Basic Information | |
---|---|
Family ID | F058856 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 43 residues |
Representative Sequence | ARVLGGEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.75 % |
% of genes near scaffold ends (potentially truncated) | 99.25 % |
% of genes from short scaffolds (< 2000 bps) | 86.57 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.254 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.791 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.030 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.254 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF07715 | Plug | 59.70 |
PF17152 | CHASE8 | 2.24 |
PF08241 | Methyltransf_11 | 0.75 |
PF08447 | PAS_3 | 0.75 |
PF13689 | DUF4154 | 0.75 |
PF07681 | DoxX | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.75 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.25 % |
Unclassified | root | N/A | 0.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001305|C688J14111_10167729 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300002914|JGI25617J43924_10320894 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300002917|JGI25616J43925_10237146 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300005174|Ga0066680_10836933 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005176|Ga0066679_10262835 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300005187|Ga0066675_10892806 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300005532|Ga0070739_10458408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300005543|Ga0070672_101570086 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300005566|Ga0066693_10157776 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005566|Ga0066693_10414463 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005575|Ga0066702_10113469 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300005576|Ga0066708_10465705 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005576|Ga0066708_10958595 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005598|Ga0066706_10063111 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
3300006794|Ga0066658_10803017 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006893|Ga0073928_10019824 | All Organisms → cellular organisms → Bacteria | 6972 | Open in IMG/M |
3300006954|Ga0079219_10392564 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300007255|Ga0099791_10201272 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300007788|Ga0099795_10479462 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300009012|Ga0066710_102781280 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300009088|Ga0099830_10489626 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300009143|Ga0099792_11150004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300010048|Ga0126373_13009636 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010326|Ga0134065_10327375 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300010337|Ga0134062_10557959 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300011269|Ga0137392_11478384 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300011270|Ga0137391_10891281 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300011271|Ga0137393_10378108 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300011271|Ga0137393_11097098 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300012169|Ga0153990_1125331 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300012189|Ga0137388_10131098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2196 | Open in IMG/M |
