| Basic Information | |
|---|---|
| Family ID | F058897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 46 residues |
| Representative Sequence | CPPCGEHFDFERLFLDFLRARCRAQGAPPELKRRILRELFEE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.99 % |
| % of genes near scaffold ends (potentially truncated) | 97.01 % |
| % of genes from short scaffolds (< 2000 bps) | 86.57 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.627 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.493 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.716 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF01940 | DUF92 | 77.61 |
| PF01494 | FAD_binding_3 | 15.67 |
| PF01613 | Flavin_Reduct | 3.73 |
| PF08241 | Methyltransf_11 | 0.75 |
| PF00109 | ketoacyl-synt | 0.75 |
| PF02801 | Ketoacyl-synt_C | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 77.61 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 31.34 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 15.67 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 15.67 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 15.67 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.73 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10009176 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 3728 | Open in IMG/M |
| 3300002561|JGI25384J37096_10240189 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300002908|JGI25382J43887_10354207 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300002908|JGI25382J43887_10371832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
| 3300003997|Ga0055466_10285876 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005166|Ga0066674_10415837 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005167|Ga0066672_10920281 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005172|Ga0066683_10116812 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300005174|Ga0066680_10027110 | All Organisms → cellular organisms → Bacteria | 3202 | Open in IMG/M |
| 3300005178|Ga0066688_10177479 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300005186|Ga0066676_10053704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2300 | Open in IMG/M |
| 3300005187|Ga0066675_11141036 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005340|Ga0070689_100845310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 807 | Open in IMG/M |
| 3300005341|Ga0070691_10174480 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005343|Ga0070687_100003335 | All Organisms → cellular organisms → Bacteria | 6217 | Open in IMG/M |
| 3300005445|Ga0070708_100453036 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300005446|Ga0066686_10538459 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300005451|Ga0066681_10718725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 607 | Open in IMG/M |
| 3300005471|Ga0070698_102223003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 502 | Open in IMG/M |
| 3300005536|Ga0070697_101850190 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005540|Ga0066697_10397627 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005549|Ga0070704_100501181 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300005552|Ga0066701_10057632 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300005553|Ga0066695_10325664 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005560|Ga0066670_10915759 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 534 | Open in IMG/M |
| 3300005574|Ga0066694_10033850 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300005574|Ga0066694_10418742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 629 | Open in IMG/M |
