NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F059001

Metagenome Family F059001

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F059001
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 42 residues
Representative Sequence MNRLKTPQEKANERYKAESIKPMYAFIIVCVAFLITAILQNI
Number of Associated Samples 97
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 2.24 %
% of genes near scaffold ends (potentially truncated) 17.91 %
% of genes from short scaffolds (< 2000 bps) 64.93 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (68.657 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(17.164 % of family members)
Environment Ontology (ENVO) Unclassified
(52.239 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(49.254 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 45.71%    β-sheet: 0.00%    Coil/Unstructured: 54.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF08299Bac_DnaA_C 18.66
PF00149Metallophos 3.73
PF13482RNase_H_2 2.99
PF03837RecT 2.99
PF08291Peptidase_M15_3 2.99
PF05190MutS_IV 2.24
PF03237Terminase_6N 1.49
PF11367DUF3168 1.49
PF13884Peptidase_S74 1.49
PF13392HNH_3 1.49
PF04851ResIII 1.49
PF14090HTH_39 1.49
PF13489Methyltransf_23 0.75
PF12705PDDEXK_1 0.75
PF03819MazG 0.75
PF02195ParBc 0.75
PF14279HNH_5 0.75
PF11753DUF3310 0.75
PF13539Peptidase_M15_4 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 18.66
COG3723Recombinational DNA repair protein RecTReplication, recombination and repair [L] 2.99
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 2.24


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.60 %
UnclassifiedrootN/A19.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001282|B570J14230_10130604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300002278|B570J29590_103643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1007Open in IMG/M
3300002408|B570J29032_109465356All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300002835|B570J40625_100424047All Organisms → Viruses → Predicted Viral1282Open in IMG/M
3300003394|JGI25907J50239_1055502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300003499|JGI25930J51415_1024382All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1119Open in IMG/M
3300004155|Ga0066600_10641263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300004240|Ga0007787_10018707All Organisms → Viruses → Predicted Viral2882Open in IMG/M
3300004240|Ga0007787_10192311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300004242|Ga0066601_10041070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1538Open in IMG/M
3300004282|Ga0066599_100399815All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage855Open in IMG/M
3300004481|Ga0069718_15965903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage976Open in IMG/M
3300005581|Ga0049081_10000086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage34853Open in IMG/M
3300005581|Ga0049081_10056910All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1477Open in IMG/M
3300005581|Ga0049081_10161714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage816Open in IMG/M
3300005662|Ga0078894_10449858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1160Open in IMG/M
3300005662|Ga0078894_11680055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300006484|Ga0070744_10012517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2517Open in IMG/M
3300006484|Ga0070744_10147701All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300006920|Ga0070748_1167635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300008113|Ga0114346_1052146Not Available2036Open in IMG/M
3300008113|Ga0114346_1138271All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1058Open in IMG/M
3300008114|Ga0114347_1008714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage23451Open in IMG/M
3300008114|Ga0114347_1039689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2070Open in IMG/M
3300008114|Ga0114347_1105653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1080Open in IMG/M