3300012189|Ga0137388_10572192 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300012189|Ga0137388_11765876 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300012198|Ga0137364_10940607 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012198|Ga0137364_11252555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300012203|Ga0137399_11426189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300012205|Ga0137362_10113367 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
3300012205|Ga0137362_10157169 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300012207|Ga0137381_10032545 | All Organisms → cellular organisms → Bacteria | 4218 | Open in IMG/M |
3300012212|Ga0150985_104456272 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300012212|Ga0150985_108393670 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300012351|Ga0137386_10525572 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300012357|Ga0137384_10905759 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012361|Ga0137360_10007406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6812 | Open in IMG/M |
3300012361|Ga0137360_11599231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300012363|Ga0137390_11940154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
3300012469|Ga0150984_100201715 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300012469|Ga0150984_102141250 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300012582|Ga0137358_10401169 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300012582|Ga0137358_10577257 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300012683|Ga0137398_10718139 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300012683|Ga0137398_10745734 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012683|Ga0137398_11075764 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012685|Ga0137397_10032063 | All Organisms → cellular organisms → Bacteria | 3746 | Open in IMG/M |
3300012685|Ga0137397_10187668 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300012917|Ga0137395_10826035 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300012917|Ga0137395_10836062 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012922|Ga0137394_10947290 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300012922|Ga0137394_11110180 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012924|Ga0137413_10315020 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300012924|Ga0137413_11356762 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300012925|Ga0137419_10945823 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300012925|Ga0137419_11008280 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012927|Ga0137416_10013346 | All Organisms → cellular organisms → Bacteria | 5024 | Open in IMG/M |
3300012927|Ga0137416_11042563 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300012927|Ga0137416_11604836 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012929|Ga0137404_11444420 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012929|Ga0137404_12222346 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300012929|Ga0137404_12240244 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012930|Ga0137407_10299597 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300012930|Ga0137407_10518883 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300012944|Ga0137410_10761775 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300012948|Ga0126375_11688327 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012957|Ga0164303_10702770 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012976|Ga0134076_10157830 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300015053|Ga0137405_1203343 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
