| Basic Information | |
|---|---|
| Family ID | F058874 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EPVRADSSVRSVLQKLAESDQNQYIRSQARIMLAQLPEFD |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 45.52 % |
| % of genes from short scaffolds (< 2000 bps) | 39.55 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.433 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.940 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.119 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.985 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF13180 | PDZ_2 | 8.21 |
| PF13345 | Obsolete Pfam Family | 2.24 |
| PF13349 | DUF4097 | 2.24 |
| PF13374 | TPR_10 | 0.75 |
| PF01145 | Band_7 | 0.75 |
| PF02597 | ThiS | 0.75 |
| PF13492 | GAF_3 | 0.75 |
| PF00990 | GGDEF | 0.75 |
| PF13185 | GAF_2 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.75 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.43 % |
| All Organisms | root | All Organisms | 36.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002239|JGI24034J26672_10032013 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005364|Ga0070673_100489327 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300005364|Ga0070673_102373615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 504 | Open in IMG/M |
| 3300005440|Ga0070705_101193830 | Not Available | 626 | Open in IMG/M |
| 3300005575|Ga0066702_10011680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3958 | Open in IMG/M |
| 3300005712|Ga0070764_10011777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4281 | Open in IMG/M |
| 3300005712|Ga0070764_10037156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2469 | Open in IMG/M |
| 3300005879|Ga0075295_1001521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1674 | Open in IMG/M |
| 3300009098|Ga0105245_13124130 | Not Available | 513 | Open in IMG/M |
| 3300009174|Ga0105241_10058047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2971 | Open in IMG/M |
| 3300009545|Ga0105237_12285510 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009545|Ga0105237_12714531 | Not Available | 506 | Open in IMG/M |
| 3300009553|Ga0105249_10781981 | Not Available | 1018 | Open in IMG/M |
| 3300009628|Ga0116125_1049058 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300009698|Ga0116216_10197951 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300010046|Ga0126384_10994250 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300010321|Ga0134067_10002251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4702 | Open in IMG/M |
| 3300010360|Ga0126372_11385759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300010360|Ga0126372_13238348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300010366|Ga0126379_12985462 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010397|Ga0134124_13204358 | Not Available | 501 | Open in IMG/M |
| 3300010401|Ga0134121_12466728 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012353|Ga0137367_10172443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1573 | Open in IMG/M |
| 3300012354|Ga0137366_10496475 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300012960|Ga0164301_10996365 | Not Available | 658 | Open in IMG/M |
| 3300015168|Ga0167631_1018679 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300016357|Ga0182032_11897834 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017930|Ga0187825_10249743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300017974|Ga0187777_10884739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300018009|Ga0187884_10335634 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018034|Ga0187863_10866955 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300018047|Ga0187859_10154395 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300018090|Ga0187770_11650751 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300018476|Ga0190274_13514125 | Not Available | 529 | Open in IMG/M |
