NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058874

Metagenome / Metatranscriptome Family F058874

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058874
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 43 residues
Representative Sequence EPVRADSSVRSVLQKLAESDQNQYIRSQARIMLAQLPEFD
Number of Associated Samples 118
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 45.52 %
% of genes from short scaffolds (< 2000 bps) 39.55 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (63.433 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.940 % of family members)
Environment Ontology (ENVO) Unclassified
(26.119 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.985 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF13180PDZ_2 8.21
PF13345Obsolete Pfam Family 2.24
PF13349DUF4097 2.24
PF13374TPR_10 0.75
PF01145Band_7 0.75
PF02597ThiS 0.75
PF13492GAF_3 0.75
PF00990GGDEF 0.75
PF13185GAF_2 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG1977Molybdopterin synthase sulfur carrier subunit MoaDCoenzyme transport and metabolism [H] 0.75
COG2104Sulfur carrier protein ThiS (thiamine biosynthesis)Coenzyme transport and metabolism [H] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A63.43 %
All OrganismsrootAll Organisms36.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002239|JGI24034J26672_10032013All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300005364|Ga0070673_100489327All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300005364|Ga0070673_102373615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter504Open in IMG/M
3300005440|Ga0070705_101193830Not Available626Open in IMG/M
3300005575|Ga0066702_10011680All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3958Open in IMG/M
3300005712|Ga0070764_10011777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter4281Open in IMG/M
3300005712|Ga0070764_10037156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2469Open in IMG/M
3300005879|Ga0075295_1001521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1674Open in IMG/M
3300009098|Ga0105245_13124130Not Available513Open in IMG/M
3300009174|Ga0105241_10058047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2971Open in IMG/M
3300009545|Ga0105237_12285510All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009545|Ga0105237_12714531Not Available506Open in IMG/M
3300009553|Ga0105249_10781981Not Available1018Open in IMG/M
3300009628|Ga0116125_1049058All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300009698|Ga0116216_10197951All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300010046|Ga0126384_10994250All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300010321|Ga0134067_10002251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4702Open in IMG/M
3300010360|Ga0126372_11385759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300010360|Ga0126372_13238348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300010366|Ga0126379_12985462All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010397|Ga0134124_13204358Not Available501Open in IMG/M
3300010401|Ga0134121_12466728All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012353|Ga0137367_10172443All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1573Open in IMG/M
3300012354|Ga0137366_10496475All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300012960|Ga0164301_10996365Not Available658Open in IMG/M
3300015168|Ga0167631_1018679All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300016357|Ga0182032_11897834All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300017930|Ga0187825_10249743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium650Open in IMG/M
3300017974|Ga0187777_10884739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300018009|Ga0187884_10335634All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300018034|Ga0187863_10866955All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300018047|Ga0187859_10154395All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300018090|Ga0187770_11650751All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300018476|Ga0190274_13514125Not Available529Open in IMG/M
