| Basic Information | |
|---|---|
| Family ID | F058937 |
| Family Type | Metagenome |
| Number of Sequences | 134 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MQTAAIAFLFAVAAVNGVLILLAVRAFLQGMRGSVDSFADPE |
| Number of Associated Samples | 47 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.82 % |
| % of genes near scaffold ends (potentially truncated) | 17.16 % |
| % of genes from short scaffolds (< 2000 bps) | 85.07 % |
| Associated GOLD sequencing projects | 43 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.179 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (28.358 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.552 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF02599 | CsrA | 35.07 |
| PF01555 | N6_N4_Mtase | 24.63 |
| PF07508 | Recombinase | 3.73 |
| PF12728 | HTH_17 | 2.24 |
| PF05069 | Phage_tail_S | 0.75 |
| PF02768 | DNA_pol3_beta_3 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1551 | sRNA-binding carbon storage regulator CsrA | Signal transduction mechanisms [T] | 35.07 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 24.63 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 24.63 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 24.63 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 3.73 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.75 |
| COG5005 | Mu-like prophage protein gpG | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.18 % |
| All Organisms | root | All Organisms | 35.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 28.36% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 26.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 23.13% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.72% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.24% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.49% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068876_101190524 | 3300005527 | Freshwater Lake | MQTAAIAFLLTAATVNGVLVVLALRAFLAGMRGSVDSFADPE* |
| Ga0049081_101214102 | 3300005581 | Freshwater Lentic | MQTVSIAFLLTVAAVNGVLIILALRAFLAGLRGSVDSFADWE* |
| Ga0075470_100376311 | 3300006030 | Aqueous | MQTAAIAFLFAVAAVNGVLIILAVRAFVATMRGSVDSFADPE* |
| Ga0075470_100395872 | 3300006030 | Aqueous | MQTAAIAFLAAAAAVNGILAILAIQAFLATMRGSVDSIDEWE* |
| Ga0075470_100409612 | 3300006030 | Aqueous | MQTAAIAFLFAVAAVNGVLILLAVRAFLQGMRGSVDSFADPE* |
| Ga0075470_100728871 | 3300006030 | Aqueous | MQTAAIAFLAVVVITNGVLIMLAVRAFVATMRGSVDSFADPE* |