| 3300006031|Ga0066651_10097424 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300006034|Ga0066656_10175208 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300006034|Ga0066656_10180638 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300006755|Ga0079222_11473457 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 636 | Open in IMG/M |
| 3300006797|Ga0066659_10959876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 714 | Open in IMG/M |
| 3300006880|Ga0075429_101866999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter globiformis | 521 | Open in IMG/M |
| 3300006903|Ga0075426_11121185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 596 | Open in IMG/M |
| 3300006914|Ga0075436_100336289 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300007258|Ga0099793_10039738 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300007258|Ga0099793_10207483 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300009012|Ga0066710_103699507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 575 | Open in IMG/M |
| 3300009038|Ga0099829_10020998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4483 | Open in IMG/M |
| 3300009038|Ga0099829_10928908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 722 | Open in IMG/M |
| 3300009088|Ga0099830_11506651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
| 3300009089|Ga0099828_10446405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1166 | Open in IMG/M |
| 3300009089|Ga0099828_10794093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 848 | Open in IMG/M |
| 3300009090|Ga0099827_10349194 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300009090|Ga0099827_10533329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1010 | Open in IMG/M |
| 3300009090|Ga0099827_11079325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 697 | Open in IMG/M |
| 3300009137|Ga0066709_103633821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
| 3300010047|Ga0126382_10482134 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010048|Ga0126373_10099786 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
| 3300010304|Ga0134088_10024415 | All Organisms → cellular organisms → Bacteria | 2699 | Open in IMG/M |
| 3300010304|Ga0134088_10658425 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
| 3300010321|Ga0134067_10011934 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
| 3300010323|Ga0134086_10004333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4144 | Open in IMG/M |
| 3300010323|Ga0134086_10296868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 626 | Open in IMG/M |
| 3300010323|Ga0134086_10328877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 600 | Open in IMG/M |
| 3300010333|Ga0134080_10660134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 515 | Open in IMG/M |
| 3300010335|Ga0134063_10365262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 703 | Open in IMG/M |
| 3300010336|Ga0134071_10063719 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300010336|Ga0134071_10376551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 720 | Open in IMG/M |
| 3300010362|Ga0126377_12846692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
| 3300010396|Ga0134126_12468664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 565 | Open in IMG/M |
| 3300012201|Ga0137365_10208642 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300012207|Ga0137381_10252984 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012207|Ga0137381_10603945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 956 | Open in IMG/M |
