066662_10536425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
| 3300020018|Ga0193721_1073282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
| 3300021080|Ga0210382_10243983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300021560|Ga0126371_11578505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
| 3300022694|Ga0222623_10102852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1111 | Open in IMG/M |
| 3300024283|Ga0247670_1039491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300025905|Ga0207685_10071351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1409 | Open in IMG/M |
| 3300025909|Ga0207705_11292053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300025910|Ga0207684_11175046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300025915|Ga0207693_11028255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300025916|Ga0207663_10573255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 884 | Open in IMG/M |
| 3300025938|Ga0207704_11603239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300025941|Ga0207711_11210067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
| 3300026121|Ga0207683_11485463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300026277|Ga0209350_1151897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300026295|Ga0209234_1277679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300026306|Ga0209468_1065988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300026306|Ga0209468_1184826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300026552|Ga0209577_10584887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300027665|Ga0209983_1135309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300027821|Ga0209811_10105738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1015 | Open in IMG/M |
| 3300027821|Ga0209811_10264454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300027903|Ga0209488_11154534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300028381|Ga0268264_10580110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300028704|Ga0307321_1078050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300028771|Ga0307320_10388675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300028787|Ga0307323_10260778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300028792|Ga0307504_10172658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300028799|Ga0307284_10187140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300028819|Ga0307296_10701699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300028828|Ga0307312_10746640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300031573|Ga0310915_10750213 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031716|Ga0310813_12125614 | Not Available | 531 | Open in IMG/M |