| 3300020579|Ga0210407_11317310 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300021181|Ga0210388_10306381 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300021401|Ga0210393_10034176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3974 | Open in IMG/M |
| 3300021403|Ga0210397_10860126 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300021404|Ga0210389_10613481 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300021432|Ga0210384_10763506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300021433|Ga0210391_10255513 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300021477|Ga0210398_10063722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3007 | Open in IMG/M |
| 3300021477|Ga0210398_10422089 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300021478|Ga0210402_10498445 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300021559|Ga0210409_10924066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300022726|Ga0242654_10447115 | Not Available | 504 | Open in IMG/M |
| 3300025414|Ga0208935_1010701 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300025898|Ga0207692_11194368 | Not Available | 505 | Open in IMG/M |
| 3300025931|Ga0207644_11568416 | Not Available | 552 | Open in IMG/M |
| 3300026041|Ga0207639_10193113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1740 | Open in IMG/M |
| 3300026041|Ga0207639_11601194 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300026318|Ga0209471_1133192 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300026318|Ga0209471_1273639 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027074|Ga0208092_112278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300027609|Ga0209221_1084811 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027696|Ga0208696_1218700 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027911|Ga0209698_10596955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300028715|Ga0307313_10146139 | Not Available | 729 | Open in IMG/M |
| 3300029636|Ga0222749_10007355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4457 | Open in IMG/M |
| 3300032770|Ga0335085_11928169 | Not Available | 601 | Open in IMG/M |
| 3300032783|Ga0335079_11739690 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.73% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.24% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.24% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1051689861 | 3300000364 | Soil | NDSNQGLRTEALHLLQPVRADGSVRNALQKLAENDQNPYIRLQAKSQLAQLPEID* |
| JGI24034J26672_100320132 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | KADSSVRAVLQRLAENDQNQYIRSQARTVMAQLPEID* |
| Ga0066679_102814631 | 3300005176 | Soil | DGNAGVRTQALQSLRPVRADSSVRVVLESLAQNDKNQYIRSQARTMLAQLGEMD* |
| Ga0065712_102292931 | 3300005290 | Miscanthus Rhizosphere | PGLRTQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0070668_1006558781 | 3300005347 | Switchgrass Rhizosphere | HLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0070673_1004893271 | 3300005364 | Switchgrass Rhizosphere | NDSNTGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID* |
| Ga0070673_1023736151 | 3300005364 | Switchgrass Rhizosphere | GLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0070710_108190172 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | NPGLRAQALRLLEPVRADSSVRVVLQKLAEKDPNQFIQSQARNVLAQTAEID* |
| Ga0070705_1011938301 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NQGLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0070707_1003578841 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID* |
| Ga0070679_1017129482 | 3300005530 | Corn Rhizosphere | PCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0070734_107286892 | 3300005533 | Surface Soil | DPVRADSSVRAVLQRLAENDQNQYIKTQARYMLAQLPEFD* |
| Ga0070733_108571481 | 3300005541 | Surface Soil | ALGLLEPVRADSSVRVVLQQLAAHDQNPYIRLQARNTLAEMPEFD* |
| Ga0070696_1014651431 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | EPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0066693_104260392 | 3300005566 | Soil | SSVRVVLQKLAVNDQNQYIRQQARNMLAQVSGID* |
| Ga0066702_100116801 | 3300005575 | Soil | DSSVRSVLQRLAQDDKNQYIRSQARSVLAQLPEID* |