| 3300012207|Ga0137381_11626342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 537 | Open in IMG/M |
| 3300012209|Ga0137379_10898711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 790 | Open in IMG/M |
| 3300012209|Ga0137379_11051209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
| 3300012211|Ga0137377_11931832 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
| 3300012349|Ga0137387_10316196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1129 | Open in IMG/M |
| 3300012351|Ga0137386_10770114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 691 | Open in IMG/M |
| 3300012357|Ga0137384_10539251 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300012359|Ga0137385_11273414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 598 | Open in IMG/M |
| 3300012362|Ga0137361_11671205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 557 | Open in IMG/M |
| 3300012393|Ga0134052_1027840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 606 | Open in IMG/M |
| 3300012409|Ga0134045_1358877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 758 | Open in IMG/M |
| 3300012918|Ga0137396_10007080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6673 | Open in IMG/M |
| 3300012925|Ga0137419_10289811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1248 | Open in IMG/M |
| 3300012925|Ga0137419_10985513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 698 | Open in IMG/M |
| 3300012927|Ga0137416_11581876 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 596 | Open in IMG/M |
| 3300012944|Ga0137410_10802185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 791 | Open in IMG/M |
| 3300012944|Ga0137410_11151815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 666 | Open in IMG/M |
| 3300012976|Ga0134076_10001345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 7232 | Open in IMG/M |
| 3300012976|Ga0134076_10255157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 749 | Open in IMG/M |
| 3300014150|Ga0134081_10133301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 805 | Open in IMG/M |
| 3300014154|Ga0134075_10364958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 634 | Open in IMG/M |
| 3300014157|Ga0134078_10138777 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300014157|Ga0134078_10543344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 547 | Open in IMG/M |
| 3300015054|Ga0137420_1054984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 839 | Open in IMG/M |
| 3300015054|Ga0137420_1213566 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300015358|Ga0134089_10104585 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300015358|Ga0134089_10562296 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
| 3300017654|Ga0134069_1233930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 635 | Open in IMG/M |
| 3300017656|Ga0134112_10035157 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300017656|Ga0134112_10312184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 634 | Open in IMG/M |
| 3300017659|Ga0134083_10063520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1408 | Open in IMG/M |
| 3300017659|Ga0134083_10322386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 660 | Open in IMG/M |
| 3300017659|Ga0134083_10398370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 600 | Open in IMG/M |
| 3300017997|Ga0184610_1149607 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 766 | Open in IMG/M |