3300008114|Ga0114347_1202454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300008116|Ga0114350_1015151All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3314Open in IMG/M
3300008117|Ga0114351_1398405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300008118|Ga0114352_1007439Not Available2494Open in IMG/M
3300008266|Ga0114363_1036129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2048Open in IMG/M
3300008266|Ga0114363_1176501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage682Open in IMG/M
3300008266|Ga0114363_1233142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300008267|Ga0114364_1010856All Organisms → Viruses → Predicted Viral4170Open in IMG/M
3300008267|Ga0114364_1103027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium884Open in IMG/M
3300008267|Ga0114364_1164175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300008450|Ga0114880_1008944Not Available5017Open in IMG/M
3300008450|Ga0114880_1010866Not Available4491Open in IMG/M
3300008450|Ga0114880_1041804All Organisms → Viruses → Predicted Viral1985Open in IMG/M
3300008450|Ga0114880_1052059All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1727Open in IMG/M
3300008450|Ga0114880_1132883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage919Open in IMG/M
3300008450|Ga0114880_1242187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage569Open in IMG/M
3300009081|Ga0105098_10140694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1076Open in IMG/M
3300009085|Ga0105103_10654362All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage601Open in IMG/M
3300009085|Ga0105103_10966622Not Available502Open in IMG/M
3300009164|Ga0114975_10005892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7914Open in IMG/M
3300009165|Ga0105102_10037415Not Available2075Open in IMG/M
3300009165|Ga0105102_10217396Not Available961Open in IMG/M
3300009165|Ga0105102_10859493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300009169|Ga0105097_10114758Not Available1475Open in IMG/M
3300009170|Ga0105096_10093685All Organisms → Viruses → Predicted Viral1495Open in IMG/M
3300009170|Ga0105096_10190625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1035Open in IMG/M
3300009183|Ga0114974_10002981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12910Open in IMG/M
3300009419|Ga0114982_1174050All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300009435|Ga0115546_1148399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage828Open in IMG/M
3300010160|Ga0114967_10020306Not Available4663Open in IMG/M
3300010160|Ga0114967_10326882All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300010368|Ga0129324_10032138Not Available2501Open in IMG/M
3300011184|Ga0136709_1050982All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300011335|Ga0153698_1227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26081Open in IMG/M
3300011336|Ga0153703_1283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18571Open in IMG/M
3300012346|Ga0157141_1000115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage34836Open in IMG/M
3300012347|Ga0157142_1044612Not Available635Open in IMG/M
3300012348|Ga0157140_10022949All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage656Open in IMG/M
3300012667|Ga0157208_10000054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage35075Open in IMG/M
3300012667|Ga0157208_10004630All Organisms → Viruses → Predicted Viral2274Open in IMG/M
3300013006|Ga0164294_10086848Not Available2341Open in IMG/M
3300013372|Ga0177922_11001616All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage947Open in IMG/M
3300017707|Ga0181363_1031309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1004Open in IMG/M
3300017747|Ga0181352_1046812All Organisms → Viruses → Predicted Viral1267Open in IMG/M
3300020160|Ga0211733_10417687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300020160|Ga0211733_10857912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300020162|Ga0211735_10405852All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300020205|Ga0211731_10027205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1776Open in IMG/M