| Ga0075470_100751301 | 3300006030 | Aqueous | MQTAAIAFLFAVAAANGVLIILAVRAFVATMRGSVDSFADPE* |
| Ga0075470_101051272 | 3300006030 | Aqueous | MQTAAIAFLFAVVMTNGVLIVLAVRAFLQGLRGSVDSICDPE* |
| Ga0075470_101200982 | 3300006030 | Aqueous | MQTAAIAFLFAVAAVNGILIMLAVRAFLQGLRGSVDSICDPE* |
| Ga0075470_101543932 | 3300006030 | Aqueous | MQTAAIAFLAAVVITNGVLIILAVRAFVATMRGSVDSIADPE* |
| Ga0075470_101737851 | 3300006030 | Aqueous | MQTAAIAFLFAVAAANAILIILAVRAFLQGLRGSVDSIADPE* |
| Ga0075470_102333062 | 3300006030 | Aqueous | MQTAAIAFLFAIAAANGVLIILAVRAFLQGMRGSVDSFADPE* |
| Ga0075470_102437302 | 3300006030 | Aqueous | MQTAAIAFLFAVAAANGVLIILAVRAFVATMRGSVDSIVDPE* |
| Ga0075471_102601332 | 3300006641 | Aqueous | MQTAAIAFLFAVAAVNGVLVLLAVRAFLQGMRGSVDSFADPE* |
| Ga0070749_103941072 | 3300006802 | Aqueous | MQTAAIAFLFAVAAANAILIILAVRAFVATMRGSVDSFADPE* |
| Ga0075464_108919501 | 3300006805 | Aqueous | MQTVSIAFLLTVAAVNGVLIVLAVRAFLQGLRGSVDSICDPE* |
| Ga0075473_100566103 | 3300006875 | Aqueous | MQTAAIAVLFAVAAVNGVLIILAVRAFVATMRGSVDSFADPE* |
| Ga0075472_102143271 | 3300006917 | Aqueous | HGDTMQTAAIAFLFAVAAANAILIILAVRAFLQGMRGSVDSFADPE* |
| Ga0070745_13584191 | 3300007344 | Aqueous | MQTAAIAFLFAVAAVNGVLIILAVRAFVATMRGSVDSIADPE* |
| Ga0075458_100136507 | 3300007363 | Aqueous | MQTAAIAFLLAVAAANAILIILAVRAFVATMRGSVDSFADPE* |
| Ga0075458_100247071 | 3300007363 | Aqueous | DTMQTAAIAFLFAVAAANAILIILAVRAFLQGLRGSVDSIADPE* |
| Ga0075458_100363531 | 3300007363 | Aqueous | MQTAAIAFLFAVATVNGVLIILAVRAFLQGLRGSVDSICDSE* |
| Ga0075458_101371133 | 3300007363 | Aqueous | MQTAAIAFLFAVAAANAILIILAVRAFLQGMRGSVDSFADPE* |
| Ga0114363_10356934 | 3300008266 | Freshwater, Plankton | MQTAAIAFLAAVAAVNGVLIILALRAFLAGMRGSVDSFADPE* |
| Ga0114363_10383943 | 3300008266 | Freshwater, Plankton | MQTVSIAFLLTVAAVNGVLVVLAVRAFLAGLRGSVDSIADPE* |
| Ga0114363_10581862 | 3300008266 | Freshwater, Plankton | MQTVSIAFLLTVAAVNGVLVLLAVRAFLAGLRGSVDSIADPE* |
| Ga0114363_10890124 | 3300008266 | Freshwater, Plankton | MQTVSIAFLLTVAAVNGVLIILALRAFLAGMRGSVD* |
| Ga0114363_10967971 | 3300008266 | Freshwater, Plankton | MQTIAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADP |
| Ga0114363_11285781 | 3300008266 | Freshwater, Plankton | AIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADPK* |
| Ga0114363_11310272 | 3300008266 | Freshwater, Plankton | MQTAAIAFLAAVVITNGVLIVLAVRAFVAGLRGSVDSFADPE* |
| Ga0114363_11448283 | 3300008266 | Freshwater, Plankton | MQTAAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADP |
| Ga0114363_12406261 | 3300008266 | Freshwater, Plankton | MQTAAIAFLLTVAAVNGVLVVLAVRAFLAGLRGGVDSIADPE* |
