Basic Information | |
---|---|
Family ID | F058846 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 46 residues |
Representative Sequence | VTLLAALHAFSQEHERCGELDSAVDGDRVWMSCTCGAVINRCADDD |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 32.56 % |
% of genes near scaffold ends (potentially truncated) | 35.82 % |
% of genes from short scaffolds (< 2000 bps) | 85.07 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.851 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (26.119 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.493 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.194 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.86% β-sheet: 22.97% Coil/Unstructured: 62.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 18.66 |
PF07452 | CHRD | 4.48 |
PF01068 | DNA_ligase_A_M | 2.99 |
PF07045 | DUF1330 | 2.24 |
PF00496 | SBP_bac_5 | 1.49 |
PF03480 | DctP | 1.49 |
PF02371 | Transposase_20 | 1.49 |
PF00691 | OmpA | 0.75 |
PF00561 | Abhydrolase_1 | 0.75 |
PF14534 | DUF4440 | 0.75 |
PF11716 | MDMPI_N | 0.75 |
PF07721 | TPR_4 | 0.75 |
PF13411 | MerR_1 | 0.75 |
PF08734 | GYD | 0.75 |
PF00857 | Isochorismatase | 0.75 |
PF14247 | DUF4344 | 0.75 |
PF03573 | OprD | 0.75 |
PF13416 | SBP_bac_8 | 0.75 |
PF01695 | IstB_IS21 | 0.75 |
PF01590 | GAF | 0.75 |
PF00144 | Beta-lactamase | 0.75 |
PF02727 | Cu_amine_oxidN2 | 0.75 |
PF08450 | SGL | 0.75 |
PF04191 | PEMT | 0.75 |
PF01738 | DLH | 0.75 |
PF00571 | CBS | 0.75 |
PF13426 | PAS_9 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 18.66 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 2.99 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 2.99 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 2.24 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.49 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.75 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.75 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.75 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.75 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.75 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.75 |
COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.75 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.85 % |
Unclassified | root | N/A | 20.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y02GFO7O | Not Available | 693 | Open in IMG/M |
3300000559|F14TC_100579877 | Not Available | 1192 | Open in IMG/M |
3300000955|JGI1027J12803_100555662 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300004268|Ga0066398_10221142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 508 | Open in IMG/M |
3300004633|Ga0066395_10290680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 890 | Open in IMG/M |
3300005332|Ga0066388_100003571 | All Organisms → cellular organisms → Bacteria | 10141 | Open in IMG/M |
3300005332|Ga0066388_100780088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1551 | Open in IMG/M |
3300005332|Ga0066388_102298790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 975 | Open in IMG/M |
3300005332|Ga0066388_104989645 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300005332|Ga0066388_105263158 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005332|Ga0066388_106880847 | Not Available | 572 | Open in IMG/M |
3300005363|Ga0008090_15531771 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300005445|Ga0070708_100186385 | Not Available | 1940 | Open in IMG/M |
3300005445|Ga0070708_100270129 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300005468|Ga0070707_102147737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 526 | Open in IMG/M |
3300005518|Ga0070699_101627744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 591 | Open in IMG/M |
3300005558|Ga0066698_10307081 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300005568|Ga0066703_10067649 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
3300005713|Ga0066905_100893451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 777 | Open in IMG/M |
3300005764|Ga0066903_100164366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3227 | Open in IMG/M |
3300005764|Ga0066903_100323728 | All Organisms → cellular organisms → Bacteria | 2464 | Open in IMG/M |
3300005764|Ga0066903_100809640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1677 | Open in IMG/M |
3300005764|Ga0066903_100873132 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
3300005764|Ga0066903_101002880 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
3300005764|Ga0066903_101529549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1261 | Open in IMG/M |
3300005764|Ga0066903_101611691 | Not Available | 1231 | Open in IMG/M |
3300005764|Ga0066903_101647873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1219 | Open in IMG/M |
3300005764|Ga0066903_102182766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1067 | Open in IMG/M |
3300005764|Ga0066903_102437463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1012 | Open in IMG/M |
3300005764|Ga0066903_103070620 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 904 | Open in IMG/M |
3300005764|Ga0066903_103370920 | Not Available | 863 | Open in IMG/M |
3300005764|Ga0066903_106373601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300005764|Ga0066903_107252789 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005764|Ga0066903_108773286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
3300006854|Ga0075425_100225318 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2156 | Open in IMG/M |
3300006854|Ga0075425_100572195 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300006854|Ga0075425_102782419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 538 | Open in IMG/M |
3300007076|Ga0075435_100882652 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300009792|Ga0126374_10114971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1560 | Open in IMG/M |
3300009792|Ga0126374_10365065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
3300009792|Ga0126374_11318149 | Not Available | 584 | Open in IMG/M |
3300010043|Ga0126380_10222546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1283 | Open in IMG/M |
3300010046|Ga0126384_10527884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1022 | Open in IMG/M |
3300010047|Ga0126382_10023901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 3235 | Open in IMG/M |
3300010047|Ga0126382_10093091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 1923 | Open in IMG/M |
3300010047|Ga0126382_10435851 | Not Available | 1034 | Open in IMG/M |
3300010047|Ga0126382_12236292 | Not Available | 527 | Open in IMG/M |
3300010048|Ga0126373_13234394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
3300010358|Ga0126370_10720527 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300010358|Ga0126370_11516478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
3300010359|Ga0126376_11385417 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300010359|Ga0126376_12693947 | Not Available | 546 | Open in IMG/M |
3300010359|Ga0126376_13190940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
3300010360|Ga0126372_10352364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1321 | Open in IMG/M |