| 3300031778|Ga0318498_10240563 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300031779|Ga0318566_10122913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1281 | Open in IMG/M |
| 3300031805|Ga0318497_10528782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 661 | Open in IMG/M |
| 3300031820|Ga0307473_10689534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300032043|Ga0318556_10388860 | Not Available | 730 | Open in IMG/M |
| 3300032044|Ga0318558_10690945 | Not Available | 510 | Open in IMG/M |
| 3300032782|Ga0335082_11243509 | Not Available | 613 | Open in IMG/M |
| 3300032892|Ga0335081_10257035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2353 | Open in IMG/M |
| 3300034147|Ga0364925_0276521 | Not Available | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.24% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.75% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_06176080 | 2170459013 | Grass Soil | IGVVEHVFAADAAHAAEEFAAELYSAQFDARRLMLE |
| INPhiseqgaiiFebDRAFT_1002336382 | 3300000364 | Soil | GVVEHMFAEDALATLEEFQAELWSTSFDARRLGLE* |
| INPhiseqgaiiFebDRAFT_1003723841 | 3300000364 | Soil | HNDRRVGVVEHVFHXDVYATLEEFRTELXSSXFDARRLDL* |
| INPhiseqgaiiFebDRAFT_1004030952 | 3300000364 | Soil | AEIGIVEHVFSADAEHIVEEFAAELDSAQFEARRLELE* |
| AL3A1W_17009071 | 3300000886 | Permafrost | IGVVEHIFGPDAERGLEEFVSELYSARFDSRRLDLH* |
| JGI1027J12803_1053014822 | 3300000955 | Soil | EVGVVEHVFSDDVAGTLEEFRAELYSASFDTRRLGL* |
| JGI10216J12902_1177482641 | 3300000956 | Soil | GVVEHHFADDVLLTVEQFHAELYSGSFDARRLLLDEVA* |
| P5cmW16_10553991 | 3300001664 | Permafrost | KVGVVEHVFNEDVAGALEEFRAELYSASFDTRRLAL* |
| Ga0062590_1012708301 | 3300004157 | Soil | HNDAQIGVVEHVFAADAAHAAEEFAAELYSAQFDARRLLLE* |
| Ga0066675_104347132 | 3300005187 | Soil | FHNDAEIGVVEHVFAADAAHAAEEFAAELYSAQFDARRLTLE* |
| Ga0070680_1007522192 | 3300005336 | Corn Rhizosphere | EIGVVEHVFAGDALRTVEEFQAELYSASFDARRLLLDEMA* |
| Ga0070681_103077833 | 3300005458 | Corn Rhizosphere | NDHEIGVVAHVFEQDAAATVEAFAAELYSEHFDARRLTLERGR* |
| Ga0070704_1007869813 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | NDREIGVVEHMLDDDRHATIEEFHAELYSASFDARRLGLD* |
| Ga0066707_101573311 | 3300005556 | Soil | EIGVVEHVFPADAERAVEEFSDELYSARFDARRLSL* |
| Ga0066699_106721951 | 3300005561 | Soil | VGVVEHVFADDVDRTLEEFRDELYSARFDARRLDLQ* |
| Ga0066694_104806262 | 3300005574 | Soil | DAEIGVVEHVFRAGAERALEEFRSELYSGTFDARRLSL* |
| Ga0066708_101001364 | 3300005576 | Soil | EIGVVEHVFESDAARTLEEFSDQLYSAHFEAARLALA* |
| Ga0068852_1026752831 | 3300005616 | Corn Rhizosphere | EVGVVEHVFEADAAAALDEFRSELYSATFDARRLGL* |
| Ga0068858_1018457111 | 3300005842 | Switchgrass Rhizosphere | VVEHVFASDIRLTIDEFQAELYSASFDARRLLLDDMA* |
| Ga0068860_1017821922 | 3300005843 | Switchgrass Rhizosphere | VGVVEHVFSDDLARTFEDFRAELYSASFDTRRLGL* |