3300015245|Ga0137409_10039884 | All Organisms → cellular organisms → Bacteria | 4510 | Open in IMG/M |
3300015264|Ga0137403_10995573 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300018468|Ga0066662_12757250 | Not Available | 521 | Open in IMG/M |
3300018482|Ga0066669_11990632 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300018482|Ga0066669_12022055 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300019789|Ga0137408_1332686 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300020199|Ga0179592_10314543 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300020199|Ga0179592_10326595 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300020582|Ga0210395_10490272 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300020583|Ga0210401_11057162 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300021171|Ga0210405_11069526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300021405|Ga0210387_10674115 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300022510|Ga0242652_1049539 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300022532|Ga0242655_10000455 | All Organisms → cellular organisms → Bacteria | 4607 | Open in IMG/M |
3300022726|Ga0242654_10050273 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300024288|Ga0179589_10017136 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
3300025906|Ga0207699_10434154 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300025914|Ga0207671_10822280 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025922|Ga0207646_11167528 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300026089|Ga0207648_12036030 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300026118|Ga0207675_102593223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
3300026298|Ga0209236_1258396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300026305|Ga0209688_1006947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2080 | Open in IMG/M |
3300026305|Ga0209688_1021812 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
3300026319|Ga0209647_1220609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300026323|Ga0209472_1237287 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300026331|Ga0209267_1237082 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300026335|Ga0209804_1075589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1586 | Open in IMG/M |
3300026496|Ga0257157_1071407 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026523|Ga0209808_1315199 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300026537|Ga0209157_1361743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300026550|Ga0209474_10400086 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300026551|Ga0209648_10031644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4614 | Open in IMG/M |
3300026557|Ga0179587_10101019 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
3300026557|Ga0179587_10260945 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300027521|Ga0209524_1044665 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300027535|Ga0209734_1053727 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300027591|Ga0209733_1009895 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
3300027610|Ga0209528_1103059 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300027629|Ga0209422_1076470 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300027651|Ga0209217_1010519 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
3300027678|Ga0209011_1168949 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300027725|Ga0209178_1423282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300027765|Ga0209073_10003353 | All Organisms → cellular organisms → Bacteria | 3701 | Open in IMG/M |