3300020488|Ga0208051_102269All Organisms → Viruses → Predicted Viral2250Open in IMG/M
3300020490|Ga0208052_123391All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage510Open in IMG/M
3300020568|Ga0208598_1009288All Organisms → Viruses → Predicted Viral1609Open in IMG/M
3300020572|Ga0207909_1000124All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29031Open in IMG/M
3300021961|Ga0222714_10182841Not Available1225Open in IMG/M
3300021962|Ga0222713_10341266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage940Open in IMG/M
3300021962|Ga0222713_10521217All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300021962|Ga0222713_10615198All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300022179|Ga0181353_1000734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6443Open in IMG/M
3300024343|Ga0244777_10572206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage687Open in IMG/M
3300024346|Ga0244775_10015625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7050Open in IMG/M
3300024346|Ga0244775_10660004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage845Open in IMG/M
3300027608|Ga0208974_1011872Not Available2810Open in IMG/M
3300027693|Ga0209704_1077491Not Available931Open in IMG/M
3300027710|Ga0209599_10005795All Organisms → Viruses4256Open in IMG/M
3300027710|Ga0209599_10130802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300027739|Ga0209575_10110249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1000Open in IMG/M
3300027759|Ga0209296_1001068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage22012Open in IMG/M
3300027764|Ga0209134_10013429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2515Open in IMG/M
3300027798|Ga0209353_10253268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage757Open in IMG/M
3300027800|Ga0209800_10276632Not Available711Open in IMG/M
3300027808|Ga0209354_10014566All Organisms → cellular organisms → Bacteria3136Open in IMG/M
3300027816|Ga0209990_10098747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1419Open in IMG/M
3300027841|Ga0209262_10534788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage570Open in IMG/M
3300027900|Ga0209253_10453916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage964Open in IMG/M
3300027969|Ga0209191_1000821All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage22119Open in IMG/M
3300028027|Ga0247722_10016413All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3103Open in IMG/M
3300031758|Ga0315907_10062226All Organisms → Viruses → Predicted Viral3252Open in IMG/M
3300031758|Ga0315907_10341072All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300031784|Ga0315899_10028920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5849Open in IMG/M
3300031787|Ga0315900_10304281All Organisms → Viruses → Predicted Viral1319Open in IMG/M
3300031857|Ga0315909_10119670Not Available2230Open in IMG/M
3300031857|Ga0315909_10132129All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2088Open in IMG/M
3300031857|Ga0315909_10141952Not Available1993Open in IMG/M
3300031951|Ga0315904_10843555All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300031951|Ga0315904_11088353Not Available625Open in IMG/M
3300032092|Ga0315905_10241073All Organisms → Viruses → Predicted Viral1759Open in IMG/M
3300032093|Ga0315902_10892596Not Available685Open in IMG/M
3300033981|Ga0334982_0010006All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5640Open in IMG/M
3300033992|Ga0334992_0000637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage28636Open in IMG/M
3300033993|Ga0334994_0456870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300033994|Ga0334996_0318630Not Available765Open in IMG/M
3300033996|Ga0334979_0072028Not Available2196Open in IMG/M
3300033996|Ga0334979_0086502Not Available1971Open in IMG/M
3300034013|Ga0334991_0005471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9091Open in IMG/M