| Ga0066654_105558751 | 3300005587 | Soil | ALLNDNNQGLRTEALHLLQPVRADGSVRRVLQKLAEGDQNQYIRSQARSEIAQLPEID* |
| Ga0070764_100117771 | 3300005712 | Soil | PVRADSSVRSVLKELAQNDQNQYIRSQARMMLSQLPEFD* |
| Ga0070764_100371561 | 3300005712 | Soil | RADSSVRTVLQELARSDQNQYIRSQARIMLSQLPEFD* |
| Ga0075295_10015213 | 3300005879 | Rice Paddy Soil | EALHLLGPVRADSSVRAVMQHLADGDHNQYIRSQARTVLAQLPEID* |
| Ga0066696_107695081 | 3300006032 | Soil | PGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0075030_1012816791 | 3300006162 | Watersheds | LLEPVRADSSVRVVLQKLADKDPNPYIQSQARNVLAQTSGID* |
| Ga0066653_105243992 | 3300006791 | Soil | ALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0066658_105606101 | 3300006794 | Soil | NPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0079221_106783731 | 3300006804 | Agricultural Soil | ADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0079220_108606802 | 3300006806 | Agricultural Soil | ADSSVRVVLKKLAESDQNQYIRSEARTMMAQLPEID* |
| Ga0075424_1027873282 | 3300006904 | Populus Rhizosphere | HLLQPVRADGSVRNALQKLAENDQNPYIRLQAKSQLAQLPEID* |
| Ga0099830_109341982 | 3300009088 | Vadose Zone Soil | DSSVRVVLQKLAENDQNLYIRTQARNVLSQMSEID* |
| Ga0099828_101494361 | 3300009089 | Vadose Zone Soil | PVRADSSVRVVLEKLAEKDPNQFIQSQARNVLAQTSGID* |
| Ga0105245_131241302 | 3300009098 | Miscanthus Rhizosphere | QGLRTNALHLLGPVRADSSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0075423_119433081 | 3300009162 | Populus Rhizosphere | NPGLRTQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0105241_100580474 | 3300009174 | Corn Rhizosphere | LQLLEPVRADSSVRAVLQRLAQDDKNVYIRSHARTLLAQLPEID* |
| Ga0105241_111615521 | 3300009174 | Corn Rhizosphere | QALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0105241_124811462 | 3300009174 | Corn Rhizosphere | LEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0105242_103784261 | 3300009176 | Miscanthus Rhizosphere | LHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0105237_122855101 | 3300009545 | Corn Rhizosphere | SSVRVVLKKLAESDQNQYIRSEARTMMAQLPEID* |
| Ga0105237_127145312 | 3300009545 | Corn Rhizosphere | DSSVRAVMQKLADSDRNQYIRSQARTELAQLPEID* |
| Ga0105249_107819812 | 3300009553 | Switchgrass Rhizosphere | EVLLHDANQGLRTNALHLLGPVRADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0116125_10490581 | 3300009628 | Peatland | SSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD* |
| Ga0116216_101979511 | 3300009698 | Peatlands Soil | ADSSVREVLQRLSGSDPNHYIRSQARTVLAQLPEID* |
| Ga0126384_109942502 | 3300010046 | Tropical Forest Soil | VRADGSVRSVLQKLADGDKNQYIRSQAKSQLAQLPEID* |
| Ga0134088_105641902 | 3300010304 | Grasslands Soil | LHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0134088_105641912 | 3300010304 | Grasslands Soil | LHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID* |
| Ga0134067_100022511 | 3300010321 | Grasslands Soil | DANPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID* |
| Ga0134064_100006886 | 3300010325 | Grasslands Soil | LDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0134080_105814932 | 3300010333 | Grasslands Soil | DSSVRVVLQKLAQNDQSPYIRSQARLVLAQLPEID* |
| Ga0134063_104998661 | 3300010335 | Grasslands Soil | RTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0126372_100507821 | 3300010360 | Tropical Forest Soil | DSSVRNVLTQLSQNDKNQYIRSQARNMLAQLPEID* |
| Ga0126372_113857592 | 3300010360 | Tropical Forest Soil | TQALILLQPVKADSSVRAALQQLAQTDQNQYIRSQARTVLAQLPEID* |
| Ga0126372_132383481 | 3300010360 | Tropical Forest Soil | QALLLLGPVKADSSVRAALQQLAQTDQNQYIRSQARTVLAQLPEID* |
| Ga0126378_121591301 | 3300010361 | Tropical Forest Soil | PVKADSSVRVVLKRLAENDQNQYIRSEARSVLAQVPEID* |
| Ga0126379_129854622 | 3300010366 | Tropical Forest Soil | VRADSSVRAVLQKLAQSDQNQYIRSQARIMVAQLPEFD* |
| Ga0134125_114345132 | 3300010371 | Terrestrial Soil | CRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID* |