3300020579|Ga0210407_11317310All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300021181|Ga0210388_10306381All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300021401|Ga0210393_10034176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3974Open in IMG/M
3300021403|Ga0210397_10860126All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300021404|Ga0210389_10613481All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300021432|Ga0210384_10763506All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300021433|Ga0210391_10255513All Organisms → cellular organisms → Bacteria1375Open in IMG/M
3300021477|Ga0210398_10063722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3007Open in IMG/M
3300021477|Ga0210398_10422089All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300021478|Ga0210402_10498445All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300021559|Ga0210409_10924066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300022726|Ga0242654_10447115Not Available504Open in IMG/M
3300025414|Ga0208935_1010701All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300025898|Ga0207692_11194368Not Available505Open in IMG/M
3300025931|Ga0207644_11568416Not Available552Open in IMG/M
3300026041|Ga0207639_10193113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1740Open in IMG/M
3300026041|Ga0207639_11601194All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300026318|Ga0209471_1133192All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300026318|Ga0209471_1273639All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300027074|Ga0208092_112278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300027609|Ga0209221_1084811All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300027696|Ga0208696_1218700All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300027911|Ga0209698_10596955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300028715|Ga0307313_10146139Not Available729Open in IMG/M
3300029636|Ga0222749_10007355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4457Open in IMG/M
3300032770|Ga0335085_11928169Not Available601Open in IMG/M
3300032783|Ga0335079_11739690All Organisms → cellular organisms → Bacteria608Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.22%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.24%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.24%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.49%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.49%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.49%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.75%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.75%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.75%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.75%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.75%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.75%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.75%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.75%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.75%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027074Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10516898613300000364SoilNDSNQGLRTEALHLLQPVRADGSVRNALQKLAENDQNPYIRLQAKSQLAQLPEID*
JGI24034J26672_1003201323300002239Corn, Switchgrass And Miscanthus RhizosphereKADSSVRAVLQRLAENDQNQYIRSQARTVMAQLPEID*
Ga0066679_1028146313300005176SoilDGNAGVRTQALQSLRPVRADSSVRVVLESLAQNDKNQYIRSQARTMLAQLGEMD*
Ga0065712_1022929313300005290Miscanthus RhizospherePGLRTQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0070668_10065587813300005347Switchgrass RhizosphereHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0070673_10048932713300005364Switchgrass RhizosphereNDSNTGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID*