| Ga0114876_10297035 | 3300008448 | Freshwater Lake | MQTAAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDS |
| Ga0114876_10346757 | 3300008448 | Freshwater Lake | MQTAALAFLAVVAAVNGVLVVLAVRAFLGGLRGSVDSIADPE* |
| Ga0114876_10591011 | 3300008448 | Freshwater Lake | MQTAAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADPK* |
| Ga0114876_10876563 | 3300008448 | Freshwater Lake | MQTIAIAFLAAVAAVNGVLIILALRAFLAGMRGSVD* |
| Ga0114876_10971481 | 3300008448 | Freshwater Lake | MQTAAIAFLAVVAAVNGVLVLLAVRAFLVGLRGSVDSIADPE* |
| Ga0114876_12126652 | 3300008448 | Freshwater Lake | MQTAAIAFLAVVAAVNGVLILLAVRAFLQGMRGSVDSIPDPE* |
| Ga0114880_10244122 | 3300008450 | Freshwater Lake | MQTAAIAFLCVVAAANAILIVLAVRAFLQGMRGGVDSICDPE* |
| Ga0114880_10265452 | 3300008450 | Freshwater Lake | MQTAAIAFLAVAAAVNGVLILLALQAFLRGLRGSVDSIADPE* |
| Ga0129336_103703232 | 3300010370 | Freshwater To Marine Saline Gradient | MQTAAIAVLAAAAAVNGVLIILALRAFLAGLRGGVDSFADPE* |
| Ga0153799_10194293 | 3300012012 | Freshwater | MQTAAIAFLFVVAAVNGVLIVLAVRAFLRGLRGGVDSFADPE* |
| Ga0177922_101142589 | 3300013372 | Freshwater | MQTAAIAFLAVVAAVNGVLVVLAVRAFLAGLRGSVDSFADPE* |
| Ga0177922_106654183 | 3300013372 | Freshwater | MQTAAIASLFVVAAVNGVLIVLAVRAFLRGLRGSVDSFADWE* |
| Ga0177922_109682772 | 3300013372 | Freshwater | MQTAAIAFLLTVAAVNGVLVVLAVRAFLAGLRGSVDSF |
| Ga0177922_110550582 | 3300013372 | Freshwater | MQTAAIAFLATAAAVNGVLILLALRAFLAGLRGGVDSFADWE* |
| Ga0181352_11474432 | 3300017747 | Freshwater Lake | MQTAAIAFLAVAAAVNGVLILLAVRAFLAGLRGSVDSFADWE |
| Ga0181353_10630441 | 3300022179 | Freshwater Lake | MQTAAIAFLAVAAAVNGVLILLALRAFLAGLRGSVDSFADWE |
| Ga0208546_10104273 | 3300025585 | Aqueous | MQTAAIAFLFAVAAANAILIILAVRAFLQGLRGSVDSIADPE |
| Ga0208546_10316142 | 3300025585 | Aqueous | MQTAAIAFLFAVVMTNGVLIVLAVRAFLQGLRGSVDSICDPE |
| Ga0208546_10370943 | 3300025585 | Aqueous | MQTAAIAFLFAVAAANGVLIILAVRAFVATMRGSVDSFADPE |
| Ga0208546_10428221 | 3300025585 | Aqueous | MQTAAIAFLAAAAAVNGILAILAIQAFLATMRGSVDSIDEWE |
| Ga0208546_10428281 | 3300025585 | Aqueous | MQTAAIAFLFAVAAVNGVLIILAVRAFVATMRGSVDSFADPE |
| Ga0208546_10541122 | 3300025585 | Aqueous | MQTAAIAFLFAVAAVNGILIMLAVRAFLQGLRGSVDSICDPE |
| Ga0208546_10583332 | 3300025585 | Aqueous | MQTAAIAFLFAVAAVNGVLILLAVRAFLQGMRGSVDSFADPE |
| Ga0208147_10058483 | 3300025635 | Aqueous | MQTVSIAFLLTVAAVNGVLIILALRAFLAGLRGSVDSFADPE |
| Ga0208147_10128452 | 3300025635 | Aqueous | MQTAAIAFLLAVAAANAILIILAVRAFVATMRGSVDSFADPE |