3300034061|Ga0334987_0239051All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1246Open in IMG/M
3300034061|Ga0334987_0548026Not Available694Open in IMG/M
3300034062|Ga0334995_0276795All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300034064|Ga0335001_0336432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300034073|Ga0310130_0001645All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11713Open in IMG/M
3300034082|Ga0335020_0055375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2078Open in IMG/M
3300034092|Ga0335010_0350488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300034101|Ga0335027_0006103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10565Open in IMG/M
3300034104|Ga0335031_0076171All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2389Open in IMG/M
3300034109|Ga0335051_0010985Not Available5017Open in IMG/M
3300034111|Ga0335063_0134400All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1456Open in IMG/M
3300034111|Ga0335063_0264087All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage931Open in IMG/M
3300034111|Ga0335063_0373113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300034119|Ga0335054_0534482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300034283|Ga0335007_0277518Not Available1112Open in IMG/M
3300034284|Ga0335013_0288789All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1048Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater17.16%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton11.19%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment7.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater5.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater5.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater4.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.73%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.99%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.99%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.99%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.24%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.75%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.75%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.75%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.75%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.75%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.75%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.75%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.75%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300002278Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300004242Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008118Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011184Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaGEnvironmentalOpen in IMG/M
3300011335Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - GumanEnvironmentalOpen in IMG/M
3300011336Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - PaldangEnvironmentalOpen in IMG/M
3300012346Freshwater microbial communities from Emily Creek, Ontario, Canada - S29EnvironmentalOpen in IMG/M
3300012347Freshwater microbial communities from Fish Creek, Ontario, Canada - S48EnvironmentalOpen in IMG/M
3300012348Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020488Freshwater microbial communities from Lake Mendota, WI - 17OCT2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020490Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020568Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027800Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028027Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FCEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034013Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034109Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J14230_1013060423300001282FreshwaterMNRLKTQQEKANERYAQESIKPLYAFIIVCVAFLITAILQNI*