Ga0070673_10237361513300005364Switchgrass RhizosphereGLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0070710_1081901723300005437Corn, Switchgrass And Miscanthus RhizosphereNPGLRAQALRLLEPVRADSSVRVVLQKLAEKDPNQFIQSQARNVLAQTAEID*
Ga0070705_10119383013300005440Corn, Switchgrass And Miscanthus RhizosphereNQGLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0070707_10035788413300005468Corn, Switchgrass And Miscanthus RhizospherePGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID*
Ga0070679_10171294823300005530Corn RhizospherePCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0070734_1072868923300005533Surface SoilDPVRADSSVRAVLQRLAENDQNQYIKTQARYMLAQLPEFD*
Ga0070733_1085714813300005541Surface SoilALGLLEPVRADSSVRVVLQQLAAHDQNPYIRLQARNTLAEMPEFD*
Ga0070696_10146514313300005546Corn, Switchgrass And Miscanthus RhizosphereEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0066693_1042603923300005566SoilSSVRVVLQKLAVNDQNQYIRQQARNMLAQVSGID*
Ga0066702_1001168013300005575SoilDSSVRSVLQRLAQDDKNQYIRSQARSVLAQLPEID*
Ga0066654_1055587513300005587SoilALLNDNNQGLRTEALHLLQPVRADGSVRRVLQKLAEGDQNQYIRSQARSEIAQLPEID*
Ga0070764_1001177713300005712SoilPVRADSSVRSVLKELAQNDQNQYIRSQARMMLSQLPEFD*
Ga0070764_1003715613300005712SoilRADSSVRTVLQELARSDQNQYIRSQARIMLSQLPEFD*
Ga0075295_100152133300005879Rice Paddy SoilEALHLLGPVRADSSVRAVMQHLADGDHNQYIRSQARTVLAQLPEID*
Ga0066696_1076950813300006032SoilPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0075030_10128167913300006162WatershedsLLEPVRADSSVRVVLQKLADKDPNPYIQSQARNVLAQTSGID*
Ga0066653_1052439923300006791SoilALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0066658_1056061013300006794SoilNPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0079221_1067837313300006804Agricultural SoilADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0079220_1086068023300006806Agricultural SoilADSSVRVVLKKLAESDQNQYIRSEARTMMAQLPEID*
Ga0075424_10278732823300006904Populus RhizosphereHLLQPVRADGSVRNALQKLAENDQNPYIRLQAKSQLAQLPEID*
Ga0099830_1093419823300009088Vadose Zone SoilDSSVRVVLQKLAENDQNLYIRTQARNVLSQMSEID*
Ga0099828_1014943613300009089Vadose Zone SoilPVRADSSVRVVLEKLAEKDPNQFIQSQARNVLAQTSGID*
Ga0105245_1312413023300009098Miscanthus RhizosphereQGLRTNALHLLGPVRADSSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0075423_1194330813300009162Populus RhizosphereNPGLRTQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0105241_1005804743300009174Corn RhizosphereLQLLEPVRADSSVRAVLQRLAQDDKNVYIRSHARTLLAQLPEID*
Ga0105241_1116155213300009174Corn RhizosphereQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0105241_1248114623300009174Corn RhizosphereLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0105242_1037842613300009176Miscanthus RhizosphereLHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0105237_1228551013300009545Corn RhizosphereSSVRVVLKKLAESDQNQYIRSEARTMMAQLPEID*
Ga0105237_1271453123300009545Corn RhizosphereDSSVRAVMQKLADSDRNQYIRSQARTELAQLPEID*
Ga0105249_1078198123300009553Switchgrass RhizosphereEVLLHDANQGLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0116125_104905813300009628PeatlandSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD*
Ga0116216_1019795113300009698Peatlands SoilADSSVREVLQRLSGSDPNHYIRSQARTVLAQLPEID*
Ga0126384_1099425023300010046Tropical Forest SoilVRADGSVRSVLQKLADGDKNQYIRSQAKSQLAQLPEID*
Ga0134088_1056419023300010304Grasslands SoilLHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0134088_1056419123300010304Grasslands SoilLHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID*
Ga0134067_1000225113300010321Grasslands SoilDANPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID*
Ga0134064_1000068863300010325Grasslands SoilLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0134080_1058149323300010333Grasslands SoilDSSVRVVLQKLAQNDQSPYIRSQARLVLAQLPEID*