3300027862|Ga0209701_10416111 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300030991|Ga0073994_12051251 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031718|Ga0307474_10053313 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
3300031718|Ga0307474_10109856 | All Organisms → cellular organisms → Bacteria | 2066 | Open in IMG/M |
3300031718|Ga0307474_10737177 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300031720|Ga0307469_11469945 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031754|Ga0307475_10284065 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300031823|Ga0307478_10867977 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300032157|Ga0315912_10870834 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300032180|Ga0307471_100365838 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300032180|Ga0307471_102486638 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300032180|Ga0307471_103637735 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032828|Ga0335080_12234514 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300034662|Ga0314783_084640 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.43% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.22% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.49% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.49% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J14111_101677291 | 3300001305 | Soil | RMQEALGSGYEAEEEVRRFLSYLRRPDTLTYSNVFTVVGDKPR* |
JGI25617J43924_103208943 | 3300002914 | Grasslands Soil | LSRVLGSENEAKEQSRAFLEYLRRPDTLTYSTVFTVVGEKP* |
JGI25616J43925_102371463 | 3300002917 | Grasslands Soil | QLARVLGSEREANEQSRAFLEYLRRPDTLTYSTVFTVAGKKSI* |
Ga0066680_108369332 | 3300005174 | Soil | LARVLGSEHEAEKQSSAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0066679_102628352 | 3300005176 | Soil | PQLARVLGGESEAKKQIRAFLDYLSRPDTFTYSTVFTVTGAKPV* |
Ga0066675_108928061 | 3300005187 | Soil | PQLARVLGGEREAEEQSRAFLEYLRRPDSLTYSTVFTVAGEKGL* |
Ga0070739_104584082 | 3300005532 | Surface Soil | RVAEALGSEWDAEQEIRRFLDYLAHPDTLTYSNVFTVTGEKPL* |
Ga0070672_1015700861 | 3300005543 | Miscanthus Rhizosphere | SNYEADEEVRRFLSYLRRPDTLTYSTVFTVVGERPR* |
Ga0066693_101577762 | 3300005566 | Soil | IAKPLLARSLGSESEAREQTRRFLDYLRRPDTLTYSMVFTVTGEKP* |
Ga0066693_104144632 | 3300005566 | Soil | LGSEREAREQANRFLEYLCRPDTLTYSTVFTVTGEKPL* |
Ga0066702_101134692 | 3300005575 | Soil | LEIARPHLERALGSEYEADEEIRRFLNYLKRPDTLTYSTLFTVTGEKPQ* |
Ga0066708_104657051 | 3300005576 | Soil | QMAKALGSKEEAEEQIQRFLEYLCRPDTLTYSVQFTVTGEKAA* |
Ga0066708_109585951 | 3300005576 | Soil | ALPQIARVLGSDDAAREYGRKFIEYLCRPDTLTYSNVFTVTGQKPQ* |
Ga0066706_100631112 | 3300005598 | Soil | PQLARALGGESQAHEQSRAFLEYLRRPDTLTYSTVFTVTGEKSI* |
Ga0066658_108030171 | 3300006794 | Soil | SRMAEALGSKEEAEEQIQRFLEYLCRPDTLTYSVQFTVTGEKAA* |
Ga0073928_100198241 | 3300006893 | Iron-Sulfur Acid Spring | LEIARPQLNRVLGGETAAKKQTRAFLEYLSRSDTLTYSTVFTVTGEKPL* |
Ga0079219_103925643 | 3300006954 | Agricultural Soil | QPQIARIFGSEARARGHSQRFLDYLRRPDTLTYSTVITVTGEKTL* |
Ga0099791_102012721 | 3300007255 | Vadose Zone Soil | IAKPQLARLLGSETEAREQTRRFLEYLCRPDTLTYSTVFTVTGEKSEQL* |
Ga0099795_104794622 | 3300007788 | Vadose Zone Soil | EELEMELEIEGPQRGRLLGSEREAREQSRRFLEYLCRPDTLTYSTVFTVSGEKV* |
Ga0066710_1027812802 | 3300009012 | Grasslands Soil | QLARALGGESQAHEQSRAFLEYLRRPDTLTYSTVFTVTGEKSI |
Ga0099830_104896262 | 3300009088 | Vadose Zone Soil | GDERAASGLAQRFLEYLRRPDTLTYSNVFTVTGVKPL* |
Ga0099792_111500042 | 3300009143 | Vadose Zone Soil | IAKPQMSRVLGSESEAKKHSQAFLDFLRRPDTLTYSTVFTVTGEKPL* |
Ga0126373_130096362 | 3300010048 | Tropical Forest Soil | GSKAEAEEHIQRFLEYLCRPDTLTYSIQFTVTGVKAQ* |