B570J29590_10364343300002278FreshwaterLNPKPKTINMNRLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI*
B570J29032_10946535633300002408FreshwaterMNRLKTPQEKANERYARESIKPMYAFIIVLFAFLITAILQNI*
B570J40625_10042404723300002835FreshwaterMNKLKTPQQKANERYQAESIKPMYAFIIVCIAFLITAILQNI*
JGI25907J50239_105550223300003394Freshwater LakeMNKLKTQQQKANERYANESIKPIYAFLIVCVAFIITAILQNI*
JGI25930J51415_102438223300003499Freshwater LakeMNRLKTPQEKANERYQAESIKPIYAFIILCVAFIITAILQNI*
Ga0066600_1064126323300004155FreshwaterMNRLKTPQEKANERYQAESIKPLYAFIIVCVAFIITAILQNI*
Ga0007787_10018707103300004240Freshwater LakeTKTTNMNRLKTPQEKANERYQAESIKPIYAFIILCVAFIITAILQNI*
Ga0007787_1019231133300004240Freshwater LakeMNRLKTPQEKANERYKAESIKPMYAFIIVCVAFLITAILQNI*
Ga0066601_1004107013300004242FreshwaterQTNMNKLKTPQQKANERYQAESIKPMYAFIIICIAFLITAILQNI*
Ga0066599_10039981533300004282FreshwaterMNKLKTPQQKANERYAQESIKPLYAFIIVCVAFIITAILQNI*
Ga0069718_1596590343300004481SedimentMNRLKTPQEKANERYAQESIKPMYAFIIVCVAFIITAILQNL*
Ga0049081_10000086353300005581Freshwater LenticMNKLKSPQQKANERYAQESIKPMYAFIIVCFAFLVTAIMENL*
Ga0049081_1005691013300005581Freshwater LenticPQEKANERYQSESIKPMYAFIIVCIAFLITAILQNI*
Ga0049081_1016171423300005581Freshwater LenticMNKLKTPQQKANEQYARESIKPIYAFIIVLFAFLITAILQNI*
Ga0078894_1044985823300005662Freshwater LakeMNRLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI*
Ga0078894_1168005523300005662Freshwater LakeMNRLKTPQEKANERYQAESIKPMYAFIIVLFAFLITAILQNI*
Ga0070744_1001251753300006484EstuarineMNRLKTPQEKANERYAQESIKPMYAFIIVLFAFLITAILQNI*
Ga0070744_1014770143300006484EstuarineMNRLKTPQEKANEQYARESIKPMYAFIIVLVAFIITAILQNI*
Ga0070748_116763513300006920AqueousMNRLKTPQEIANERYKAESIKPIYAFIIVCVAFLITAILQNL*
Ga0114346_105214653300008113Freshwater, PlanktonMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0114346_113827143300008113Freshwater, PlanktonEKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0114347_1008714183300008114Freshwater, PlanktonMNKLKTPQEKANERYQAESIKPMYAFIIVCIAFLITAILQNI*
Ga0114347_103968943300008114Freshwater, PlanktonMNKLKTRQEKANERYQAESIKPMYAFIIVCIAFLITAILQNI*
Ga0114347_110565323300008114Freshwater, PlanktonMNRLKTPQEKANERYAQESIKPMYAFIIVLIAFLITAILQNI*
Ga0114347_120245423300008114Freshwater, PlanktonMNRLKTPQEKANERYAQESIKPMYAFIIVLVAFIITAILQNI*
Ga0114350_101515173300008116Freshwater, PlanktonMNKLKTPQQKANEQYARESIKPMYAFIIVLFAFLITAILQNI*
Ga0114351_139840513300008117Freshwater, PlanktonLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0114352_100743923300008118Freshwater, PlanktonMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNL*
Ga0114363_103612963300008266Freshwater, PlanktonMNKLKTQQQKANERYAQESIKPMYAFIIVLVAFLITAILQNI*
Ga0114363_117650123300008266Freshwater, PlanktonMNKLKTPQQKANERYQAESIKPMYAFIIVCIAFIITAILQNI*
Ga0114363_123314223300008266Freshwater, PlanktonMNRLKTPQEKANERYQAESIKPMYAFIIVLVAFIITAILQNI*
Ga0114364_101085653300008267Freshwater, PlanktonMNKLKTPQEKANERYAQESIKPMYAFIIVLIAFLITAILQNI*
Ga0114364_110302723300008267Freshwater, PlanktonMNRLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNL*
Ga0114364_116417513300008267Freshwater, PlanktonMNKLKTPQQKANERYQAESIKPIYAFIIVCVAFLITAILQNL*
Ga0114880_100894433300008450Freshwater LakeLHFNKPITNNMNKLKTPQQKAQERYAQESIKPMYAFIIVCFAFLVTAIMQNL*
Ga0114880_101086633300008450Freshwater LakeMNRLKTPQQKANEQYARESIKPLYAFIIVCVVFIITAILQNI*
Ga0114880_104180423300008450Freshwater LakeMNKLKTPQQKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0114880_105205933300008450Freshwater LakeMNKLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI*
Ga0114880_113288313300008450Freshwater LakeMNRLKTQQEKANERYAQESIKPMYAFIIVLIAFLITAILQNI*
Ga0114880_124218723300008450Freshwater LakeMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITA
Ga0105098_1014069443300009081Freshwater SedimentMNKLKTPQEKANEQYKVESIKPLYAFIIVCVAFLI
Ga0105103_1065436213300009085Freshwater SedimentKPKTTNMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0105103_1096662223300009085Freshwater SedimentMNTLKTPQQKANERYRSESINPLYAGIILAVAFILTAIIENL*
Ga0114975_10005892153300009164Freshwater LakeMNRLKTQQEKANERYAQESIKPMYAFIIVCIAFLITAILQNI*