| Ga0075270_10439471 | 3300005894 | Rice Paddy Soil | EIGVVEHVFAGDVDHAVAAFRAELDSASFDARRLGL* |
| Ga0075282_10143263 | 3300005896 | Rice Paddy Soil | EIGVVEHLFVEDAPATLDEFRAELWSASFDARRLALE* |
| Ga0075269_100150421 | 3300005905 | Rice Paddy Soil | HNDREIAVVDHVFREDVDAAVEEFRAELSSSAFDIRRLGL* |
| Ga0070717_103892721 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGVVEHVFPDDVHATVEEFRAELWSATFDARRIDLE* |
| Ga0070717_106600642 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | REIGVVEHVFERDADAAVAEFRAELESESFDARRLGLE* |
| Ga0066696_104314622 | 3300006032 | Soil | GVVEHVFAEDVHATLEEFRAELWSASFDARRLALE* |
| Ga0066696_105144382 | 3300006032 | Soil | NDPEVGVVEHVFAEDVARTLEAFREELYSSRFDARRLGLE* |
| Ga0066696_109358052 | 3300006032 | Soil | GVVEHVFREDALRTLEEFQSELYAGTFDARRLDLH* |
| Ga0097621_1012115722 | 3300006237 | Miscanthus Rhizosphere | PEIGVVEHVFASDIRLTIDEFQAELYSANFDARRLLLDDMA* |
| Ga0074049_123818012 | 3300006580 | Soil | VEHVFAGDALLTVEEFRAELYSASFDARRLLLDEIA* |
| Ga0066660_103274341 | 3300006800 | Soil | DAEIGVVEHVFAADAAHAAEEFAAELYSAEFDARRLAL* |
| Ga0079221_114740021 | 3300006804 | Agricultural Soil | GVVEHLFADDVATTVEEFRAELWSARFDARRLAL* |
| Ga0079220_119220352 | 3300006806 | Agricultural Soil | EIGIVDHLFTADAERAVEAFAAELDSAGFDSRRLQL* |
| Ga0075430_1013840371 | 3300006846 | Populus Rhizosphere | FHNDREVGVVPHVFASDLERVAEEFAAELYSARFDSRRLAL* |
| Ga0075424_1011671971 | 3300006904 | Populus Rhizosphere | HNDREIGVLGHHFDTDLETTVDAFTSELYSAGFDARRLSLG* |
| Ga0111539_128927782 | 3300009094 | Populus Rhizosphere | VGVVEHVFEADAERAIEEFRVELYSGTFDTRRLAL* |
| Ga0066709_1013819651 | 3300009137 | Grasslands Soil | NDAEVGVVEHVLESDAAALVAEFREELLSSAFDARRMHFH* |
| Ga0105091_102532672 | 3300009146 | Freshwater Sediment | DREVGVLEHVFPADAPQVVEEFSAELYSARFDARRLWLD* |
| Ga0111538_100718087 | 3300009156 | Populus Rhizosphere | IGVVEHVFAADAGHVLEEFEAELYSARFDSRRLHLDDPPHEV* |
| Ga0075423_110347781 | 3300009162 | Populus Rhizosphere | VGVVEHMFAADVDHTLEEFRAELDSAAFDYRRLALE* |
| Ga0126309_112505342 | 3300010039 | Serpentine Soil | VGVVEHVFEDDARATVEEFRADLYGASFDARRLSLQ* |
| Ga0126310_110641313 | 3300010044 | Serpentine Soil | VGVVEHVFSDDVARTLEEFRTELYSASFDTRRLGL* |
| Ga0127491_11285211 | 3300010111 | Grasslands Soil | NDPEVGVVEHVFSDDVARTLEELRAELYSASFDTRRLGL* |
| Ga0127452_10222462 | 3300010119 | Grasslands Soil | GVVEHLFADDLHAALDEFRAELWSAGFDARRLALE* |
| Ga0134065_100944043 | 3300010326 | Grasslands Soil | IGVVEHVFRADAKRALGEFRGELYSGTFDARRLSL* |
| Ga0134111_103984451 | 3300010329 | Grasslands Soil | NDAHVGVVEHVFTADVPPALEEFRAELYSSTFDYRRLALE* |
| Ga0134063_100655461 | 3300010335 | Grasslands Soil | EIGVVEHLFRAGAERALEEFSSELYSGTFDARRLSL* |
| Ga0134063_106524432 | 3300010335 | Grasslands Soil | GVVEHVFDADVARAAEEFAAELDSAQFDARRLAL* |