| 3300018078|Ga0184612_10607582 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 517 | Open in IMG/M |
| 3300018431|Ga0066655_10269446 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300018431|Ga0066655_11415549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300018433|Ga0066667_10513397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 989 | Open in IMG/M |
| 3300019876|Ga0193703_1041903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 707 | Open in IMG/M |
| 3300020004|Ga0193755_1000414 | All Organisms → cellular organisms → Bacteria | 12216 | Open in IMG/M |
| 3300020170|Ga0179594_10053922 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300021073|Ga0210378_10028319 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2240 | Open in IMG/M |
| 3300024330|Ga0137417_1069291 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300025537|Ga0210061_1104667 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300025928|Ga0207700_11653951 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
| 3300026014|Ga0208776_1018134 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 594 | Open in IMG/M |
| 3300026296|Ga0209235_1249594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 550 | Open in IMG/M |
| 3300026308|Ga0209265_1053755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1236 | Open in IMG/M |
| 3300026325|Ga0209152_10007533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3863 | Open in IMG/M |
| 3300026326|Ga0209801_1190689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 832 | Open in IMG/M |
| 3300026327|Ga0209266_1109069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1195 | Open in IMG/M |
| 3300026330|Ga0209473_1084841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1332 | Open in IMG/M |
| 3300026331|Ga0209267_1330297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 505 | Open in IMG/M |
| 3300026332|Ga0209803_1232057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 645 | Open in IMG/M |
| 3300026333|Ga0209158_1065443 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300026528|Ga0209378_1062147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1754 | Open in IMG/M |
| 3300026540|Ga0209376_1254761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 747 | Open in IMG/M |
| 3300026547|Ga0209156_10342445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
| 3300026548|Ga0209161_10514286 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 531 | Open in IMG/M |
| 3300026551|Ga0209648_10837221 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
| 3300027735|Ga0209261_10072534 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300027748|Ga0209689_1122527 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300027787|Ga0209074_10288039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 652 | Open in IMG/M |
| 3300028145|Ga0247663_1061547 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300028536|Ga0137415_10903275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 693 | Open in IMG/M |
| 3300031720|Ga0307469_10489002 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300031965|Ga0326597_10091913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3708 | Open in IMG/M |
| 3300031965|Ga0326597_10718590 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300033813|Ga0364928_0150580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 570 | Open in IMG/M |