| Ga0134124_132043582 | 3300010397 | Terrestrial Soil | ADGSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0134121_124667281 | 3300010401 | Terrestrial Soil | ADSSVRIVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0137362_103405001 | 3300012205 | Vadose Zone Soil | ADSSVRVVLQKLAENDQNLYIRTQARNVLSQMSEID* |
| Ga0137380_100145787 | 3300012206 | Vadose Zone Soil | HLLEPVSADSSVRVVLQKLAQNDQSPYIRSQARLVLAQLPEID* |
| Ga0137379_115266121 | 3300012209 | Vadose Zone Soil | LLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID* |
| Ga0137378_115654881 | 3300012210 | Vadose Zone Soil | QALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD* |
| Ga0150985_1193089422 | 3300012212 | Avena Fatua Rhizosphere | LEPVRADSSVRMVLQKLADNDQNLYIRSQARNVLSQMSEID* |
| Ga0137387_112677292 | 3300012349 | Vadose Zone Soil | QALRLLEPVRADSSVRVVLQKLAEKDPNQFIQEQARNVLAQTAGMD* |
| Ga0137367_101724431 | 3300012353 | Vadose Zone Soil | TNALHLLAPVRADSSVRAVMQQLANGDRNQYIRSQARTVLAQLPEID* |
| Ga0137366_104964751 | 3300012354 | Vadose Zone Soil | PVKADSSVRGVLQRLAENDQNQYIRSQARTLLARLPEID* |
| Ga0137385_112547132 | 3300012359 | Vadose Zone Soil | QALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVDEESR* |
| Ga0164301_109963651 | 3300012960 | Soil | SSVRAVMQQLADGDRNQYIRSQARTVLAQLPEID* |
| Ga0120125_11622212 | 3300014056 | Permafrost | LEPVSADSSVRVVLQKLAQNDQSPYIRAQARSVLAQLPEID* |
| Ga0167631_10186792 | 3300015168 | Glacier Forefield Soil | LLGPVRADGSVRQVLYKLAESDSNQYIRSQARTQLAQLPEID* |
| Ga0182032_118978341 | 3300016357 | Soil | LVEAVKADSSVRMDLRKLAEDDQNQYIRSQARTVLAQLPEID |
| Ga0187807_12306101 | 3300017926 | Freshwater Sediment | PVRADSSVRALLEQLAQGDQNPYIRSQARIMLAQLPEFD |
| Ga0187824_100532102 | 3300017927 | Freshwater Sediment | DSSVRVVLEKLAEKDSNQYIQSQARNVLAQTAGID |
| Ga0187825_102497431 | 3300017930 | Freshwater Sediment | VKADGTVRAALQHLAETDENQYIRSQARTVLAQLPEID |
| Ga0187777_108847391 | 3300017974 | Tropical Peatland | PVKADGSVRSVLQHLADSDQNQYIRSQARTVIAQLPEID |
| Ga0187782_116195392 | 3300017975 | Tropical Peatland | EPVRADSSVRAVLQRLAEDDRSEYIKNQARNMLAQLPEFD |
| Ga0187822_101775442 | 3300017994 | Freshwater Sediment | QALRLLEPVRADSSVRVVLEKLAEKDSNQYIQSQARNVLAQTAGID |
| Ga0187884_103356342 | 3300018009 | Peatland | CSPLPGSGPADSSVRTVLQELAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0187873_11334322 | 3300018013 | Peatland | RTDALRLLDPVRADSSVRTVLQQLAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0187863_108669552 | 3300018034 | Peatland | PVRADSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0187859_101543952 | 3300018047 | Peatland | DSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0187770_100417554 | 3300018090 | Tropical Peatland | EPVRADSSVRAVLQELAAKDQNQYIRSQARNTLAEVPDMD |
| Ga0187770_116507511 | 3300018090 | Tropical Peatland | GPVRGDSSVRAVLVNLAEHDENAYIKLQARSVLAQLPEFD |
| Ga0066655_104831852 | 3300018431 | Grasslands Soil | IDLLEPVRADSSVRVVLQRLAENDQNQYIRSQARNVLAQTPEID |
| Ga0066655_108533881 | 3300018431 | Grasslands Soil | NPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD |
| Ga0190274_135141252 | 3300018476 | Soil | LLGPVRADGSVRAVLYKLAESDSNQYIRSQARTQLAQLPEID |
| Ga0187794_14061142 | 3300019273 | Peatland | CWADSSVRSVLRKLAENDSNQYIRSQARNVLAQMPEID |
| Ga0193726_10535051 | 3300020021 | Soil | VLDPVRADSSVRVVLQKLAESDQNPYIKSQARLEVAQLPEID |
| Ga0210407_102685481 | 3300020579 | Soil | RTEALHLLDPVRADGSVRAVLQRLAENDQNQYIKTQARNMLAQMPEFD |
| Ga0210407_113173101 | 3300020579 | Soil | LQPVRADSSVRLVLQNLAKSDQNQYIRSQARLMLAQMPEFD |
| Ga0210401_101991613 | 3300020583 | Soil | LEPCRADSSVRVVLRKLAENDQNQYIRSQARNWLAQLQEID |
| Ga0210388_103063811 | 3300021181 | Soil | ALRLLDPVRADSSVRTVLQQLAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0210393_100341764 | 3300021401 | Soil | RADSSVRLVLQKLAQSDQNQYIRSQARIMLAQLPEFD |
| Ga0210397_108601261 | 3300021403 | Soil | EPVRADGSVRSVLQKLAESDQNQYIRSQARTMLAQLPEFD |
| Ga0210389_106134811 | 3300021404 | Soil | DSSVRAVLQKLSQSDQNQYIQSQARTVLAQLPEFD |
| Ga0210384_107635061 | 3300021432 | Soil | LQPVKADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID |
| Ga0210384_116984531 | 3300021432 | Soil | DGSVRAVLQSLAEKDQNQYIKTQARNMLAQMPEFD |
