| Basic Information | |
|---|---|
| Family ID | F058898 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 73.13 % |
| % of genes from short scaffolds (< 2000 bps) | 67.91 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.373 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.134 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.507 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.224 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF14559 | TPR_19 | 20.15 |
| PF13432 | TPR_16 | 11.94 |
| PF01960 | ArgJ | 8.96 |
| PF08281 | Sigma70_r4_2 | 2.24 |
| PF16561 | AMPK1_CBM | 1.49 |
| PF13414 | TPR_11 | 0.75 |
| PF13431 | TPR_17 | 0.75 |
| PF01476 | LysM | 0.75 |
| PF02922 | CBM_48 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 8.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.37 % |
| Unclassified | root | N/A | 24.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10814107 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300002558|JGI25385J37094_10069072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1132 | Open in IMG/M |
| 3300002560|JGI25383J37093_10048267 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1382 | Open in IMG/M |
| 3300002912|JGI25386J43895_10012550 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300002912|JGI25386J43895_10157735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300005174|Ga0066680_10160130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1411 | Open in IMG/M |
| 3300005175|Ga0066673_10246834 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300005175|Ga0066673_10262046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1003 | Open in IMG/M |
| 3300005177|Ga0066690_10582887 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005181|Ga0066678_10081197 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| 3300005181|Ga0066678_10108679 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300005446|Ga0066686_10496594 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005447|Ga0066689_10389321 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 871 | Open in IMG/M |
| 3300005454|Ga0066687_10090489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1523 | Open in IMG/M |
| 3300005458|Ga0070681_11473088 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005467|Ga0070706_101326782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
| 3300005468|Ga0070707_100819749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 894 | Open in IMG/M |
| 3300005536|Ga0070697_100325285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1325 | Open in IMG/M |
| 3300005536|Ga0070697_100375626 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1230 | Open in IMG/M |
| 3300005536|Ga0070697_100681145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 906 | Open in IMG/M |
| 3300005545|Ga0070695_101443099 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300005555|Ga0066692_10151629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1423 | Open in IMG/M |
| 3300005556|Ga0066707_10146360 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300005574|Ga0066694_10092091 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1412 | Open in IMG/M |
| 3300005575|Ga0066702_10862663 | Not Available | 539 | Open in IMG/M |
| 3300005576|Ga0066708_10163478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1376 | Open in IMG/M |
| 3300005879|Ga0075295_1045211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
| 3300005879|Ga0075295_1059686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300006031|Ga0066651_10458110 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006046|Ga0066652_100142373 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300006796|Ga0066665_10527614 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300006800|Ga0066660_11313156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300006804|Ga0079221_10020381 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300006847|Ga0075431_101500380 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300009012|Ga0066710_102094391 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