Ga0134063_1049986613300010335Grasslands SoilRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0126372_1005078213300010360Tropical Forest SoilDSSVRNVLTQLSQNDKNQYIRSQARNMLAQLPEID*
Ga0126372_1138575923300010360Tropical Forest SoilTQALILLQPVKADSSVRAALQQLAQTDQNQYIRSQARTVLAQLPEID*
Ga0126372_1323834813300010360Tropical Forest SoilQALLLLGPVKADSSVRAALQQLAQTDQNQYIRSQARTVLAQLPEID*
Ga0126378_1215913013300010361Tropical Forest SoilPVKADSSVRVVLKRLAENDQNQYIRSEARSVLAQVPEID*
Ga0126379_1298546223300010366Tropical Forest SoilVRADSSVRAVLQKLAQSDQNQYIRSQARIMVAQLPEFD*
Ga0134125_1143451323300010371Terrestrial SoilCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID*
Ga0134124_1320435823300010397Terrestrial SoilADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0134121_1246672813300010401Terrestrial SoilADSSVRIVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0137362_1034050013300012205Vadose Zone SoilADSSVRVVLQKLAENDQNLYIRTQARNVLSQMSEID*
Ga0137380_1001457873300012206Vadose Zone SoilHLLEPVSADSSVRVVLQKLAQNDQSPYIRSQARLVLAQLPEID*
Ga0137379_1152661213300012209Vadose Zone SoilLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID*
Ga0137378_1156548813300012210Vadose Zone SoilQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD*
Ga0150985_11930894223300012212Avena Fatua RhizosphereLEPVRADSSVRMVLQKLADNDQNLYIRSQARNVLSQMSEID*
Ga0137387_1126772923300012349Vadose Zone SoilQALRLLEPVRADSSVRVVLQKLAEKDPNQFIQEQARNVLAQTAGMD*
Ga0137367_1017244313300012353Vadose Zone SoilTNALHLLAPVRADSSVRAVMQQLANGDRNQYIRSQARTVLAQLPEID*
Ga0137366_1049647513300012354Vadose Zone SoilPVKADSSVRGVLQRLAENDQNQYIRSQARTLLARLPEID*
Ga0137385_1125471323300012359Vadose Zone SoilQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVDEESR*
Ga0164301_1099636513300012960SoilSSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID*
Ga0120125_116222123300014056PermafrostLEPVSADSSVRVVLQKLAQNDQSPYIRAQARSVLAQLPEID*
Ga0167631_101867923300015168Glacier Forefield SoilLLGPVRADGSVRQVLYKLAESDSNQYIRSQARTQLAQLPEID*
Ga0182032_1189783413300016357SoilLVEAVKADSSVRMDLRKLAEDDQNQYIRSQARTVLAQLPEID
Ga0187807_123061013300017926Freshwater SedimentPVRADSSVRALLEQLAQGDQNPYIRSQARIMLAQLPEFD
Ga0187824_1005321023300017927Freshwater SedimentDSSVRVVLEKLAEKDSNQYIQSQARNVLAQTAGID
Ga0187825_1024974313300017930Freshwater SedimentVKADGTVRAALQHLAETDENQYIRSQARTVLAQLPEID
Ga0187777_1088473913300017974Tropical PeatlandPVKADGSVRSVLQHLADSDQNQYIRSQARTVIAQLPEID
Ga0187782_1161953923300017975Tropical PeatlandEPVRADSSVRAVLQRLAEDDRSEYIKNQARNMLAQLPEFD
Ga0187822_1017754423300017994Freshwater SedimentQALRLLEPVRADSSVRVVLEKLAEKDSNQYIQSQARNVLAQTAGID
Ga0187884_1033563423300018009PeatlandCSPLPGSGPADSSVRTVLQELAQSDQNQYIRSQARIMLSQLPEFD
Ga0187873_113343223300018013PeatlandRTDALRLLDPVRADSSVRTVLQQLAQSDQNQYIRSQARIMLSQLPEFD
Ga0187863_1086695523300018034PeatlandPVRADSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD
Ga0187859_1015439523300018047PeatlandDSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD
Ga0187770_1004175543300018090Tropical PeatlandEPVRADSSVRAVLQELAAKDQNQYIRSQARNTLAEVPDMD
Ga0187770_1165075113300018090Tropical PeatlandGPVRGDSSVRAVLVNLAEHDENAYIKLQARSVLAQLPEFD
Ga0066655_1048318523300018431Grasslands SoilIDLLEPVRADSSVRVVLQRLAENDQNQYIRSQARNVLAQTPEID
Ga0066655_1085338813300018431Grasslands SoilNPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD
Ga0190274_1351412523300018476SoilLLGPVRADGSVRAVLYKLAESDSNQYIRSQARTQLAQLPEID
Ga0187794_140611423300019273PeatlandCWADSSVRSVLRKLAENDSNQYIRSQARNVLAQMPEID
Ga0193726_105350513300020021SoilVLDPVRADSSVRVVLQKLAESDQNPYIKSQARLEVAQLPEID
Ga0210407_1026854813300020579SoilRTEALHLLDPVRADGSVRAVLQRLAENDQNQYIKTQARNMLAQMPEFD
Ga0210407_1131731013300020579SoilLQPVRADSSVRLVLQNLAKSDQNQYIRSQARLMLAQMPEFD
Ga0210401_1019916133300020583SoilLEPCRADSSVRVVLRKLAENDQNQYIRSQARNWLAQLQEID
Ga0210388_1030638113300021181SoilALRLLDPVRADSSVRTVLQQLAQSDQNQYIRSQARIMLSQLPEFD
Ga0210393_1003417643300021401SoilRADSSVRLVLQKLAQSDQNQYIRSQARIMLAQLPEFD
Ga0210397_1086012613300021403SoilEPVRADGSVRSVLQKLAESDQNQYIRSQARTMLAQLPEFD