| 3300034165|Ga0364942_0311082 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 19.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.49% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.75% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100091761 | 3300002561 | Grasslands Soil | TPAVEQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| JGI25384J37096_102401892 | 3300002561 | Grasslands Soil | VEQEIRAHLAECPPCGEEFDFERLFLTFLRARCRAQGAPPDLKRRILRELFDE* |
| JGI25382J43887_103542072 | 3300002908 | Grasslands Soil | VEQEIRQHLTDCPPCGEVFDFEXLFLGFLRARCRAQGAPADLKRRILDELFDE* |
| JGI25382J43887_103718322 | 3300002908 | Grasslands Soil | CGEHFDFERVFLTFLRARSRAQGAPPELKRRILRELFDE* |
| Ga0055466_102858762 | 3300003997 | Natural And Restored Wetlands | HLEECPPCGEQFDFEAIYLKFLRARCRTQGAPEELKRRVLRELFGE* |
| Ga0066674_104158372 | 3300005166 | Soil | EREIRAHLAECPPCGEHHDFEALFLKFVRARCRAQGAPAELRRRIARELFEE* |
| Ga0066672_109202812 | 3300005167 | Soil | HLEDCPPCGEQFDFEELFLKFLRARCRAQGAPPELKKRVLRELFGE* |
| Ga0066683_101168123 | 3300005172 | Soil | EVEREIRTHLEDCPPCGEHFDFERLFLDFLQARCRARGAPPDLKRRILRELFDE* |
| Ga0066680_100271105 | 3300005174 | Soil | SVMEEIRQHVAECPPCGESFDFEKVFLTFVRARCRAQGASPELRRRILDELLDE* |
| Ga0066688_101774793 | 3300005178 | Soil | PPCGEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE* |
| Ga0066676_100537041 | 3300005186 | Soil | DCPPCGEHFDFEKLFLDFLRARCRAHGAPPELKRKILRDLFGA* |
| Ga0066675_111410361 | 3300005187 | Soil | LTDCPPCGEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE* |
| Ga0070689_1008453102 | 3300005340 | Switchgrass Rhizosphere | CPPCDEQYDFEELFLKFLRARCRTQGAPAELKKRVFRELFGE* |
| Ga0070691_101744803 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EDCPPCDEQYDFEELFLKFLRARCRTQGAPAELKKRVFRELFGE* |
| Ga0070687_1000033359 | 3300005343 | Switchgrass Rhizosphere | LEDCPPCDEQYDFEELFLKFLRARCRTQGAPAELKKRVFRELFGE* |
| Ga0070708_1004530361 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PCGEQFDFEELFLKFLRARCRAEGAPPELKKRVLRELFGE* |
| Ga0066686_105384592 | 3300005446 | Soil | HLADCPPCGEHFDFEKLFLDFLRARCRAHGAPPELKRKILRDLFGE* |
| Ga0066681_107187251 | 3300005451 | Soil | CGEQYDFEELFLKFLRARCRTQGAPAELKKRVLRELFGE* |
| Ga0070698_1022230031 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | CGEQFDFETIYLKFLRARCRTQGAPAELKRRVMRELFGE* |
| Ga0070697_1018501901 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | EEIRQHVAECPPCGESFDFEKVFLTFVRARCRAQGASPELRRRILDELLDE* |
| Ga0066697_103976272 | 3300005540 | Soil | EIRQHLADCPPCGEHFDFERLFLDFLRARCRAHGAPAELKRRILRELFDE* |
| Ga0070704_1005011811 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | EDCPPCDEQYDFEELFLKFLRARCRTQGAPAELKKRVLRELFGE* |
| Ga0066701_100576321 | 3300005552 | Soil | DCPPCGEEFDFEKLFLGFLKARCRAQGAPADLKRRILDELLDE* |
| Ga0066695_103256643 | 3300005553 | Soil | YDFEELFLKFLRARCRTQGAPAELKKRVLRELFGE* |
| Ga0066670_109157592 | 3300005560 | Soil | PCEEQYDFEELFLKFLRARCRTQGAPPELKKRVLRELFGE* |
| Ga0066694_100338504 | 3300005574 | Soil | QEIRQHIADCPPCGEEFDFEKLFLGFLKARCRAQGAPADLKRRILDELLDE* |
| Ga0066694_104187422 | 3300005574 | Soil | GESFDFEKVFLTFVRARCRAHGASPELRRRILDELLDE* |
| Ga0066651_100974241 | 3300006031 | Soil | CPPCGEHFDFERLFLDFLRARCRAHGAPAELKRRILRELFDE* |
| Ga0066656_101752081 | 3300006034 | Soil | PQVEREIRAHIADCPPCGEHFDFERVFLTFLRARSRAQGAPPDLKRRILRELFDE* |
| Ga0066656_101806381 | 3300006034 | Soil | CPPCGEQFDFESLFLKFLRARCRAQGAPPELKRRLLHDLFGE* |
| Ga0079222_114734572 | 3300006755 | Agricultural Soil | CPPCGHKFDFEAAFKKFVQARTRAQGCPPELKQRILRELFDE* |
| Ga0066659_109598762 | 3300006797 | Soil | CGEHFDFERLFLDFLRARCRAKGAPPELKRRILDELLDE* |
| Ga0075429_1018669991 | 3300006880 | Populus Rhizosphere | LERDIREHLEECPPCGEQFDFEAVYLKFLRARCRTQGAPEDLKRRVLRELFGE* |