| 3300009090|Ga0099827_11655983 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300009137|Ga0066709_100539716 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300009137|Ga0066709_102015435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300009147|Ga0114129_10595632 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300010301|Ga0134070_10088961 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300010320|Ga0134109_10072423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1170 | Open in IMG/M |
| 3300010321|Ga0134067_10477751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
| 3300010323|Ga0134086_10430496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300010325|Ga0134064_10041385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1387 | Open in IMG/M |
| 3300010329|Ga0134111_10550870 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010337|Ga0134062_10271426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 795 | Open in IMG/M |
| 3300010397|Ga0134124_12971616 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012189|Ga0137388_11893848 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300012199|Ga0137383_10526077 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 866 | Open in IMG/M |
| 3300012200|Ga0137382_10522646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 844 | Open in IMG/M |
| 3300012201|Ga0137365_10412763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 996 | Open in IMG/M |
| 3300012203|Ga0137399_10515559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1003 | Open in IMG/M |
| 3300012204|Ga0137374_11224371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300012206|Ga0137380_11167255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
| 3300012207|Ga0137381_10253694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1529 | Open in IMG/M |
| 3300012208|Ga0137376_10633600 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 924 | Open in IMG/M |
| 3300012209|Ga0137379_11359037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 615 | Open in IMG/M |
| 3300012210|Ga0137378_11854154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300012351|Ga0137386_10004263 | All Organisms → cellular organisms → Bacteria | 9402 | Open in IMG/M |
| 3300012351|Ga0137386_10912331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
| 3300012353|Ga0137367_10215166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1389 | Open in IMG/M |
| 3300012354|Ga0137366_10231111 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300012356|Ga0137371_10742962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 749 | Open in IMG/M |
| 3300012360|Ga0137375_11322945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300012917|Ga0137395_10683470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300012922|Ga0137394_11216955 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300012975|Ga0134110_10063353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1465 | Open in IMG/M |
| 3300012976|Ga0134076_10101182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1143 | Open in IMG/M |
| 3300014157|Ga0134078_10251368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
| 3300015052|Ga0137411_1215336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
| 3300015052|Ga0137411_1305273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4440 | Open in IMG/M |
| 3300015245|Ga0137409_10175178 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300015356|Ga0134073_10085997 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 907 | Open in IMG/M |
| 3300015359|Ga0134085_10104009 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300015359|Ga0134085_10616003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300017959|Ga0187779_11161535 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300018084|Ga0184629_10045131 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300018431|Ga0066655_10217951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1194 | Open in IMG/M |
| 3300018433|Ga0066667_11374536 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
| 3300019866|Ga0193756_1000653 | All Organisms → cellular organisms → Bacteria | 2967 | Open in IMG/M |