Ga0105102_1003741523300009165Freshwater SedimentMNRLKTPQQKANERYAKESIKPMYAFIIVCVAFLITAIMQNL*
Ga0105102_1021739633300009165Freshwater SedimentMNRLKSPQQKANERYAQDSIKPMYAFIIVCVAFLITAILENL*
Ga0105102_1085949323300009165Freshwater SedimentMNKLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI*
Ga0105097_1011475813300009169Freshwater SedimentMNKLKTPQQKAQERYAQESIKPMYAFIIVCVAFLVTAIMQNL*
Ga0105096_1009368513300009170Freshwater SedimentMNKLKTPQEKANERYKAESSKPLYAFIIVCVAFLITAILQNI*
Ga0105096_1019062543300009170Freshwater SedimentMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAI
Ga0114974_10002981173300009183Freshwater LakeMNRLKNQQEKANERYAQESIKPMYAFIIVLTAFIITAILQNI*
Ga0114982_117405013300009419Deep SubsurfaceMNRLKTPQQKANERYAQESIKPMYAFIIVCVAFLITAIMQNL*
Ga0115546_114839913300009435Pelagic MarineMNKLKTPQEKANERYQAESIKPMYAFIIVLMAFLFTAILQNI*
Ga0114967_1002030683300010160Freshwater LakeMNKLKTHQQKAKERYIQESIKPVYAVIIICFALLVTAIMQNL*
Ga0114967_1032688213300010160Freshwater LakeKTQQEKANERYAQESIKPLYAFIIVCVAFLITAILQNI*
Ga0129324_1003213813300010368Freshwater To Marine Saline GradientMNRLKTPQQKANERYAQESIKPMYAFIIVCVAFLITAILQNL*
Ga0136709_105098223300011184FreshwaterMGVKPKFSNMNRLKTQQEKANERYAQESIKPLYAFIIVCVAFLITAILQNI*
Ga0153698_1227293300011335FreshwaterMNTLKTPQQKANERYRQESINPLYAGIIVMVALLITALIENL*
Ga0153703_1283133300011336FreshwaterMNKLKTPQQKANERYQADSIKPMYAFIIVCIAFIITAILQNI*
Ga0157141_1000115213300012346FreshwaterMNKLKTPQQKANERYAQESIKPMYAFIIVCVAFIITALIENL*
Ga0157142_104461213300012347FreshwaterMNRLKTPQEKANEQYARESIKPLYAFIIVCVAFIITAILQNI*
Ga0157140_1002294913300012348FreshwaterMNKLKTPQQKANERYQAESIKPIYAFLIVCVAFIITAILQNI*
Ga0157208_10000054323300012667FreshwaterMNRLKTPQQKANERYAQESIKPVYAFIIVCVAFIITAILQNI*
Ga0157208_1000463063300012667FreshwaterMNKLKTPQQKANERYQAESIRPMYAFIIVCVAFIITAILQNI*
Ga0164294_1008684833300013006FreshwaterMNKLKTSQEKANERYAQESIKPVYAVIIICFALLVTAIMQNL*
Ga0177922_1100161643300013372FreshwaterMNKLKTPQEKANERYQAESIKPMYAFIIVLFAFLITAILQNI*
Ga0181363_103130923300017707Freshwater LakeMNRLKTPQEKANERYQVESIKPMYAFIIVCVAFIITAILQNI
Ga0181352_104681213300017747Freshwater LakeTKTTNMNRLKTPQEKANERYQAESIKPMYAFIIVCVAFIITAILQNI
Ga0211733_1041768723300020160FreshwaterMNRLKTPQQKANERYAQESIKPMYAFIIVCVAFLITAILQNL
Ga0211733_1085791233300020160FreshwaterMNKLKTQQQKANERYAQESIKPMYAFIIVLVAFLITAILQNL
Ga0211735_1040585223300020162FreshwaterMNKLKTPQEKANERYAQESIKPMYAFIIVLVAFLITAILQNI
Ga0211731_1002720543300020205FreshwaterMNKLKTPQQKANERYQAESIKPMYAFIIICIAFLITAILQNI
Ga0208051_10226953300020488FreshwaterVRLFNAQINKPKTTNMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI
Ga0208052_12339133300020490FreshwaterKLKTPQQKANERYAQESIKPMYAFIIVCVAFLVTAIMQNL
Ga0208598_100928853300020568FreshwaterMNRLKTPQEKANERYAQESIKPMYGFIIVLIAFLITAILQNI
Ga0207909_1000124193300020572FreshwaterMNRLKTQQEKANERYAQESIKPLYAFIIVCVAFLITAILQNI
Ga0222714_1018284123300021961Estuarine WaterMNTLKTPQQKANERYRSESINPLYAGIILAVAFILTAIIENL
Ga0222713_1034126643300021962Estuarine WaterKTTNMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI
Ga0222713_1052121723300021962Estuarine WaterMNKLKTPEEKANERYQAESIKPMYAFIIVCIAFLITAILQNI
Ga0222713_1061519813300021962Estuarine WaterMNKLKTPQEKANERYQAESIKPLYAFIIVLFAFLITAILQNI
Ga0181353_1000734113300022179Freshwater LakeMNRLKTPQEKANERYQAESIKPIYAFIILCVAFIITAILQNI
Ga0244777_1057220623300024343EstuarineMNRLKTPQEKANERYAQESIKPMYAFIIVLVAFLITAILQNI
Ga0244775_10015625123300024346EstuarineMNRLKTPQEKANERYAQESIKPMYAFIIVLFAFLITAILQNI
Ga0244775_1066000443300024346EstuarineLKTPQEKANERYAQESIKQLYAFIILCVAFLITAILQNI
Ga0208974_101187213300027608Freshwater LenticMNKLKSPQQKANERYAQESIKPMYAFIIVCFAFLVTAIMENL
Ga0209704_107749113300027693Freshwater SedimentKMNRLKTPQQKANERYAKESIKPMYAFIIVCVAFLITAIMQNL
Ga0209599_1000579513300027710Deep SubsurfaceMNKLKTPQQKANERYAKESIKPMYAFIIVCVAFLVTAIMQNL
Ga0209599_1013080233300027710Deep SubsurfaceMNRLKTPQQKANERYAQESIKPMYAFIIVCVAFLITAIMQNL
Ga0209575_1011024943300027739FreshwaterQTNMNKLKTPQQKANERYQAESIKPMYAFIIICIAFLITAILQNI