| Ga0075426_111211851 | 3300006903 | Populus Rhizosphere | EHFDFERVFLTFLRARCRAQGAPPELKRRILRELFEE* |
| Ga0075436_1003362891 | 3300006914 | Populus Rhizosphere | VEQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAHGAPPDLKRRILDELLDE* |
| Ga0099793_100397383 | 3300007258 | Vadose Zone Soil | CGDHFDFERLFLDFLRARCRAQGAPSDLKLRILRELFDE* |
| Ga0099793_102074831 | 3300007258 | Vadose Zone Soil | DCPPCGEQYDFEELFLKFLRARCKTQGAPAELKKRVLRELFGE* |
| Ga0066710_1036995072 | 3300009012 | Grasslands Soil | VEQEIRQHLADCPPCGEHFDFEKLFLDFLRARCRAHGAPPELKRKILRDLFGA |
| Ga0099829_100209983 | 3300009038 | Vadose Zone Soil | LEDCPPCGEQYDFEELFLKFLRARCRTQGAPAELKKRVLRELFGE* |
| Ga0099829_109289081 | 3300009038 | Vadose Zone Soil | EIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0099830_115066511 | 3300009088 | Vadose Zone Soil | PCGEQYDFEELFLKFLRARCRAQGAPAELKKRVLRELFGE* |
| Ga0099828_104464053 | 3300009089 | Vadose Zone Soil | YDFEELFLKFLRARCKTQGAPAELKKRVLRELFGE* |
| Ga0099828_107940932 | 3300009089 | Vadose Zone Soil | INSIRAHLAECPPCGEEFDFERLFLTFLRARCRAQGAPPDLKRRILRELFDE* |
| Ga0099827_103491941 | 3300009090 | Vadose Zone Soil | RVHLEDCPPCGEHFDFERLFLDFLQARCRARGAPPDLKRRILRELFDE* |
| Ga0099827_105333291 | 3300009090 | Vadose Zone Soil | RVHLEDCPPCGEHFDFERLFLDFLQARCRARGAPPDLKRRILRDLFDE* |
| Ga0099827_110793252 | 3300009090 | Vadose Zone Soil | GEQYDFEELFLKFLRARCRTQGAPADLKKRVLRELFGE* |
| Ga0066709_1036338212 | 3300009137 | Grasslands Soil | VEQEIRQHLTDCPPCGEQFDFEKLFLGFLRARCRAQGAPADLKRRILDELLDE* |
| Ga0126382_104821343 | 3300010047 | Tropical Forest Soil | DFETLFLKFVRVRCRAQGAPATLRHRILEQLLEE* |
| Ga0126373_100997861 | 3300010048 | Tropical Forest Soil | PCGTKFDFEAAFKKFVQAKSRAQGCPPELKQRILRELFDE* |
| Ga0134088_100244155 | 3300010304 | Grasslands Soil | LTPAVEQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0134088_106584251 | 3300010304 | Grasslands Soil | PAVEQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0134067_100119341 | 3300010321 | Grasslands Soil | QEIRQHLADCPPCGEHFDFERLFLDFLRARCRAEGAPPELKRRILRELFDE* |
| Ga0134086_100043331 | 3300010323 | Grasslands Soil | QHIVDCPPCGEHFDFERLFLDFLRARCRAKGAPPELKRRILDELLDE* |
| Ga0134086_102968681 | 3300010323 | Grasslands Soil | QFDFEKLFLGFLRARCRAQGAPADLKRRILDELLDE* |
| Ga0134086_103288771 | 3300010323 | Grasslands Soil | REIRTHLEDCPPCCEHFDFERLFLDFLQARCRARGAPPDLKRRILRELFDE* |
| Ga0134080_106601342 | 3300010333 | Grasslands Soil | DFEKLFLGFLKARCRAQGAPADLKRRILDELLDE* |
| Ga0134063_103652621 | 3300010335 | Grasslands Soil | VEQEIRQHLTDCPPCGEQFDFEKLFFGFLRARCRAEGAPADLKRRILDELFDE* |
| Ga0134071_100637193 | 3300010336 | Grasslands Soil | HLEDCPPCGEHFDFERLFLDFLQARCRARGAPPDLKRRILRELFDE* |
| Ga0134071_103765512 | 3300010336 | Grasslands Soil | CPPCGEHFDFERLFLDFLRARCRAQGAPPELKRRILRELFEE* |
| Ga0126377_128466921 | 3300010362 | Tropical Forest Soil | LEAEMRAHIQKCPPCSEHFDFETLFLKFVRVRCRAQGAPATLRHRILEQLLEE* |
| Ga0134126_124686642 | 3300010396 | Terrestrial Soil | CGTKFDFEGAFKKFVQARTRAQGCPPELKQRILRELFDE* |
| Ga0137365_102086423 | 3300012201 | Vadose Zone Soil | QHVAECPPCGESFDFEKVFLTFVRARCRAQGASPELRRRILDELLDE* |
| Ga0137381_102529843 | 3300012207 | Vadose Zone Soil | PCLEQFDFEDAFLKFLQARCCGRCAPPELKRRILHELFGE* |
| Ga0137381_106039451 | 3300012207 | Vadose Zone Soil | HVEREIRQHLAECPPCGEHFDFERLFLDFLRARCRAQGAPTELKHRILRDLFDE* |
| Ga0137381_116263421 | 3300012207 | Vadose Zone Soil | ELTPVVEQEIRQHLTDCPPCGEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE* |