| 3300020004|Ga0193755_1000055 | All Organisms → cellular organisms → Bacteria | 29303 | Open in IMG/M |
| 3300020059|Ga0193745_1116900 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021046|Ga0215015_10214584 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6506 | Open in IMG/M |
| 3300021080|Ga0210382_10564374 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300024330|Ga0137417_1277891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1278 | Open in IMG/M |
| 3300024330|Ga0137417_1383106 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
| 3300025324|Ga0209640_10099185 | All Organisms → cellular organisms → Bacteria | 2512 | Open in IMG/M |
| 3300025905|Ga0207685_10235201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 878 | Open in IMG/M |
| 3300026295|Ga0209234_1065149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1386 | Open in IMG/M |
| 3300026298|Ga0209236_1120392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1158 | Open in IMG/M |
| 3300026301|Ga0209238_1186815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
| 3300026308|Ga0209265_1236831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300026310|Ga0209239_1173354 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 823 | Open in IMG/M |
| 3300026314|Ga0209268_1002471 | All Organisms → cellular organisms → Bacteria | 8791 | Open in IMG/M |
| 3300026314|Ga0209268_1071534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1039 | Open in IMG/M |
| 3300026314|Ga0209268_1189249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300026333|Ga0209158_1314680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300026551|Ga0209648_10779291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300027573|Ga0208454_1014538 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300027725|Ga0209178_1017233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2255 | Open in IMG/M |
| 3300032205|Ga0307472_102486450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300032770|Ga0335085_10878748 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 979 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.24% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.49% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.49% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_108141071 | 3300001686 | Soil | AILAVKVPGGGNXELEALLLAGAVTLVALGDGPLSVAVRFKHSPT* |
| JGI25385J37094_100690721 | 3300002558 | Grasslands Soil | CMMFEMAVAMLVQLHGGHNIELEGLLFAGALTLVALGDGPLSIAIRFKRPPA* |
| JGI25383J37093_100482672 | 3300002560 | Grasslands Soil | LCMALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| JGI25386J43895_100125503 | 3300002912 | Grasslands Soil | CMMVEMAVAMLVQLHGGHNIELEGLLFAGALTLVALGDGPLSVAVRLKHGN* |
| JGI25386J43895_101577352 | 3300002912 | Grasslands Soil | MALEMLVAILAVKLPHSGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0066680_101601302 | 3300005174 | Soil | CMAIEMLVAILAVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGGS* |
| Ga0066673_102468342 | 3300005175 | Soil | ACMAVEMVVAILTIQLPRGSSFELEGLLLAGALTLMALGDGPLSLAVRFKKPTV* |
| Ga0066673_102620462 | 3300005175 | Soil | EMLVAILAVQLRKGAGFEVEGLLFAGAITLIALGDGPLSIAVKLKHSS* |
| Ga0066690_105828872 | 3300005177 | Soil | MAIEMLVAIFALKVPHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSG* |
| Ga0066678_100811973 | 3300005181 | Soil | AVEMLVAILVVRLPHHGNFELEGLLFAGAVTLVALGDGPLSVAVKLKHGT* |
| Ga0066678_101086791 | 3300005181 | Soil | ACMAVEMLVAILAVQLPRHGNFELEGLLFAGALTLVALGDGPLSVAVKLKHGT* |
| Ga0066686_104965942 | 3300005446 | Soil | CMAVEMVVAILTIQLPRGSSFELEGLLLAGALTLMALGDGPLSIAVRFKKPTV* |
| Ga0066689_103893211 | 3300005447 | Soil | VAILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLRHGS* |
| Ga0066681_108197641 | 3300005451 | Soil | AVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSST* |
| Ga0066687_100904892 | 3300005454 | Soil | FAVKVPHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHGS* |
| Ga0070681_114730882 | 3300005458 | Corn Rhizosphere | TMAVVMVVAIVAVKIPGGRSWELEALLLAGAVTLVALGDGPLSIAVRFKRPST* |
| Ga0070706_1013267821 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ALCMALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0070707_1008197492 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIFAVKVPHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSSS* |