| Ga0210391_102555132 | 3300021433 | Soil | DPVRADSSVRSVLKELAQNDQNQYIRSQARMMLSQLPEFD |
| Ga0210398_100637221 | 3300021477 | Soil | ADSSVCTVLQELARSDQNQYIRSQARIMLSQLPEFD |
| Ga0210398_104220891 | 3300021477 | Soil | DPVRADSSVRTVLQERARSDQNQYIRSQARIMLSQLPEFD |
| Ga0210402_104984452 | 3300021478 | Soil | ADSSVRAIMQHLADADQNQYIRSQARTVIAQLPEID |
| Ga0210409_109240661 | 3300021559 | Soil | ADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID |
| Ga0126371_120626651 | 3300021560 | Tropical Forest Soil | GVRTSALRLLEPVRADGSVRDVLQKLAANDQNQYIRTQARNILAELREFD |
| Ga0242654_104471151 | 3300022726 | Soil | DSSVRAIMQHLADADQNQYIRSQARTVIAQLPEID |
| Ga0208935_10107012 | 3300025414 | Peatland | DPVRADSSVRAVLQQLAQSDQNQYIRSQARIMLSQLPEFD |
| Ga0207692_111943682 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ADSSVRQALLRLAREDKNQFIRSRSRMVLAQLPEID |
| Ga0207680_111356541 | 3300025903 | Switchgrass Rhizosphere | TQALHLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID |
| Ga0207646_110394252 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRRQAGNMLAQLSGID |
| Ga0207644_115684162 | 3300025931 | Switchgrass Rhizosphere | DSNTGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID |
| Ga0207704_105830911 | 3300025938 | Miscanthus Rhizosphere | ADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID |
| Ga0207661_100891283 | 3300025944 | Corn Rhizosphere | DSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID |
| Ga0207679_115322651 | 3300025945 | Corn Rhizosphere | HLLEPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID |
| Ga0207639_101931131 | 3300026041 | Corn Rhizosphere | LEVLLHDSNQGLRTNALHLLGPVRADGSVRAVMQQLADGDGNQYIRSQARTVLAQLPEID |
| Ga0207639_116011941 | 3300026041 | Corn Rhizosphere | TGMRAQALHLLGPVRADGSVRAVLARLAESDGNQYIRSQARTQLAQLPEID |
| Ga0209350_11071461 | 3300026277 | Grasslands Soil | ANPGLRTQALHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD |
| Ga0209236_11984781 | 3300026298 | Grasslands Soil | LLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID |
| Ga0209471_11331922 | 3300026318 | Soil | LRPVRADSSVRVVLESLAQNDKNQYIRSQARTMLAQLGEMD |
| Ga0209471_12736392 | 3300026318 | Soil | LLEPCKADSSVRSVFQRLAENDQNQYIRSQARTVLAQLPEID |
| Ga0209806_12904852 | 3300026529 | Soil | ADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGID |
| Ga0209807_12707421 | 3300026530 | Soil | LHLLDPCRADSSVRVVLQKLAANDQNQYIRLQARNMLAQVSGVD |
| Ga0208092_1122781 | 3300027074 | Forest Soil | QPVKADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID |
| Ga0208043_11800952 | 3300027570 | Peatlands Soil | DSSVRVVLQKLAESDRNPYIQSQARNTLQELPEID |
| Ga0209116_11185981 | 3300027590 | Forest Soil | VRADGSVRAVLQGLAESDKNQYIKAQARNMLAQMPEFD |
| Ga0209221_10848112 | 3300027609 | Forest Soil | LDPVRADSSVRSVLQELARTDQNQYIRGQARMMLAQLPEFD |
| Ga0208696_12187002 | 3300027696 | Peatlands Soil | EPVRADSSVRSVLQKLAESDQNQYIRSQARIMLAQLPEFD |
| Ga0209380_105598952 | 3300027889 | Soil | PVRADGSVRAVLQGLAEHDQNQYIKTQARNMLAQMPEFD |
| Ga0209698_105969551 | 3300027911 | Watersheds | ALILLQPVQADSSVRAALQHLAETDQNQYIRSQARTVLAQLPEID |
| Ga0268264_111079762 | 3300028381 | Switchgrass Rhizosphere | EPCRADSSVRVVLQKLAENDQNLYIRSQARNMLAQTAEID |
| Ga0307313_101461391 | 3300028715 | Soil | GMRTQALHLLGPVRADGSVRAVLARLAESDSNQYIRSQARTQLAQLPEID |
| Ga0307312_102186071 | 3300028828 | Soil | NPGLRAQALRMLEPVRADSSVRVVLEKLAEKDPNQYIQSQARNVLAQTSGID |
| Ga0222749_100073551 | 3300029636 | Soil | SNPGLRAQALRLLEPVRADSSVRLVLQKLAEKDSNQFIQSQARNVLAQTAGID |
| Ga0265329_102840971 | 3300031242 | Rhizosphere | LLEPVRADSSVRFVMQQLAKSDRNPYIRLQARNMLAQASQID |
| Ga0307479_107783871 | 3300031962 | Hardwood Forest Soil | LHLLEPCRADSSVRVVLQKLAESDQNLYIRTQARNVLSQMSEID |
| Ga0335085_119281691 | 3300032770 | Soil | KLLAPVQADTSVRAVLQHLADTDQNQYIRTQARNVLAQLPEID |
| Ga0335079_105194981 | 3300032783 | Soil | LRTQALHLLEPCWADGSVRTVLRKLAENDSNQYIRSQARNVLAQMPEID |
| Ga0335079_117396902 | 3300032783 | Soil | PVRADSSVRAVLQKLAANDPNPYIKAQARNELSQLPEFD |
| Ga0335083_110480772 | 3300032954 | Soil | CRADSSVRVVLQKLADNDQNLYIRSQASNMLAQTAEID |
| ⦗Top⦘ |