Ga0134065_103273752 | 3300010326 | Grasslands Soil | RVLGGEREAEEQSRAFLEYLRRPDSLTYSTVFTVAGEKGL* |
Ga0134062_105579592 | 3300010337 | Grasslands Soil | SQMAKALGSKAEAERHIQRFLEYLCRPDTLTYSMQFTVTGEKGYETGK* |
Ga0137392_114783841 | 3300011269 | Vadose Zone Soil | REAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137391_108912812 | 3300011270 | Vadose Zone Soil | ARVLGSEREAEQQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137393_103781081 | 3300011271 | Vadose Zone Soil | SEAEGQSRAFLEYLRRPETLTYSTVFTVAGKKAL* |
Ga0137393_110970981 | 3300011271 | Vadose Zone Soil | KPQLARVLGGEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0153990_11253313 | 3300012169 | Attine Ant Fungus Gardens | RIFGSEAEAKAYSQRFLEYLSRPDTLTYSTVFTVVGEKPL* |
Ga0137388_101310982 | 3300012189 | Vadose Zone Soil | PRIARILGDERAASGLAQRFLEYLRRPDTLTYSNVFTVTGVKPL* |
Ga0137388_105721921 | 3300012189 | Vadose Zone Soil | EIAGPQLARLLGSESEAREQSRRFLEYLCRPDTLTYSTVFTVTGEKF* |
Ga0137388_117658761 | 3300012189 | Vadose Zone Soil | IAKPQLARVLGSEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137364_109406071 | 3300012198 | Vadose Zone Soil | EIARPQLARVLGGESEAKKQIRAFLDYLSRSDTFTYSTVFTVTGAKPV* |
Ga0137364_112525551 | 3300012198 | Vadose Zone Soil | PQLARVLGGESEAKKQIRAFLDYLSRSDTFTYSTVFTVTGAKPV* |
Ga0137399_114261893 | 3300012203 | Vadose Zone Soil | KLEIARPQLARVLGGESEAKKQIRAFLNYLSRPDTFTYSTVFTVTGEKPL* |
Ga0137362_101133671 | 3300012205 | Vadose Zone Soil | PQMSRVLGSESEAKEQSRAFLEFLRQPDTLTYSTVFTVAGKKPL* |
Ga0137362_101571692 | 3300012205 | Vadose Zone Soil | ELEAQEQSRAFLEYLRRPDTLTYSTVFTVVGKKSL* |
Ga0137381_100325455 | 3300012207 | Vadose Zone Soil | LKLEIARPQLARVLGGEREAEEQSRAFLEYLRQPDTLTYSTVFTVAGKKTL* |
Ga0150985_1044562722 | 3300012212 | Avena Fatua Rhizosphere | MQEALGSGYEAEEEVRRFLSYLRRPDTLTYSNVFTVVGEKPR* |
Ga0150985_1083936701 | 3300012212 | Avena Fatua Rhizosphere | PRMQEALGSGYEAEEEVRRFLSYLRRPDTLTYSNVFTVVGDKPR* |
Ga0137386_105255722 | 3300012351 | Vadose Zone Soil | LGGESEAKKQIRAFLDYLSRSDTFTYSTVFTVTGAKPV* |
Ga0137384_109057592 | 3300012357 | Vadose Zone Soil | VLGGESEAKKQVRAFLDYLSRSDTFTYSTVFTVTGAKPV* |
Ga0137360_100074066 | 3300012361 | Vadose Zone Soil | LGGDGDAKAQTQRFLEYLRRPDTLTYSTVFTVTGEKRQ* |
Ga0137360_115992311 | 3300012361 | Vadose Zone Soil | ESEARKQSQAFLDFLRRPDTLTYSTVFTVTGEKPL* |
Ga0137390_119401542 | 3300012363 | Vadose Zone Soil | KLEIAKPQLAQIFGGESEAKKQIRAFLDYLSRPDTLTYSTVFTVTGEKTI* |
Ga0150984_1002017151 | 3300012469 | Avena Fatua Rhizosphere | MAAALGSDYEADEEIRRFLNYLRRPDTLTYSNVFTVTGEKPR* |
Ga0150984_1021412502 | 3300012469 | Avena Fatua Rhizosphere | ARPSMVRALGSESEADEQIRRFMDYLSRPDTLTYSNVFTITGKKPL* |
Ga0137358_104011691 | 3300012582 | Vadose Zone Soil | QLARVLGGESEAKKQIRAFLDYLSRPDTFTYSTVFTVTGEKPL* |
Ga0137358_105772572 | 3300012582 | Vadose Zone Soil | EGAAREHTQRFLEYLRRPDTLTYSIVFTIVGKKSL* |
Ga0137398_107181391 | 3300012683 | Vadose Zone Soil | LGDERAAREQAQRFLEYLRRPDTLTYSNVFTVTGVKPL* |
Ga0137398_107457341 | 3300012683 | Vadose Zone Soil | RAAREQAQRFLEYLRRPDTLTYSNVFTVTGVKPL* |
Ga0137398_110757642 | 3300012683 | Vadose Zone Soil | LKLEIARPQLARVLGSESEAERQSQAFLEYLRRPDTLTYSTAF |
Ga0137397_100320631 | 3300012685 | Vadose Zone Soil | LGGECEAKEQTQRFLEYLRRPDTLTYSNVFTVTGEKRR* |
Ga0137397_101876681 | 3300012685 | Vadose Zone Soil | EIARPQLARVLGGESEAKKQIRAFLDYLSRPDTFTYSTVFTVTGEKAL* |
Ga0137395_108260352 | 3300012917 | Vadose Zone Soil | VLGSESEAERQSREFLEYLRRPDTLTYSTAFTVAGKKAI* |
Ga0137395_108360622 | 3300012917 | Vadose Zone Soil | LARVLGSEREAEEQSRAFLDYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137394_109472902 | 3300012922 | Vadose Zone Soil | AGVLGGELEAQEQSRAFLEYLRRPDTLTYSTVFTIVGKKSL* |
Ga0137394_111101802 | 3300012922 | Vadose Zone Soil | AGVLGGELEAQEQSRAFLEYLRRPDTLTYSTVFTIVGKKSS* |