| Ga0070697_1003252852 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LCMALEMIIAILAVKLPHGGNIELEALLFAGAITLVALGDGPLSIAVKLKHSG* |
| Ga0070697_1003756262 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LALKLPHRGNFELEGLLFAGAITLVALGDGPLSVAVKLKHSS* |
| Ga0070697_1006811451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LALKLPHRGNFELEGLLFAGAITLVALGDGPLSVAVKLKHGT* |
| Ga0070695_1014430991 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0066692_101516291 | 3300005555 | Soil | ALEMIVAILAVKLPHSGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0066707_101463601 | 3300005556 | Soil | MVVAILAVKVRGGGNFELEALLLAGAVTLVALGDGPLSVAVRFKQRPS* |
| Ga0066704_100372271 | 3300005557 | Soil | GGNIELEALLLAGALTLVALGDGPLSVAIGLKRGRS* |
| Ga0066694_100920912 | 3300005574 | Soil | ILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVRFKHTGT* |
| Ga0066702_108626631 | 3300005575 | Soil | VKVPHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0066708_101634782 | 3300005576 | Soil | MVVAILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVRFKHTGT* |
| Ga0066654_100072916 | 3300005587 | Soil | GGNFELEGLLFAGAITLFALGDGPLSVAVKLKHTGT* |
| Ga0075295_10452111 | 3300005879 | Rice Paddy Soil | VQLPKGAGFEVEGLLFAGAVTLIALGDGPLSIAVRLKHSST* |
| Ga0075295_10596862 | 3300005879 | Rice Paddy Soil | VEMVIAILAVKLPQHGNIELEGLLFAGAVTLFALGDGPLSVAIGLKRRG* |
| Ga0066651_104581101 | 3300006031 | Soil | FNMAVAILAVVLPKPPELEGLLLAGSLTLVALGDGPLSIGIYFKKPAM* |
| Ga0066651_107473222 | 3300006031 | Soil | QLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGGS* |
| Ga0066652_1001423731 | 3300006046 | Soil | EMLVAILAVQLPRHGNFELEGLLFAGALTLVALGDGPLSVAVKLKHGT* |
| Ga0075417_100557281 | 3300006049 | Populus Rhizosphere | LLPHGQIPELEGMLLAGSLALVALGDGPLSIGLTLKKGSD* |
| Ga0079222_114147322 | 3300006755 | Agricultural Soil | PKGASFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSGN* |
| Ga0066665_105276142 | 3300006796 | Soil | EMVVAILAVKVRGGGNFELEALLLAGAVTLVALGDGPLSVAVRFKQRPS* |
| Ga0066659_101164553 | 3300006797 | Soil | GSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSG* |
| Ga0066660_113131561 | 3300006800 | Soil | MAIEMVVAILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLRHGS* |
| Ga0079221_100203813 | 3300006804 | Agricultural Soil | VIVILALKLPHRGNFELEGLLFAGAITLVALGDGPLSVAVKLKHGT* |
| Ga0075431_1015003802 | 3300006847 | Populus Rhizosphere | MVVAIIAVRLAGHQSFELEALLLAGALTLVALGDGPLSIAVKFKQRS* |
| Ga0075433_107765912 | 3300006852 | Populus Rhizosphere | LPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0075424_1001325581 | 3300006904 | Populus Rhizosphere | DFELEALLLAGAVTLVALGDGPLSVAVRFKRPSEQS* |
| Ga0099793_101358152 | 3300007258 | Vadose Zone Soil | NLELEALLLAGAVTLVALGDGPLSIAVRFKQPGS* |
| Ga0066710_1020943911 | 3300009012 | Grasslands Soil | MALEMIVAILAVKLPHSGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0066710_1022970821 | 3300009012 | Grasslands Soil | VPRGGNIELEALLLAGALTLVALGDGPLSVAIGLKRGDS |
| Ga0099827_116559832 | 3300009090 | Vadose Zone Soil | VEMVVAILLVKVPHGGNIELEGLLLAGAITLVALGDGPVSVAVRSIQNN* |
| Ga0066709_1005397163 | 3300009137 | Grasslands Soil | LAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHGGS* |
| Ga0066709_1020154352 | 3300009137 | Grasslands Soil | CMAIEMVVAILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLRHGG* |
| Ga0114129_105956322 | 3300009147 | Populus Rhizosphere | MAVEMVVAILTIQLPRGSSFELEGLLLAGALTLMALGDGPLSIAVRFKRPAM* |
| Ga0134070_100889612 | 3300010301 | Grasslands Soil | AILTVQLPHGSNFELEGLLLAGAVTLMALGDGPLSVAVRFKRPAI* |
| Ga0134109_100724231 | 3300010320 | Grasslands Soil | AILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVRFKHTGT* |
| Ga0134109_101798441 | 3300010320 | Grasslands Soil | SGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGGS* |
| Ga0134067_100602491 | 3300010321 | Grasslands Soil | GNFELEGLLFAGAITLFALGDGPLSVAVKLKHGS* |
| Ga0134067_104777511 | 3300010321 | Grasslands Soil | EMLVAILAVQLRKGAGFEVEGLLFAGAITLIALGDGPLSIAVKLKHSA* |
| Ga0134084_101702132 | 3300010322 | Grasslands Soil | PHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0134086_104304962 | 3300010323 | Grasslands Soil | IAAVKVPSGGNIELEALLLAGAVTLVALGDGPLSIAVRFKHGG* |