Ga0210389_1061348113300021404SoilDSSVRAVLQKLSQSDQNQYIQSQARTVLAQLPEFD
Ga0210384_1076350613300021432SoilLQPVKADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID
Ga0210384_1169845313300021432SoilDGSVRAVLQSLAEKDQNQYIKTQARNMLAQMPEFD
Ga0210391_1025551323300021433SoilDPVRADSSVRSVLKELAQNDQNQYIRSQARMMLSQLPEFD
Ga0210398_1006372213300021477SoilADSSVCTVLQELARSDQNQYIRSQARIMLSQLPEFD
Ga0210398_1042208913300021477SoilDPVRADSSVRTVLQERARSDQNQYIRSQARIMLSQLPEFD
Ga0210402_1049844523300021478SoilADSSVRAIMQHLADADQNQYIRSQARTVIAQLPEID
Ga0210409_1092406613300021559SoilADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID
Ga0126371_1206266513300021560Tropical Forest SoilGVRTSALRLLEPVRADGSVRDVLQKLAANDQNQYIRTQARNILAELREFD
Ga0242654_1044711513300022726SoilDSSVRAIMQHLADADQNQYIRSQARTVIAQLPEID
Ga0208935_101070123300025414PeatlandDPVRADSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD
Ga0207692_1119436823300025898Corn, Switchgrass And Miscanthus RhizosphereADSSVRQALLRLAREDKNQFIRSRSRMVLAQLPEID
Ga0207680_1113565413300025903Switchgrass RhizosphereTQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID
Ga0207646_1103942523300025922Corn, Switchgrass And Miscanthus RhizosphereGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRRQAGNMLAQLSGID
Ga0207644_1156841623300025931Switchgrass RhizosphereDSNTGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID
Ga0207704_1058309113300025938Miscanthus RhizosphereADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID
Ga0207661_1008912833300025944Corn RhizosphereDSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID
Ga0207679_1153226513300025945Corn RhizosphereHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID
Ga0207639_1019311313300026041Corn RhizosphereLEVLLHDSNQGLRTNALHLLGPVRADGSVRAVMQQLADGDGNQYIRSQARTVLAQLPEID
Ga0207639_1160119413300026041Corn RhizosphereTGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID
Ga0209350_110714613300026277Grasslands SoilANPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD
Ga0209236_119847813300026298Grasslands SoilLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID
Ga0209471_113319223300026318SoilLRPVRADSSVRVVLESLAQNDKNQYIRSQARTMLAQLGEMD
Ga0209471_127363923300026318SoilLLEPCKADSSVRSVFQRLAENDQNQYIRSQARTVLAQLPEID
Ga0209806_129048523300026529SoilADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID
Ga0209807_127074213300026530SoilLHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD
Ga0208092_11227813300027074Forest SoilQPVKADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID
Ga0208043_118009523300027570Peatlands SoilDSSVRVVLQKLAESDRNPYIQSQARNTLQELPEID
Ga0209116_111859813300027590Forest SoilVRADGSVRAVLQGLAESDKNQYIKAQARNMLAQMPEFD
Ga0209221_108481123300027609Forest SoilLDPVRADSSVRSVLQELARTDQNQYIRGQARMMLAQLPEFD
Ga0208696_121870023300027696Peatlands SoilEPVRADSSVRSVLQKLAESDQNQYIRSQARIMLAQLPEFD
Ga0209380_1055989523300027889SoilPVRADGSVRAVLQGLAEHDQNQYIKTQARNMLAQMPEFD
Ga0209698_1059695513300027911WatershedsALILLQPVQADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID
Ga0268264_1110797623300028381Switchgrass RhizosphereEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID
Ga0307313_1014613913300028715SoilGMRTQALHLLGPVRADGSVRAVLARLAESDSNQYIRSQARTQLAQLPEID
Ga0307312_1021860713300028828SoilNPGLRAQALRMLEPVRADSSVRVVLEKLAEKDPNQYIQSQARNVLAQTSGID
Ga0222749_1000735513300029636SoilSNPGLRAQALRLLEPVRADSSVRLVLQKLAEKDSNQFIQSQARNVLAQTAGID
Ga0265329_1028409713300031242RhizosphereLLEPVRADSSVRFVMQQLAKSDRNPYIRLQARNMLAQASQID
Ga0307479_1077838713300031962Hardwood Forest SoilLHLLEPCRADSSVRVVLQKLAESDQNLYIRTQARNVLSQMSEID
Ga0335085_1192816913300032770SoilKLLAPVQADTSVRAVLQHLADTDQNQYIRTQARNVLAQLPEID
Ga0335079_1051949813300032783SoilLRTQALHLLEPCWADGSVRTVLRKLAENDSNQYIRSQARNVLAQMPEID
Ga0335079_1173969023300032783SoilPVRADSSVRAVLQKLAANDPNPYIKAQARNELSQLPEFD
Ga0335083_1104807723300032954SoilCRADSSVRVVLQKLADNDQNLYIRSQASNMLAQTAEID


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.