| Ga0137379_108987112 | 3300012209 | Vadose Zone Soil | PCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137379_110512091 | 3300012209 | Vadose Zone Soil | EFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137377_119318322 | 3300012211 | Vadose Zone Soil | RAHLEDCPPCGEQFDFEELFLKFLRARCRAQGAPQELKKRVLRELFGE* |
| Ga0137387_103161963 | 3300012349 | Vadose Zone Soil | CPPCGEHFDFEKLFLDFLRARCRAHGAPPELKRKILRDLFGA* |
| Ga0137386_107701142 | 3300012351 | Vadose Zone Soil | GEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137384_105392511 | 3300012357 | Vadose Zone Soil | IRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137385_112734141 | 3300012359 | Vadose Zone Soil | IRQHIADCPPCGEEFDFEKLFLGFLRARCRAEGAPADLKRRILDELFDE* |
| Ga0137361_116712052 | 3300012362 | Vadose Zone Soil | PCGEQYDFEELFLKFLRARCRTQGAPAELKKRVLRELFGE* |
| Ga0134052_10278402 | 3300012393 | Grasslands Soil | CPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0134045_13588771 | 3300012409 | Grasslands Soil | RQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137396_100070809 | 3300012918 | Vadose Zone Soil | VEKEIRQHLSDCPPCGEQFDFEKLFLGFLRARCQAQGAPPELKRRILDELLDE* |
| Ga0137419_102898111 | 3300012925 | Vadose Zone Soil | FDFEELFLKFVRARCRAQGAPAELKKRVLRELFGE* |
| Ga0137419_109855131 | 3300012925 | Vadose Zone Soil | IRAHLEDCPPCEEQYDFEELFLKFLRARCKTQGAPTELKKRVLRELFGE* |
| Ga0137416_115818761 | 3300012927 | Vadose Zone Soil | LEECPPCGEQFDFEAVYLKFLRARCRTQGAPEELKRRVLRELFGE* |
| Ga0137410_108021852 | 3300012944 | Vadose Zone Soil | EECPPCGEQFDFEAIYLKFLRARCRTQGAPEALKRRVLRELFGE* |
| Ga0137410_111518151 | 3300012944 | Vadose Zone Soil | EQFDFEKLFLGFLKARCRAQGAPADLKRRILDELLDE* |
| Ga0134076_100013452 | 3300012976 | Grasslands Soil | VEQEIRQHLADCPPCGEHFDFERLFLDFLRARCRAHGAPAELKRRILRELFDE* |
| Ga0134076_102551571 | 3300012976 | Grasslands Soil | PCGEQYDFEELFLKLLRARCRAQGAPAELKKRVLRELFGE* |
| Ga0134081_101333012 | 3300014150 | Grasslands Soil | PAVAEEIRQHIAECPPCGENFDFEKVFLTFVRARCRAHGASPDLRRRILDELLDE* |
| Ga0134075_103649582 | 3300014154 | Grasslands Soil | VEQEIRQHLTDCPPCGEAFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE* |
| Ga0134078_101387771 | 3300014157 | Grasslands Soil | KQHIVDCPPCGEHFDFERLFLDFLRARCRAKGAPPELKRRILDELLDE* |
| Ga0134078_105433441 | 3300014157 | Grasslands Soil | HIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137420_10549842 | 3300015054 | Vadose Zone Soil | EQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0137420_12135661 | 3300015054 | Vadose Zone Soil | SRRRLTPAVEQEIRQHLTDCPPCGEQFDFEKLFLGFLRARCQAQGAPPELKRRILDELLDE* |
| Ga0134089_101045851 | 3300015358 | Grasslands Soil | FDFEKLFLGFLRARCRAQGAPADLKRRILDELLDE* |
| Ga0134089_105622961 | 3300015358 | Grasslands Soil | QEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE* |
| Ga0134069_12339302 | 3300017654 | Grasslands Soil | DCPPCGEHFDFERLFLDFLRARCRAEGAPPELKRRILRELFDE |
| Ga0134112_100351573 | 3300017656 | Grasslands Soil | PPCGEQFDFEELFLKFLRARCRAEGASPELKKRVLRELFGE |
| Ga0134112_103121841 | 3300017656 | Grasslands Soil | DCPPCGEHFDFEKLFLDFLRARCRAHGAPPELKRKILRDLFGE |
| Ga0134083_100635204 | 3300017659 | Grasslands Soil | QEIRQHLADCPPCGEHFDFEKLFLDFLRARCRAQGAPPELKRRILGELFDE |
| Ga0134083_103223861 | 3300017659 | Grasslands Soil | QHLTDCPPCGEAFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE |
| Ga0134083_103983702 | 3300017659 | Grasslands Soil | REHLADCPPCGEHFDFERLFLDFLRARCRAQGAPPELKRRILRELFEE |
| Ga0184610_11496072 | 3300017997 | Groundwater Sediment | REHLEDCPPCGEQFDFEELFLKFLRARCRSQGAPTELKKRVLRELFGE |