| Ga0208147_11368582 | 3300025635 | Aqueous | MQTAAIAFLFAVAAVNGVLIILAVRAFVATMRGSVDSIADPE |
| Ga0208784_10268012 | 3300025732 | Aqueous | MQTAAIAFLAVVVITNGVLIMLAVRAFVATMRGSVDSFADPE |
| Ga0208005_10097964 | 3300025848 | Aqueous | QTAAIAFLAAVVITNGVLIILAVRAFVATMRGSVDSIADPE |
| Ga0208005_10675181 | 3300025848 | Aqueous | MQTAAIAFLFAIAAANGVLIILAVRAFLQGMRGSVDSFADPE |
| Ga0208005_11019512 | 3300025848 | Aqueous | QTAAIAFLLTAAAVNGVLILLAVRAFLQGMRGSVDSFADPE |
| Ga0208005_11798442 | 3300025848 | Aqueous | MQTAAIAFLFAVAAANAILIILAVRAFVATMRGSVDSFADPE |
| Ga0208005_12188802 | 3300025848 | Aqueous | MQTAAIAFLFAVAAVNGILIILAVRAFVATMRGSVDSIADPE |
| Ga0208005_12241611 | 3300025848 | Aqueous | MQTAAIAFLLTAAAVNGVLILLAVRAFLQGMRGSVDSFADPE |
| Ga0209229_103164571 | 3300027805 | Freshwater And Sediment | MQTAAIAFLAVVVITNGVLVVLAVRAFLAGLRGSVDSIADPE |
| Ga0209229_103221122 | 3300027805 | Freshwater And Sediment | MQTAAIAFLAVAAAVNGVLIVLAVRAFLQGMRGSVD |
| Ga0315907_100656861 | 3300031758 | Freshwater | MQTAAIAFLAAVAAVNGVLIILALRAFLAGMRGSVDSFADPE |
| Ga0315907_108980642 | 3300031758 | Freshwater | MQTVSIAFLLTVAAVNGVLIILALRAFLAGMRGSVD |
| Ga0315907_111103811 | 3300031758 | Freshwater | MQTAAIAFLAAVVITNGVLIVLAVRAFVAGLRGSVDSFADPE |
| Ga0315900_1000947418 | 3300031787 | Freshwater | MQTAAIAFLAVVAAVNGVLVLLAVRAFVAGLRGSVDSFADWE |
| Ga0315900_100381723 | 3300031787 | Freshwater | MQTVSIAFLLTVAAVNGVLVVLAVRAFLAGLRGSVDSIADPE |
| Ga0315900_102519274 | 3300031787 | Freshwater | MQTAAIAFLLTVAAVNGVLVVLAVRAFLAGLRGGVDSIADPE |
| Ga0315900_104785033 | 3300031787 | Freshwater | MQTVSIAFLLTVAAVNGVLVVLALRAFLAGLRGSVDSIADPE |
| Ga0315900_110625922 | 3300031787 | Freshwater | IAFLAAVAATNAILIVLAVRAFLLGMRGSVDSIADPK |
| Ga0315900_111324241 | 3300031787 | Freshwater | MQTAAIAFLLTVAAVNGVLIILALRAFLAGMRGSVDSIADPE |
| Ga0315909_101032053 | 3300031857 | Freshwater | MQTIAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADPK |
| Ga0315909_101458413 | 3300031857 | Freshwater | MQTAAIAFLAVVAAVNGVLILLAVRAFLAGLRGGVDSIADPE |
| Ga0315909_101578971 | 3300031857 | Freshwater | MQTAAIAFLCVVAAANAILIVLAVRAFLQGMRGGVDSICDPE |
| Ga0315909_106288153 | 3300031857 | Freshwater | MQTVSIAFLLTVAAVNGVLVVLAFRAFLAGLRGSVDSIADPE |
| Ga0315909_107861732 | 3300031857 | Freshwater | MQTAAIAFLAVVAAVNGVLVVLAVRAFLAGLRGSVDSFADPE |
| Ga0315909_108535182 | 3300031857 | Freshwater | VLLAGAPMQTAAIAFLAAAAAVNGVLVVLALRAFLAGMRGSVD |
| Ga0315904_101663662 | 3300031951 | Freshwater | MQTTAIAFLLVVAAVNGVLILLAVRAFLQGMRGSVD |