| Ga0126372_128347372 | 3300010360 | Tropical Forest Soil | DRQIGVVEHVFAADAERVVDEFAAELYSARFDSRRLGLQ* |
| Ga0126377_106274001 | 3300010362 | Tropical Forest Soil | NDGAIGVIEHVFAADTLRTIEEFRVELHSASFDARRLLL* |
| Ga0134125_124768192 | 3300010371 | Terrestrial Soil | ANDREVGVVEHLFAHDADAVLDEFREELYSASFDARRLTLN* |
| Ga0134125_128566212 | 3300010371 | Terrestrial Soil | DREIGVVGHVFASDVAATIDAFTDELYSASFDARRLALD* |
| Ga0126383_122827361 | 3300010398 | Tropical Forest Soil | DAEIGVVEHVFEADAARAVEEFSAELHSARFDARRLALE* |
| Ga0134127_118817662 | 3300010399 | Terrestrial Soil | EVGVVEHVFSDDLARTLEDFRAELYSASFDTRRLTL* |
| Ga0126344_11706731 | 3300010866 | Boreal Forest Soil | GVVEHVFTGDVHATVEEFRAELWSSAFDARRLAL* |
| Ga0105246_112958221 | 3300011119 | Miscanthus Rhizosphere | GVVEHVFASDIRLTIDEFQAELYSANFDARRLLLDDMA* |
| Ga0137374_101325551 | 3300012204 | Vadose Zone Soil | GVVEHVFARDALRTVEEFRTELYSASFDARRLLLD* |
| Ga0137374_112161181 | 3300012204 | Vadose Zone Soil | NDPHVGVVEHVFQADVMPTIEEFHSELYSSAFDYRRLTLQ* |
| Ga0137380_112092802 | 3300012206 | Vadose Zone Soil | VVEHVFCSDLERVVEEFHAELHSGLFDARRLTLD* |
| Ga0137381_103353094 | 3300012207 | Vadose Zone Soil | GVVEHVFSDDVAGALEEFRAELYSASFDTRRLAL* |
| Ga0137381_111673421 | 3300012207 | Vadose Zone Soil | GVLPYVFPADADRMLEEFRAELDSGSFDARRLSLD* |
| Ga0137376_113487141 | 3300012208 | Vadose Zone Soil | NDPEVGVVAHVFSEDVSTMLEEFRTELYSASFDARRMAL* |
| Ga0137378_111016491 | 3300012210 | Vadose Zone Soil | EVGVVEHVFGSDLERVVEEFHTELHSGLFDARRLTLD* |
| Ga0137378_113939451 | 3300012210 | Vadose Zone Soil | VVEHVFADDATRALDEFREELYSARLDARRLDLQ* |
| Ga0137377_102415421 | 3300012211 | Vadose Zone Soil | VGVVEHVFSDDVAGALEEFRAELYSASFDTRRLAL* |
| Ga0137377_114811602 | 3300012211 | Vadose Zone Soil | VVEHVFADDATRAVEEFRSELYSPRFDARRLDLQ* |
| Ga0150985_1008546391 | 3300012212 | Avena Fatua Rhizosphere | HVFAGDALLTMEQFHAELYSASFDARRLLLDDVA* |
| Ga0150985_1171083071 | 3300012212 | Avena Fatua Rhizosphere | NDREVGVLEHVFAHDAAAAADEFHAELWSGSFDARRLALE* |
| Ga0137361_100646191 | 3300012362 | Vadose Zone Soil | IGVVEHVFAGDLETTVEEFRSELWSAAFDARRLSLD* |
| Ga0150984_1076685681 | 3300012469 | Avena Fatua Rhizosphere | NDREIGVVGHVFPDDATSTVEAFNAELYSASFDARRLALD* |
| Ga0150984_1213643331 | 3300012469 | Avena Fatua Rhizosphere | HNDLEIGVVEHVFPGDILLTVEEFGAELYSATFDARRLLLDEMA* |
| Ga0137373_111747901 | 3300012532 | Vadose Zone Soil | FHNDPQVGVVEHVFEGDAERALEEFRVELYSAAFDTRRLAL* |
| Ga0157295_103357201 | 3300012906 | Soil | PEIGVVEHVFAGDALRTVEEFQAELYSASFDARRLLLDEMA* |
| Ga0157286_103484132 | 3300012908 | Soil | DREIGVVEHVFGPDAERAVEEFAHELYSARFDARRLDLQ* |
| Ga0137404_110500611 | 3300012929 | Vadose Zone Soil | VNDRELGVVEHHFSDDAAAAVAEFQAELWSGSFDGRRLGLE* |
| Ga0162652_1000502602 | 3300012941 | Soil | GVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE* |