Ga0137413_103150203 | 3300012924 | Vadose Zone Soil | EIAAPQMSRVLGSESEARKQSQAFLDFLRRPDTLTYSNVFTVTGEKPL* |
Ga0137413_113567621 | 3300012924 | Vadose Zone Soil | LKLEIAVPQIARIFGSERAAKEQTRKFLEYLRPPYTLTYSNVFTVTGEKPL* |
Ga0137419_109458231 | 3300012925 | Vadose Zone Soil | PWIARIVGDERAASELAQRFLEYLRRPDTLTYSNVFTVTGVKPL* |
Ga0137419_110082801 | 3300012925 | Vadose Zone Soil | GDERAAVELAQRFLDYLRRPDTLTYSNVFTVTGVKPL* |
Ga0137416_100133461 | 3300012927 | Vadose Zone Soil | DIAAPQIARILGGDRDAKAQTQRFLEYLRRPDTLTYSTVFTVTGEKRQ* |
Ga0137416_110425632 | 3300012927 | Vadose Zone Soil | ARVLGGEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137416_116048361 | 3300012927 | Vadose Zone Soil | VLGGEREAQEQSRAFLEYLRRPDTLTYSTVFTIVGKKSL* |
Ga0137404_114444201 | 3300012929 | Vadose Zone Soil | VGVLGGELEAQEQSRAFLEYLRRPDTLTYSTVFTVVGKKSS* |
Ga0137404_122223461 | 3300012929 | Vadose Zone Soil | GELEAQEQSQAFLEYLRRPDTLTYSTVFTVVGKKSL* |
Ga0137404_122402441 | 3300012929 | Vadose Zone Soil | LEIARPQLAQLLGSEREAREQSRRFLEYLRRPDTLTYSTVFTVTGVKY* |
Ga0137407_102995971 | 3300012930 | Vadose Zone Soil | PQLARLLGSESEAREQTRRFLEYLRRPDTLTYSTVFTVTGEKS* |
Ga0137407_105188832 | 3300012930 | Vadose Zone Soil | PQLARLLGSESEAQEQTRRFLDYLRRPDTLTYSTVFTVTGEKS* |
Ga0137410_107617752 | 3300012944 | Vadose Zone Soil | SRVLGSESEARKQSQAFLDFLRRPDTLTYSTVFTVTGEKPL* |
Ga0126375_116883271 | 3300012948 | Tropical Forest Soil | MAAALGSVYEADEEIRRFLSYLRRPDTMTYSNVFTVKGEKPR* |
Ga0164303_107027701 | 3300012957 | Soil | MAAALGSEYEADEEIRRFLNYLKRPDTMTYSNVFTVTGEKPR* |
Ga0134076_101578302 | 3300012976 | Grasslands Soil | LARVFGGEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL* |
Ga0137405_12033431 | 3300015053 | Vadose Zone Soil | ESEVREQTSESEVREQTRRFLEYLCRPDTLTYSTVFTVTGEKS* |
Ga0137409_100398844 | 3300015245 | Vadose Zone Soil | RVLGSESEARGQSRAFLEFLSRPDTLTYSTVFTVAGKKPL* |
Ga0137403_109955731 | 3300015264 | Vadose Zone Soil | RAAKEQARKFLEYLRRPDTLTYSNVFTVTGEKPL* |
Ga0066662_127572501 | 3300018468 | Grasslands Soil | QLARVLGGEREAEEQSRAFLEYLRQPDTLTYSTVFTVAGKKTL |
Ga0066669_119906322 | 3300018482 | Grasslands Soil | EYEADEEMRRFLSYLRRPDTLTYSNVFTVTGEKPR |
Ga0066669_120220552 | 3300018482 | Grasslands Soil | GPQLARLLGSESEAREQTRRFLEYLRRPDTLTYSTVFTVTGEKS |
Ga0137408_13326862 | 3300019789 | Vadose Zone Soil | EIARPQLARVLGSEREAEEQSSAFLEYLRRPDTLTYSTVFTVAGEKSL |
Ga0179592_103145432 | 3300020199 | Vadose Zone Soil | GEGAAREHTQRFLEYLRRPDTLTYSIVFTIAGKKSL |
Ga0179592_103265952 | 3300020199 | Vadose Zone Soil | LEIAKPQLARVLGSEREAEEQSRAFLEYLRRPDTLTYSSVFTVAGEKSL |
Ga0210395_104902721 | 3300020582 | Soil | RPQMTRVFGSEAEAKAYSRRFLEYLSRPDTLTYSTVFTVTGEKPL |
Ga0210401_110571621 | 3300020583 | Soil | QVFGGESEAKNQIRAFLEYLSRPDTLTYSTVFTVTGEKAL |
Ga0210405_110695261 | 3300021171 | Soil | PQLAQIFGGESEAKNQIRAFLEYLSRPDTLTYSTVFTVTGEKAL |
Ga0210387_106741152 | 3300021405 | Soil | APRMARALGGEDKARECSQRFLEYLSRPDTLTYSTVFTVTGEKPLRN |
Ga0242652_10495391 | 3300022510 | Soil | RVFGSEAEAKAYSRRFLEYLSRPDTLTYSTVFTVTGEKPL |
Ga0242655_100004551 | 3300022532 | Soil | EAEAKAYSRRFLEYLSRPDTLTYSTVFTVTGEKPL |
Ga0242654_100502731 | 3300022726 | Soil | ELKLEIAKPQLAQIFGGESEAKNQIRAFLEYLSRPDTLTYSTVFTVTGEKPL |
Ga0179589_100171361 | 3300024288 | Vadose Zone Soil | KLEIAAPQMSRVLGSESEARKQSQAFLDFLRRPDTLTYSNAFTVTGEKPL |
Ga0207699_104341542 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ETTAREHAKRFLEYLRRPDTLTYSTVFTVSGKKPLQ |
Ga0207671_108222801 | 3300025914 | Corn Rhizosphere | IALPQIARVLGSDHAAREYGRKFIEYLCRPDTLTYSNVFTVTGQKP |
Ga0207646_111675282 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LARLLGSESEAREQTRRFLEYLRRPDTLTYSTVFTVTGEKA |
Ga0207648_120360302 | 3300026089 | Miscanthus Rhizosphere | PCLEQMLGSKHAAAEQIERFLDYLKSPDTLTYSNVFTVTGEKPL |