| Ga0315904_103372851 | 3300031951 | Freshwater | MQTVSIAFLLTVAAVNGVLVLLAVRAFLAGLRGSVDSIADPE |
| Ga0315904_103391593 | 3300031951 | Freshwater | MQTAAIAFLATAAAVNGVLIVLALRAFLAGLRGSVDSFADPE |
| Ga0315904_104599031 | 3300031951 | Freshwater | MQTAAIAFLLTVAAVNGVLVLLAVRAFLAGLRGSVDSIA |
| Ga0315904_106765532 | 3300031951 | Freshwater | MQTAAIAFLAAVVAVNGVLILLAVRAFLAGLRGGVDSICDPE |
| Ga0315904_108032731 | 3300031951 | Freshwater | MQTAAIAFLAAVAATNAILIVLAVRAFLLGMRGSVDSIADPK |
| Ga0315904_108551532 | 3300031951 | Freshwater | MQTVSIAFLLTVATVNGVLIVLALRAFLAGMRGGVDSICDPE |
| Ga0315904_109188112 | 3300031951 | Freshwater | AFLFAVAATNAILIVLAVRAFLLGMRGSVDSIADPK |
| Ga0315901_102531022 | 3300031963 | Freshwater | MQTAAIAFLAAVVAVNGVLILLAVRAFLAGLRGGVDSIADPE |
| Ga0315901_103255571 | 3300031963 | Freshwater | MQTIAIAFLFAVAATNGVLALLAVRAFLAGLRGSVDSIADPE |
| Ga0315901_103286812 | 3300031963 | Freshwater | TNHGDTMQTTAIAFLLVVAAVNGVLILLAVRAFLQGMRGSVD |
| Ga0315901_103609831 | 3300031963 | Freshwater | MQTAAIAFLLTVAAVNGVLVLLAVRAFLAGLRGSVDSFADPE |
| Ga0315901_108424621 | 3300031963 | Freshwater | AIAFLAAVVAVNGVLILLAVRAFLAGLRGGVDSICDPE |
| Ga0315902_104552683 | 3300032093 | Freshwater | QTIAIAFLFAVAATNGVLILLAVRAFLLGMRGSVDSIADPK |
| Ga0315902_104757042 | 3300032093 | Freshwater | MQTAAIAFLAVVAAVNGVLILLAVRAFLQGMRGSVDSIPDPE |
| Ga0315903_102337551 | 3300032116 | Freshwater | MQTAAIAFLLTAAAVNGVLIVLAVRAFLVGLRGSVDSFADPE |
| Ga0315903_104168082 | 3300032116 | Freshwater | MQTAAIAFLFAVAATNAILIVLAVRAFLLGMRGSVDSIADPK |
| Ga0315903_105256171 | 3300032116 | Freshwater | AGAPMQTAAIAFLAAVVAVNGVLILLAVRAFLAGLRGGVDSIADPE |
| Ga0315903_105620822 | 3300032116 | Freshwater | MQTAAIAFLLTVAAVNGVLVLLAVRAFLAGLRGSVDSIADPE |
| Ga0315903_108988022 | 3300032116 | Freshwater | MQTAAIAFLAAVAAVNGVLVLLAVRAFLAGLRGSVDSFADWE |
| Ga0315903_110127721 | 3300032116 | Freshwater | MQTVSIAFLLTVAAVNGVFIILALRAFLAGMRGSVD |
| Ga0334980_0032025_1801_1929 | 3300033816 | Freshwater | MQTAAIAFLAVTAAVNAILIVLAVRAFLAGLRGSVDSIADPE |
| Ga0334980_0063878_1331_1459 | 3300033816 | Freshwater | MQTAAIAFLLTVAAVNGVLVVLAARAFLQGLRGSVDSIADPE |
| Ga0334978_0053413_1941_2069 | 3300033979 | Freshwater | MQTAAIAFLAVAAAVNGVLILLAVRAFLQGLRGDVDSIADPE |
| Ga0334981_0238097_15_143 | 3300033980 | Freshwater | MQTAAIASLFVVAAVNAILIVLAIRAFLAGLRGSVDSIADPE |
| Ga0334981_0347399_156_284 | 3300033980 | Freshwater | MQTAAIAFLLTVAAVNGVLVVLAARAFLATMRGSVDSIADPE |
| Ga0334982_0081481_1591_1719 | 3300033981 | Freshwater | MQTAAIAFLLTAAAVNAILIVLAVRAFLAGLRGSVDSIADPE |