| Ga0164301_103983183 | 3300012960 | Soil | GVVEHVFNDDVAGAIEEFRAELYSASFDTRRLTL* |
| Ga0164302_100914641 | 3300012961 | Soil | VVEHMFAEDALATLDEFQAELWSSSFDARRLALE* |
| Ga0164305_122340411 | 3300012989 | Soil | DVEIGVVEHVFAADAERAVEEFAEELYSAHFDARRLSL* |
| Ga0157369_118609642 | 3300013105 | Corn Rhizosphere | VGVVEHVFAGDLQATLEEFRAELWSARFDARRLALE* |
| Ga0157369_122606412 | 3300013105 | Corn Rhizosphere | GVVEQVFPDDISATLEEFRAELWSTAFDARRLSLD* |
| Ga0157378_122111521 | 3300013297 | Miscanthus Rhizosphere | HNDSEIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE* |
| Ga0120123_10856331 | 3300013770 | Permafrost | VVEHHFRGDVVTAIEEFRDELYSARFDVRRLVGLE* |
| Ga0163163_106825401 | 3300014325 | Switchgrass Rhizosphere | VVEHVFARDALRTVEEFQAELYSASFDARRLLLDDMA* |
| Ga0137405_13202604 | 3300015053 | Vadose Zone Soil | GVVEHVFATDAAHAAEEFAAELYSAQFDARRLML* |
| Ga0137418_108511471 | 3300015241 | Vadose Zone Soil | VGVVEHVFNDDVAGALEEFRAELYSASFDTRRLAL* |
| Ga0132258_119590851 | 3300015371 | Arabidopsis Rhizosphere | QVGVVGHVFEADAERALDEFRAELYSAAFDTRRLAL* |
| Ga0132257_1001563376 | 3300015373 | Arabidopsis Rhizosphere | GVVEHMFAEDALATLDEFQAELWSSSFDARRLALE* |
| Ga0163161_100729764 | 3300017792 | Switchgrass Rhizosphere | HNDREVGVVPHVFASDLELVVEEFAAELYSGRFDSRRLAL |
| Ga0184605_100131905 | 3300018027 | Groundwater Sediment | EIGVVEHVFPADAERAVEEFAGELYSARFDARRLSL |
| Ga0184619_103711212 | 3300018061 | Groundwater Sediment | FHNDSEIGVVEHVFPADAAYAAAEFAAELYSAQFDARRLMLE |
| Ga0066655_108863522 | 3300018431 | Grasslands Soil | IGVVEHVFTGDAETAVEEFRAELWSSTFDARRLSL |
| Ga0066662_105364251 | 3300018468 | Grasslands Soil | RAVGVVEHVFPDDVHAAVEEFRAELWSASFDARRLALE |
| Ga0193721_10732821 | 3300020018 | Soil | HNDPKVGVVEHVFSDDLAHTLEDFRAELYSASFDTRRLSL |
| Ga0210382_102439832 | 3300021080 | Groundwater Sediment | FHNDAEIGVVEHVFPADAERAVEEFAGELYSARFDARRLSL |
| Ga0126371_115785052 | 3300021560 | Tropical Forest Soil | EIGVVEHMFAEDALTTVEAFREELWSSSFDARRLALE |
| Ga0222623_101028524 | 3300022694 | Groundwater Sediment | EIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE |
| Ga0247670_10394911 | 3300024283 | Soil | REIGVVEHVFATDAERVVEEFAAALYSASFDNRRLGLH |
| Ga0207685_100713514 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVVEHMFAEDALATLEEFQAELWSTSFDARRLALQ |
| Ga0207705_112920531 | 3300025909 | Corn Rhizosphere | GVVEHVFDHDVTTVVEEFRAELYSGSFDARRLTLE |
| Ga0207684_111750462 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGVVEHVFAADAAHVAEEFAAELYSAQFDARRLTLE |
| Ga0207693_110282552 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FLNDREIGVVEHVFERDADATVAEFRAELGSESFDARRLGLE |
| Ga0207663_105732551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RVGVVEHVFHDDAYATLEEFRTELWSSGFDARRLDL |