| Ga0184612_106075821 | 3300018078 | Groundwater Sediment | REATPALERDIRQHLEECPPCGEQFNFEAVYLKFLRARCRTQGASPELKRRVLRELFGE |
| Ga0066655_102694461 | 3300018431 | Grasslands Soil | FDFEKLFLGFLRARCRAQGAPADLKRRILDELLDE |
| Ga0066655_114155492 | 3300018431 | Grasslands Soil | CPPCGEQFDFEALFLKFVRARCLTQGAPPELKRRVLLELFGDE |
| Ga0066667_105133971 | 3300018433 | Grasslands Soil | LTDCPPCGEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE |
| Ga0193703_10419031 | 3300019876 | Soil | PCGEQYDFEELFLKFLRARCRTQGAPADLKKRVLRELFGE |
| Ga0193755_10004141 | 3300020004 | Soil | CEEQYDFEELFLKFLRARCKTQGAPTELKKRVLRELFGE |
| Ga0179594_100539221 | 3300020170 | Vadose Zone Soil | QYDFEELFLKFLRARCRAQGAPPELKKRVLRELFGE |
| Ga0210378_100283194 | 3300021073 | Groundwater Sediment | DCPPCGEQFDFEELFLKFLRARCRSQGAPTELKKRVLRELFGE |
| Ga0137417_10692913 | 3300024330 | Vadose Zone Soil | IRDHLEDCPPCGEQYDFEELYLKFLRARCRTQGAPTELKKRVLRQLFGE |
| Ga0210061_11046671 | 3300025537 | Natural And Restored Wetlands | HLEECPPCGEQFDFEAIYLKFLRARCRTQGAPEELKRRVLRELFGE |
| Ga0207700_116539511 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PPCGESFDFEKVFLTFVRARCRAQGASPELRRRILDELLDE |
| Ga0208776_10181341 | 3300026014 | Rice Paddy Soil | EECPPCGEHFDFEKLFLDFLKTRCRVHGAPPELKRRIFDELFGE |
| Ga0209235_12495941 | 3300026296 | Grasslands Soil | PCGEQFDFEELFLKFLRARCRAEGASPELKKRVLRELFGE |
| Ga0209265_10537553 | 3300026308 | Soil | CGEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE |
| Ga0209152_100075331 | 3300026325 | Soil | PCGDSFDFEKVFLTFVRARCSAHGASPELRRRILDELLDE |
| Ga0209801_11906892 | 3300026326 | Soil | PCGEHFDFERLFLDFLRARCRAQGAPSELKLRILRELFDE |
| Ga0209266_11090691 | 3300026327 | Soil | GEVFDFEKLFLGFLRARCRAQGAPADLKRRILDELFDE |
| Ga0209473_10848413 | 3300026330 | Soil | QVEQEIRQHLADCPPCGEHFDFERLFLDFLRARCRAEGAPPELKRRILRELFDE |
| Ga0209267_13302971 | 3300026331 | Soil | QHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE |
| Ga0209803_12320571 | 3300026332 | Soil | CGEHFDFERLFLDFLQARCRARGAPPDLKRRILRELFDE |
| Ga0209158_10654431 | 3300026333 | Soil | PPCGEHFDFERLFLDFLQARCRARGAPPELKRRILRELFDE |
| Ga0209378_10621471 | 3300026528 | Soil | AVEQEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE |
| Ga0209376_12547611 | 3300026540 | Soil | EIRQHLADCPPCGEHFDFERLFLDFLRARCRAQGAPAELKLRILRELFDE |
| Ga0209156_103424451 | 3300026547 | Soil | EFDFEKLFLGFLRARCRAQGAPADLKRRILDELLDE |
| Ga0209161_105142861 | 3300026548 | Soil | SFDFEKVFLTFVRARCSAHGASPELRRRILDELLDE |
| Ga0209648_108372212 | 3300026551 | Grasslands Soil | REHLADCEPCGEHFDFEGMFLRFLRARCRAQGAPQELKRRLLHDLFGE |
| Ga0209261_100725341 | 3300027735 | Wetland Sediment | REIREHLEDCPPCGEQYDFEELFLKFLRARCRTQGAPPELKKRVFRELFGE |
| Ga0209689_11225273 | 3300027748 | Soil | CRPCLEQFDFEDAFLKFLQARCRARCAPPELKRRILHELFGE |
| Ga0209074_102880391 | 3300027787 | Agricultural Soil | EIREHLSHCPPCGHKFDFEAAFKKFVQARTRAQGCPPELKQRILRELFDE |
| Ga0247663_10615472 | 3300028145 | Soil | DREVTPELETEIRAHIQKCPPCSEHFDFETLFLKFVRVRCRAQGAPATLRRRILEQLLEE |
| Ga0137415_109032751 | 3300028536 | Vadose Zone Soil | HLEECPPCGEQFDFEAVYLKFLRARCRTQGAPEELKRRVLRELFGE |
| Ga0307469_104890023 | 3300031720 | Hardwood Forest Soil | QEIRQHIADCPPCGEEFDFEKLFLGFLRARCRAQGAPPDLKRRILDELLDE |
| Ga0326597_100919131 | 3300031965 | Soil | RRHLEECPPCGEQFDFEAVYLKFLRARCRAQGAPPELKRRLLQELFGE |
| Ga0326597_107185903 | 3300031965 | Soil | RRHLEECPPCGEQFDFEAVYLKFLRARCRAQGAPPELKRRLLRELFGE |
| Ga0364928_0150580_2_154 | 3300033813 | Sediment | EIREHLEDCPPCDEQFDFEELFLKFLRARCRTQGAPTELKKRVLRELFGE |
| Ga0364942_0311082_1_129 | 3300034165 | Sediment | CAPCDEQFDFEAVFLKFLRARCRTQGAPPELKRRVLRELFGE |
| ⦗Top⦘ |