| Ga0334982_0510916_118_246 | 3300033981 | Freshwater | MQTAAIASLFVVAAVNGVLIVLAVLAFLQGMRGSVDSIADPE |
| Ga0334994_0526599_352_480 | 3300033993 | Freshwater | MQTAAIAFLAAVVITNGVLVILAVRAFLAGMRGSVDSFADPE |
| Ga0334986_0296389_85_213 | 3300034012 | Freshwater | MQTAAIAFLFVATAVNGVLIVLAVQAFLQGMRGSVDSIADPE |
| Ga0334986_0300407_596_724 | 3300034012 | Freshwater | MQTAAIAFLAVAAAVNGVLILLAVRAFLAGMRGSVDSFADPE |
| Ga0334986_0474345_294_422 | 3300034012 | Freshwater | MQTAAIAFLAVTAAVNGVLILLAVRAFLAGLRGSVDSFADPE |
| Ga0334986_0527421_120_248 | 3300034012 | Freshwater | MQTAAIAFLAVAAAVNGVLIVLAVRAFLQGLRGSVDSIADPE |
| Ga0335002_0159998_1184_1312 | 3300034020 | Freshwater | MQTAAIASLFVVAAVNGVLIVLAVRAFLVGMRGSVDSFADPE |
| Ga0335002_0167891_714_842 | 3300034020 | Freshwater | MQTAAIAFLLTAAAVNAILIVLAIRAFLAGLRGSVDSIADPE |
| Ga0335002_0621948_410_538 | 3300034020 | Freshwater | MQTLSIAFLAAVVAVNGVLIVLAVRAFLAGLRGSVDSFADPE |
| Ga0335002_0664537_140_268 | 3300034020 | Freshwater | MQTAAIAFLLTVAAVNGVLVVLAVRAFLAGMRGSVDSIADWE |
| Ga0334995_0400270_728_856 | 3300034062 | Freshwater | MQTAAIAFLAVAAAVNGVLILLAVRAFFAGMRGSVDSFADPE |
| Ga0335027_0670897_64_192 | 3300034101 | Freshwater | MQTAAIAFLAVTAAVNGVLILLAVRAFFAGMRGSVDSFADPE |
| Ga0335031_0389581_599_727 | 3300034104 | Freshwater | MQTAAIAFLLTAAAVNGVLVVLAVRAFLQGLRGSVDSFADPE |
| Ga0335031_0538224_117_245 | 3300034104 | Freshwater | MQTAAIAFLLTVAAVNGVLIVLALRAFLAGMRGSVDSFADWE |
| Ga0335063_0257813_37_165 | 3300034111 | Freshwater | MQTAAIAFLAVTAAVNGVLVVLAVRAFLQGLRGSVDSFADPE |
| Ga0335063_0414866_163_291 | 3300034111 | Freshwater | MQTAAIAFLAVAAAVNGVLIVLAVRAFLAGLRGSVDSFADWE |
| Ga0335063_0538114_69_197 | 3300034111 | Freshwater | MQTAAIAFLAVAAAVNGVLVVLAVRAFLQGMRGSVDSFADPE |
| Ga0335066_0100688_3_128 | 3300034112 | Freshwater | QTAAIASLFVVAAVNAILIVLAIRAFLAGLRGSVDSIADPE |
| Ga0335066_0170937_53_181 | 3300034112 | Freshwater | MQTAAIAFLAVAAAVNGVLILLAVRAFLQGLRGSVDSIADPE |
| Ga0335053_0275893_44_172 | 3300034118 | Freshwater | MQTAAIAFLAVAAAVNGVLILLAVRAFLQGMRGSVDSFADPE |
| Ga0335053_0744720_181_309 | 3300034118 | Freshwater | MQTAAIASLLVVAAVNGVLILLAVRAFLAGLRGSVDSFADPE |
| Ga0335056_0525875_344_472 | 3300034120 | Freshwater | MQTAAIAFLLTAAAVNGVLIVLALQAFLAGMRGSVDSIADPE |
| Ga0335060_0309965_26_154 | 3300034122 | Freshwater | MQTAAIAFLLTAAAVNGVLILLAVRAFLAGMRGSVDSIADWE |
| Ga0335049_0495894_1_114 | 3300034272 | Freshwater | MQTVSIAFLAAVVITNGVLIILAIRAFLVGMRGSVDSF |
| Ga0334997_0545000_569_697 | 3300034280 | Freshwater | MQTAAIAFLLTAAAVNGVLILLAMRAFLQGMRGSVDSIADPE |
| ⦗Top⦘ |