| Ga0134064_100413851 | 3300010325 | Grasslands Soil | LEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSG* |
| Ga0134111_105508702 | 3300010329 | Grasslands Soil | AWCMAIEMLVAILAVQLPKGVNFELEGLLFAGAITLVALGDGPLSVAVKLKHGS* |
| Ga0134080_105219162 | 3300010333 | Grasslands Soil | GNIELEGLLFAGAITLVALGDGPLSIAVKLKHTS* |
| Ga0134063_100865012 | 3300010335 | Grasslands Soil | GSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSS* |
| Ga0134062_102714261 | 3300010337 | Grasslands Soil | MAVEMVVAILAEKLPHGGNIDVEALLFAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0134124_129716162 | 3300010397 | Terrestrial Soil | EMVVAILAVTLPGHQNFELEALLLAGAVTLVALGDGPLSVAVKFKHSPT* |
| Ga0137457_10164531 | 3300011443 | Soil | NFELEALLLAGAVTLVALGDGPLSIAVRFKQAPS* |
| Ga0137388_118938481 | 3300012189 | Vadose Zone Soil | CMALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0137383_105260771 | 3300012199 | Vadose Zone Soil | IAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHTS* |
| Ga0137382_105226462 | 3300012200 | Vadose Zone Soil | AILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVKFKHTGT* |
| Ga0137365_104127632 | 3300012201 | Vadose Zone Soil | LEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0137399_105155592 | 3300012203 | Vadose Zone Soil | AVEMVVAILAAKVPQRGNIELEGLLLAGAITLVALGDGPLSIAIGLKRRA* |
| Ga0137374_112243711 | 3300012204 | Vadose Zone Soil | VEMVVAILAVKLPHGGNIELEALLFAGALTLVALGDGPLSVAIGLKRGRS* |
| Ga0137380_111672552 | 3300012206 | Vadose Zone Soil | EMVVAILAVKVPQAGNFELEGLLLAGAITLVALGDGPLSIAIGLKRGL* |
| Ga0137381_102536941 | 3300012207 | Vadose Zone Soil | KVPQAENFELEGLLLAGAITLVALGDGPLSVAIGLKRGL* |
| Ga0137381_114407541 | 3300012207 | Vadose Zone Soil | KGAGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSST* |
| Ga0137376_106336002 | 3300012208 | Vadose Zone Soil | MAVEMVVAILAVKVPQAGNFELEGLLLAGAITLVALGDGPLSIAIGLKRGL* |
| Ga0137379_1001478910 | 3300012209 | Vadose Zone Soil | GGHNIELEGLLFAGALTLVALGDGPLSVAVRFKHTGM* |
| Ga0137379_113590371 | 3300012209 | Vadose Zone Soil | MALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHTS* |
| Ga0137378_118541542 | 3300012210 | Vadose Zone Soil | ALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHTS* |
| Ga0137386_100042631 | 3300012351 | Vadose Zone Soil | MAVAIFAVKVPRGGNIELEALLLAGALTLVALGDGPLSVAIGLKRGRS* |
| Ga0137386_109123312 | 3300012351 | Vadose Zone Soil | MIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHTT* |
| Ga0137367_102151662 | 3300012353 | Vadose Zone Soil | ALEMINAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0137367_111918502 | 3300012353 | Vadose Zone Soil | GGFEVEGLLFAGAVTLIALGDGPLSIAVRLKHSST* |
| Ga0137366_102311113 | 3300012354 | Vadose Zone Soil | TVQLPHGGNFELEGLLLAGAVTLMALGDGPLSVAVRFKRPAM* |
| Ga0137371_107429622 | 3300012356 | Vadose Zone Soil | AVKVPRGGNIELEALLLAGALTLVALGDGPLSVAIGLKRGRS* |
| Ga0137375_113229452 | 3300012360 | Vadose Zone Soil | VAILAVQLPRGGNFELEGLLFAGAITLVALGDGPLSIAVKLKHGS* |
| Ga0137395_106834702 | 3300012917 | Vadose Zone Soil | WAACMAVEMVVAILAAKFPQRGNIELECLLLAGAITLVALGDGPLSVAIGLKRRA* |
| Ga0137394_112169551 | 3300012922 | Vadose Zone Soil | ACMAIEMLVAILAVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSST* |
| Ga0137410_109865941 | 3300012944 | Vadose Zone Soil | LAIMPRGGSFELEGLLFAGAVTLVALGDGPLSVAVKFKKGD* |
| Ga0134110_100633531 | 3300012975 | Grasslands Soil | MAIEMLVAILAVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGS* |
| Ga0134076_101011822 | 3300012976 | Grasslands Soil | AILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0164304_107782791 | 3300012986 | Soil | PHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0157378_116206511 | 3300013297 | Miscanthus Rhizosphere | HQNFELEALLLAGAVTLVALGDGPLSVAVKFKHSPT* |
| Ga0134078_102284472 | 3300014157 | Grasslands Soil | HGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSGT* |
| Ga0134078_102513681 | 3300014157 | Grasslands Soil | LAVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGGS* |
| Ga0134078_102800232 | 3300014157 | Grasslands Soil | QLRGGHNIELEGLLFAGALTLVALGDGPLSVAVRFKHTGM* |