Ga0207675_1025932231 | 3300026118 | Switchgrass Rhizosphere | LGDGYEADKEIRRFLSYLRRPDTLTYCNAFTVAGEKPR |
Ga0209236_12583962 | 3300026298 | Grasslands Soil | EIARPQLARVLGGESEAKKQIRAFLDYLSRPDTFTYSTVFTVTGEKAL |
Ga0209688_10069471 | 3300026305 | Soil | SRMAKALGSKEEAEEQIQRFLEYLCRPDTLTYSVQFTVTGEKAA |
Ga0209688_10218123 | 3300026305 | Soil | VLGSEREAREQANRFLEYLCRPDTLTYSTVFTVTGEKPL |
Ga0209647_12206093 | 3300026319 | Grasslands Soil | EIAGPQMSRVLGSESQAKEQSKAFLDFLRRPDTLTYSTVFTVTGEKPL |
Ga0209472_12372872 | 3300026323 | Soil | SKAEAERHIRRFLEYLCRPDTLTYSMQFTVTGEKGYETGK |
Ga0209267_12370821 | 3300026331 | Soil | LGGEREAEEQSRAFLEYLRRPDSLTYSTVFTVAGEKGL |
Ga0209804_10755891 | 3300026335 | Soil | PQLARALGGESQAHEQSRAFLEYLRRPDTLTYSTVFTVTGEKSI |
Ga0257157_10714071 | 3300026496 | Soil | ARVLGDEGAAREHAQRFLEYLRRPDTLTYSNVFTVTGVKPL |
Ga0209808_13151991 | 3300026523 | Soil | QMAKALGSKEEAEEQIQRFLEYLCRPDTLTYSVQFTVTGEKAA |
Ga0209157_13617432 | 3300026537 | Soil | RVLGSENEAKEQSRAFLEYLRRPDTLTYSTVFTVVGEKP |
Ga0209474_104000862 | 3300026550 | Soil | KLEIARPRLARVFGGEREAEEQSRAFLEYLRRPDTLTYSTVFTVAGEKSL |
Ga0209648_100316441 | 3300026551 | Grasslands Soil | EIARPQLSRVLGSENEAKEQSRAFLEYLRRPDTLTYSTVFTVVGEKP |
Ga0179587_101010192 | 3300026557 | Vadose Zone Soil | ARPQLARVLGSESEAEGQSRAFLEYLRRPETLTYSTVFTVAGKKAL |
Ga0179587_102609452 | 3300026557 | Vadose Zone Soil | LGGESEAKKQIRAFLDYLSRPDTFTYSTVFTVTGEKPL |
Ga0209524_10446651 | 3300027521 | Forest Soil | PWIARIVGDERSANKLAQRFLEYLRRPDTLTYSNVFTVTGVKPL |
Ga0209734_10537271 | 3300027535 | Forest Soil | GSEREAREQSRKFLEFLRRPDTLTYSTVFTVTGEKV |
Ga0209733_10098953 | 3300027591 | Forest Soil | IAAPQLTKVLGSETAAKEHAQRFLEYLRRPDTLTYSTVFTVTGKKPLQQSCN |
Ga0209528_11030591 | 3300027610 | Forest Soil | IVGDERAASELAQRFLEYLRRPDTLTYSNVFTVTGVKPL |
Ga0209422_10764702 | 3300027629 | Forest Soil | AGAAKEHAKRFLDYLRRPDTLTYSNVFTVTGEKPW |
Ga0209217_10105191 | 3300027651 | Forest Soil | QLARLLGSESEAREQSRRFLDYLRRPDTLTYSTVFTVTGEKP |
Ga0209011_11689492 | 3300027678 | Forest Soil | VPWIARIVGDERAASELAQRFLEYLRRPDTLTYSNVFTVTGVKPL |
Ga0209178_14232821 | 3300027725 | Agricultural Soil | KLEIAQPQMARVFGGEAEAREHSQRFLDYLRRPDTLTYSNVFTVKGEKRS |
Ga0209073_100033534 | 3300027765 | Agricultural Soil | LEIAQPQIARIFGSEARAREHSQRFLDYLRRPDTLTYSTVFTVTGEKTL |
Ga0209701_104161112 | 3300027862 | Vadose Zone Soil | MSQVLGSESEAKKQSQAFLDFLRQPDTLTYSTVFTVTGEKPL |
Ga0073994_120512511 | 3300030991 | Soil | GDERAASELAQRFLDYLRRPDTLTYSNVFTVTGVKPL |
Ga0307474_100533131 | 3300031718 | Hardwood Forest Soil | DSEAKKQSQAFLDFLRQPDTLTYSTVFTVTGEKPL |
Ga0307474_101098561 | 3300031718 | Hardwood Forest Soil | LLGSESEAREQSRRFLEYLCRPDTLTYSTVFTVTGEKV |
Ga0307474_107371771 | 3300031718 | Hardwood Forest Soil | IARPQMTRVFGSEAEAKAYSRRFLEYLSRPDTLTYSTVFTVTGEKPL |
Ga0307469_114699451 | 3300031720 | Hardwood Forest Soil | AGPLLARVLGGESQAEKQSRAFLEYLRRPDTLTYSTVFTVAGKKAT |
Ga0307475_102840651 | 3300031754 | Hardwood Forest Soil | ELKLEIARPQLARVLGGESEAQKQIRAFLDYLSRPDTFTYSTVFTVTGEKPL |
Ga0307478_108679772 | 3300031823 | Hardwood Forest Soil | PLLAQIFGGENEAKKQIRAFLEYLSRPDTLTYSTVFTVTGEKAL |
Ga0315912_108708342 | 3300032157 | Soil | LGSEMEADEQIRRFMDYLHRPDTLTYSNVFTITGKKPL |
Ga0307471_1003658382 | 3300032180 | Hardwood Forest Soil | IADNEGEAKEYSRRFLEYLSRPDTLTYSTVFTVTGEKPF |
Ga0307471_1024866382 | 3300032180 | Hardwood Forest Soil | LEIARPQMARIFGSEAEAKEHTRRFLEYLRRPDTLTYSTVFTVTGEKPL |
Ga0307471_1036377352 | 3300032180 | Hardwood Forest Soil | GSEREAGEHSRRFLDYLKRPDTLTYSTVFTVTGQKPL |
Ga0335080_122345141 | 3300032828 | Soil | IARILGSEREAKECARRFMEYLNRPDTLTYSTVFTVTGEKAQ |
Ga0314783_084640_2_127 | 3300034662 | Soil | AEALGSEYEAGEEIRRFLGYLRRPDTLTYCNAFTVTGQKPR |
⦗Top⦘ |