| Ga0207704_116032392 | 3300025938 | Miscanthus Rhizosphere | PEIGVVEHVFARDALRTVEEFQAELYSASFDARRLLLDEMA |
| Ga0207711_112100671 | 3300025941 | Switchgrass Rhizosphere | GVVEHMFAEDALATLEEFQAELWSTSFDARRLALR |
| Ga0207683_114854633 | 3300026121 | Miscanthus Rhizosphere | EVGVVEHVFSDDVARTLEEFREELYSASFDSRRLGL |
| Ga0209350_11518971 | 3300026277 | Grasslands Soil | QIGIVEHVFQADAERALEEFAAELYSARFDARRLSL |
| Ga0209234_12776792 | 3300026295 | Grasslands Soil | IGVVAHVFADDAAATIEAFSAELYSASFDARRLTLD |
| Ga0209468_10659883 | 3300026306 | Soil | HNDAEIGVVEHVFEADAARAAEEFAAELDSAEFDARRLAL |
| Ga0209468_11848262 | 3300026306 | Soil | FHNDAEIGVVEHVFEADAARAVEEFAAELHSARFDARRLALE |
| Ga0209577_105848871 | 3300026552 | Soil | DAEIGVVEHVFAADAAHAAEEFAAELYSAEFDARRLAL |
| Ga0209983_11353091 | 3300027665 | Arabidopsis Thaliana Rhizosphere | FHNDREVGVVPHVFASDLERVVEEFAAELYSARFDSRRLAL |
| Ga0209811_101057381 | 3300027821 | Surface Soil | EIGVVEHMFAADALATLEEFQAELWSTSFDARRLALQ |
| Ga0209811_102644541 | 3300027821 | Surface Soil | GVVEHLFADDAVATADEFHAELWSGSFDARRLALE |
| Ga0209488_111545341 | 3300027903 | Vadose Zone Soil | IGVVEHVFADDAHAAIEEFRSELWSGSFDARRLALE |
| Ga0268264_105801101 | 3300028381 | Switchgrass Rhizosphere | VGVVEHVFSDDLARTFEDFRAELYSASFDTRRLGL |
| Ga0307321_10780501 | 3300028704 | Soil | HNDPEVGVVEHVFSDDVTRTLQEFQAELYSASFDTRRLGL |
| Ga0307320_103886751 | 3300028771 | Soil | SEIGVVEHVFPADAAHAAEEFAAELYSAQFDARRLMLE |
| Ga0307323_102607782 | 3300028787 | Soil | RRIGVVEHVFGADADRAVEEFAAELYSARFDSRRLDLH |
| Ga0307504_101726581 | 3300028792 | Soil | PKVGVVEHVFSDDLARTLEDFRAELYSASFDTRRLSL |
| Ga0307284_101871402 | 3300028799 | Soil | PEVGVVEHVFIDDVARTLEEFRSELYSASFDTRRLHL |
| Ga0307296_107016991 | 3300028819 | Soil | REVGVVEHVFSDDLRTTVEEFRAELWSASFDARRLGLE |
| Ga0307312_107466402 | 3300028828 | Soil | DHEVGVVEHVFSEDVAGTVEAFRGELYSASFDTRRLSL |
| Ga0310915_107502131 | 3300031573 | Soil | VGVVEHLFADDAAAAVDEFRSELYSTSFDARRLSL |
| Ga0310813_121256141 | 3300031716 | Soil | IGVVEHLFGGDALRTVEEFQAELYSASFDARRMLL |
| Ga0318498_102405633 | 3300031778 | Soil | FVNDREVGVVEHLFADDATAAVDEFRSELYSTSFDARRLSL |
| Ga0318566_101229134 | 3300031779 | Soil | DREVGVVEHLFADDATAAVDEFRSELYSTSFDARRLSL |
| Ga0318497_105287822 | 3300031805 | Soil | DREIGVVEHMFAEDAVATLDEFRAELWSASSDARRLALE |
| Ga0307473_106895342 | 3300031820 | Hardwood Forest Soil | GIVEHVFSADAEHIVEQYAAELDSAQFEARRLELE |
| Ga0318556_103888601 | 3300032043 | Soil | TVGVVEHVFAADAQRTVEEFRTELDSSSFDARRLRLH |
| Ga0318558_106909453 | 3300032044 | Soil | HNDMTVGVVEHVFAADAQRTVEEFRTELDSSSFDARRLRLH |
| Ga0335082_112435092 | 3300032782 | Soil | PFHNDAAVGVVEHVFPEDAARTIDEFHDELHSAAFDVRRLKLH |
| Ga0335081_102570357 | 3300032892 | Soil | IGVVEHVFADDLQAAVEEFRAELWSAAFDARRLGLS |
| Ga0364925_0276521_1_111 | 3300034147 | Sediment | HIGVVEHVFEADALHAAEVFAAELESAVFDLRRLEL |
| ⦗Top⦘ |