| Ga0137411_12153362 | 3300015052 | Vadose Zone Soil | AACMAVEMVVAILAAKVPQRGNIELEGLLLAGAITLVALGDGPLSIAIGLKRRA* |
| Ga0137411_13052736 | 3300015052 | Vadose Zone Soil | MALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST* |
| Ga0137420_13117811 | 3300015054 | Vadose Zone Soil | GNIELEGLLFAGAITLVALGDGPLSIAVKLKHSSS* |
| Ga0137409_101751782 | 3300015245 | Vadose Zone Soil | ILAVKVPHGGNIEVEALLFAGAITLVALGDGPLSIAVKLKHSSS* |
| Ga0134073_100859972 | 3300015356 | Grasslands Soil | VCMAIEMVVAILAVQVPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLKHTGT* |
| Ga0134089_101515121 | 3300015358 | Grasslands Soil | IQLRGGHNIELEALLFAGALTLVALGDGPLSVAVKLKHSGT* |
| Ga0134085_101040091 | 3300015359 | Grasslands Soil | VAILTVQLPHGSNFELEGLLLAGAVTLMALGDGPLSVAVRFKRPAI* |
| Ga0134085_106160032 | 3300015359 | Grasslands Soil | AVKLPHSGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS* |
| Ga0187779_111615351 | 3300017959 | Tropical Peatland | VWAACMVVDMTVAILAVQLPRGSSFELEGLLLGAAAALVALGDGPLSVAIGLKRAR |
| Ga0184629_100451313 | 3300018084 | Groundwater Sediment | MLVAILAMKLRNGMNFELEALLLAGAVTLVALGDGPLSIAVRFKQRSA |
| Ga0066655_102179511 | 3300018431 | Grasslands Soil | MIVAILAVKLPHSGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0066667_113745361 | 3300018433 | Grasslands Soil | AVAMLVQLHGGHNIELEGLLFAGALTLVALGDGPLSVAVRLKHGN |
| Ga0066662_103041401 | 3300018468 | Grasslands Soil | GSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSST |
| Ga0180117_14214381 | 3300019248 | Groundwater Sediment | LPHGSKFELEGLLLAGAITLVALGDGPLSVAIGLKRRS |
| Ga0193756_10006534 | 3300019866 | Soil | GNIELEGLLFAGAITLVALGDGPLSIAVKLKHSSS |
| Ga0193755_10000551 | 3300020004 | Soil | LAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST |
| Ga0193745_11169001 | 3300020059 | Soil | EMVVAILAVKFPHRGNIELEGLLLAGAITLVALGDGPLSVAIGLKRRS |
| Ga0215015_102145841 | 3300021046 | Soil | LAVDMLVAILAVQLPAGRPWELEGLLFAGCVTLVALGDGPLSVAVKLKHSST |
| Ga0210382_105643741 | 3300021080 | Groundwater Sediment | LAVKLPRGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSST |
| Ga0137417_12778911 | 3300024330 | Vadose Zone Soil | VKLPHGGNLELEGLLFELEGLLFAGAITLVALGDGPLSIAVKLKHSST |
| Ga0137417_13831063 | 3300024330 | Vadose Zone Soil | IIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0209640_100991851 | 3300025324 | Soil | VMLGAIFVAKLPAGRNFELDALLLAGALTLIALGDGPLSLAVRFKHRGD |
| Ga0207685_102352011 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0207709_111645852 | 3300025935 | Miscanthus Rhizosphere | PGHQNFELEALLLAGAVTLVALGDGPLSVAVKFKHSPT |
| Ga0209234_10651491 | 3300026295 | Grasslands Soil | AILAVQLPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLRHGS |
| Ga0209236_11203922 | 3300026298 | Grasslands Soil | CMMFEMAVAMLVQLHGGHNIELEGLLFAGALTLVALGDGPLSIAIRFKRPPA |
| Ga0209238_11868151 | 3300026301 | Grasslands Soil | EMAVAMLVQLHGGHNIELEGLLFAGALTLVALGDGPLSIAIRFKRPPA |
| Ga0209265_12368312 | 3300026308 | Soil | AILAVQVPRGGNFELEGLLFAGAITLFALGDGPLSVAVKLKHTGT |
| Ga0209239_11733542 | 3300026310 | Grasslands Soil | VKVPHGGNIELEGLLLAGAITLVALGDGPLSIAVKLKHSN |
| Ga0209268_10024711 | 3300026314 | Soil | ALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0209268_10715342 | 3300026314 | Soil | AACMMFEMAIAMLIQLRGGHNIELEGLLFAGALTLVALGDGPLSVAVRFKHTGM |
| Ga0209268_11892492 | 3300026314 | Soil | CMAIEMLVAILAVQLPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHGS |
| Ga0209471_10971901 | 3300026318 | Soil | LPKGSGFEVEGLLFAGAVTLIALGDGPLSIAVKLKHSG |
| Ga0209158_13146802 | 3300026333 | Soil | MFEMAVAMIIQLHGGHNIELEGLLFAGALTLVALGDGPLSIAIRFKRPPA |
| Ga0209648_107792911 | 3300026551 | Grasslands Soil | VEMAVAIVAVKLPGHQNLELEALLLAGAVTLVALGDGPLSIAVRFKQPSS |
| Ga0208454_10145381 | 3300027573 | Soil | VVMVVAILAVKLPGHQNFELEALLLAGAVTLVALGDGPLSIAVRFKRPPM |
| Ga0209178_10172331 | 3300027725 | Agricultural Soil | VILALKLPHRGNFELEGLLIAGAITLVALGDGPLSVAVKLKHSG |
| Ga0310892_112397722 | 3300031858 | Soil | HQNVELEALLLAGAVTLVALGDGPLSVAVKFKHSPT |
| Ga0307472_1024864501 | 3300032205 | Hardwood Forest Soil | MALEMIIAILAVKLPHGGNIELEGLLFAGAITLVALGDGPLSIAVKLKHSS |
| Ga0335085_108787481 | 3300032770 | Soil | MAANMVVAILAVQLPKGANFEVEALLLAGAVTLVALGDGPLSVAIGLRQGN |
| ⦗Top⦘ |