Ga0209296_1001068283300027759Freshwater LakeMNRLKNQQEKANERYAQESIKPMYAFIIVLTAFIITAILQNI
Ga0209134_1001342963300027764Freshwater LakeMNRLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI
Ga0209353_1025326813300027798Freshwater LakeIQFLNQKQTNMNRLKTPQEKANERYQAESIKPMYAFIIVCVAFIITAILQNI
Ga0209800_1027663233300027800FreshwaterMNRLKTPQEKANERYQAESIKPMYAFIIVCIAFLITAILQ
Ga0209354_1001456653300027808Freshwater LakeMNKLKTQQQKANERYANESIKPIYAFLIVCVAFIITAILQNI
Ga0209990_1009874753300027816Freshwater LakeMNKLKTPQEKANERYQVESIKPMYAFIIVCIAFLITAILQNI
Ga0209262_1053478823300027841FreshwaterMNKLKTPQEKANERYQAESIKPMYAFIILCIAFLITAILQNI
Ga0209253_1045391623300027900Freshwater Lake SedimentMNKLKTPQQKAQERYAQESIKPMYAFIIVCVAFLVTAIMQNL
Ga0209191_1000821353300027969Freshwater LakeMNRLKTQQEKANERYAQESIKPMYAFIIVCIAFLITAILQNI
Ga0247722_1001641353300028027Deep Subsurface SedimentMNKLKTPQEKANERYAQESIKPMYAFIIVLAAFLITAILQNI
Ga0315907_1006222643300031758FreshwaterMNKLKTRQEKANERYQAESIKPMYAFIIVCIAFLITAILQNI
Ga0315907_1034107213300031758FreshwaterNRLKTPQEKANERYAQESIKPMYAFIIVLVAFIITAILQNI
Ga0315899_1002892073300031784FreshwaterMNKLKTPQEKANEQYARESIKPIYAFIILCVAFIITAILQNI
Ga0315900_1030428153300031787FreshwaterMNRLKTPQEKANERYQAESIKPMYAFIIVLFAFLITAILQNI
Ga0315909_1011967063300031857FreshwaterMNRLKTPQQKANEQYARESIKPLYAFIIVCVVFIITAILQNI
Ga0315909_1013212923300031857FreshwaterMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNI
Ga0315909_1014195233300031857FreshwaterMNKLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI
Ga0315904_1084355513300031951FreshwaterMNRLKTPQEKANERYQAESIKPMYAFIIVLVAFIITAILQNI
Ga0315904_1108835323300031951FreshwaterMNKLKTPQEKANERYQAESIKPMYAFIIVCIAFLITAI
Ga0315905_1024107353300032092FreshwaterMNKLKTPQEKANERYAQESIKPLYAFIIVCVAFLITAILQNI
Ga0315902_1089259613300032093FreshwaterMNKLKTPQEKANEQYARESIKPIYAFIILCVAFIITAILQN
Ga0334982_0010006_4958_50863300033981FreshwaterMNKLKTPQQKSNEQYARESIKPIYAFIIVLFAFLITAILQNI
Ga0334992_0000637_8490_86183300033992FreshwaterMNRLKTQQEKANERYAQESIKPMYAFIIVCVAFLITAILQNI
Ga0334994_0456870_299_4273300033993FreshwaterMNRLKTPQEKANERYKAESIKPMYAFIIVCVAFLITAILQNL
Ga0334996_0318630_459_5873300033994FreshwaterMNRLKTQQEKANERYAQESIKPMYAFIIVCVAFLITAILENL
Ga0334979_0072028_252_3803300033996FreshwaterMNKLKTPQQKANERYAQESIKPMYAFIIVCAAFLITAIMQNL
Ga0334979_0086502_1592_17203300033996FreshwaterMNKLKSPQQKANERYAQESIKPMYAFIIVCFALLVTAIMQNL
Ga0334991_0005471_5715_58433300034013FreshwaterMNKLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQNL
Ga0334987_0239051_829_9843300034061FreshwaterLNPKPKTTNMNRLKTPQEKANERYKAESIKPIYAFIIVCVAFLITAILQNI
Ga0334987_0548026_381_5093300034061FreshwaterMNRLKTPQQKANERYAQESIKPIYAFIIVCIAFLVTAIMQNL
Ga0334995_0276795_128_3013300034062FreshwaterVRLINAQFNKPKQNNMNRLKTPQEKANERYQAESIKPMYAFIIVLIAFLITAILQNI
Ga0335001_0336432_3_1253300034064FreshwaterMNRLKTPQEKANERYKAESIKPLYAFIIVCVAFLITAILQN
Ga0310130_0001645_3748_38763300034073Fracking WaterMNKLKTPQEKANEQYARESIRPMYAFIIVCVAFIITAILQNI
Ga0335020_0055375_616_7443300034082FreshwaterMNRLKTPQEKANERYARESIKPMYAFIIVLIAFLITAILQNI
Ga0335010_0350488_325_4533300034092FreshwaterMNRLKTPQEKANERYARESIKPMYAFIIVLFAFLITAILQNI
Ga0335027_0006103_8810_89383300034101FreshwaterMNRLKTPQEKANERYKAESIKPIYAFIIVLFAFLITAILQNI
Ga0335031_0076171_728_8563300034104FreshwaterMNRLKTPQEKANERYANESIKPMYAFIIICIAFLITAILQNI
Ga0335051_0010985_4425_45533300034109FreshwaterMNKLKTPQQKANEQYARESIKPIYAFIIVLFAFLITAILQNI
Ga0335063_0134400_339_4673300034111FreshwaterMNRLKTPQQKANERYAQESIKPLYAFIIVLVAFIITAILQNL
Ga0335063_0264087_740_8683300034111FreshwaterMNKLKTPQQKANERYAQESIKPMYAFIIVLFAFLITAILQNI
Ga0335063_0373113_423_5963300034111FreshwaterVRLINAQFNKPKQTNMNRLKTQQEKANERYAQESIKPMYAFIIVLIAFLITAILQNI
Ga0335054_0534482_446_5743300034119FreshwaterMNKLKTPQQKANERYKAESIKPIYAFIIVCVAFLITAILQNI
Ga0335007_0277518_634_7623300034283FreshwaterMNKLKTPQQKANERYAQESIKPMYAFIIVCFALLVTAIMENL
Ga0335013_0288789_907_10353300034284FreshwaterMNKLKTPQKKANERYAQESIKPIYAFIIVCVAFIITAILQNI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.