3300010360|Ga0126372_10419893 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300010360|Ga0126372_10527355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1116 | Open in IMG/M |
3300010360|Ga0126372_11691819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 674 | Open in IMG/M |
3300010360|Ga0126372_12038876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 621 | Open in IMG/M |
3300010362|Ga0126377_10584966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1159 | Open in IMG/M |
3300010362|Ga0126377_11619015 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300010366|Ga0126379_10060140 | All Organisms → cellular organisms → Bacteria | 3180 | Open in IMG/M |
3300010376|Ga0126381_100719222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1429 | Open in IMG/M |
3300010376|Ga0126381_104313152 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 551 | Open in IMG/M |
3300010376|Ga0126381_105037780 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
3300010398|Ga0126383_10154158 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300010398|Ga0126383_10612354 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300010398|Ga0126383_11639657 | Not Available | 732 | Open in IMG/M |
3300010398|Ga0126383_12317231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
3300012948|Ga0126375_10247589 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1205 | Open in IMG/M |
3300012948|Ga0126375_10287081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
3300012948|Ga0126375_11660145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300012971|Ga0126369_10120395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2417 | Open in IMG/M |
3300012971|Ga0126369_11962782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
3300015371|Ga0132258_10393011 | All Organisms → cellular organisms → Bacteria | 3443 | Open in IMG/M |
3300015374|Ga0132255_101430074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
3300016294|Ga0182041_11240713 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 681 | Open in IMG/M |
3300016357|Ga0182032_11764646 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 540 | Open in IMG/M |
3300016371|Ga0182034_10489371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1024 | Open in IMG/M |
3300016404|Ga0182037_10193097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1573 | Open in IMG/M |
3300016404|Ga0182037_10615027 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 923 | Open in IMG/M |
3300025910|Ga0207684_10551294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas azotifigens | 986 | Open in IMG/M |
3300025922|Ga0207646_10218040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1724 | Open in IMG/M |
3300025937|Ga0207669_10497361 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300027527|Ga0209684_1005375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2121 | Open in IMG/M |
3300027907|Ga0207428_10168218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1661 | Open in IMG/M |
3300031544|Ga0318534_10126210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1471 | Open in IMG/M |
3300031546|Ga0318538_10373985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 770 | Open in IMG/M |
3300031573|Ga0310915_10622702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 764 | Open in IMG/M |
3300031573|Ga0310915_11280642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
3300031640|Ga0318555_10192480 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300031668|Ga0318542_10113528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1319 | Open in IMG/M |
3300031679|Ga0318561_10465275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 696 | Open in IMG/M |
3300031719|Ga0306917_10368320 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300031720|Ga0307469_10231610 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300031740|Ga0307468_100061784 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2027 | Open in IMG/M |
3300031740|Ga0307468_101807688 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 579 | Open in IMG/M |
3300031747|Ga0318502_10958584 | Not Available | 521 | Open in IMG/M |
3300031768|Ga0318509_10081871 | Not Available | 1713 | Open in IMG/M |
3300031779|Ga0318566_10048137 | All Organisms → cellular organisms → Bacteria | 2019 | Open in IMG/M |
3300031796|Ga0318576_10081615 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300031798|Ga0318523_10459657 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031820|Ga0307473_10278158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
3300031833|Ga0310917_10880370 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300031846|Ga0318512_10387280 | Not Available | 702 | Open in IMG/M |
3300031879|Ga0306919_10026242 | All Organisms → cellular organisms → Bacteria | 3609 | Open in IMG/M |
3300031880|Ga0318544_10385403 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 545 | Open in IMG/M |
3300031890|Ga0306925_11627285 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300031890|Ga0306925_12085141 | Not Available | 532 | Open in IMG/M |
3300031910|Ga0306923_10160079 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
3300031941|Ga0310912_10734318 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300031941|Ga0310912_11040812 | Not Available | 627 | Open in IMG/M |
3300031945|Ga0310913_10912148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 618 | Open in IMG/M |
3300031954|Ga0306926_12402520 | Not Available | 581 | Open in IMG/M |
3300032041|Ga0318549_10133168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1100 | Open in IMG/M |
3300032043|Ga0318556_10724728 | Not Available | 517 | Open in IMG/M |
3300032052|Ga0318506_10472790 | Not Available | 555 | Open in IMG/M |
3300032055|Ga0318575_10137398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1208 | Open in IMG/M |
3300032063|Ga0318504_10594324 | Not Available | 531 | Open in IMG/M |
3300032064|Ga0318510_10159879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 893 | Open in IMG/M |
3300032065|Ga0318513_10465577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
3300032076|Ga0306924_10639122 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300032091|Ga0318577_10310811 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 754 | Open in IMG/M |
3300032180|Ga0307471_101866915 | Not Available | 751 | Open in IMG/M |
3300032205|Ga0307472_100379961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RBG_16_73_20 | 1173 | Open in IMG/M |
3300032205|Ga0307472_100747097 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300032261|Ga0306920_101840836 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300032261|Ga0306920_103136038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas oryzicola | 620 | Open in IMG/M |
3300032770|Ga0335085_11079771 | Not Available | 861 | Open in IMG/M |
3300033290|Ga0318519_10356115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 866 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.73% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.49% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.75% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_02514930 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MLLAALYAFFQEHERCGDLDSGLESDRVWLACSACGAVINRCADDE |
F14TC_1005798772 | 3300000559 | Soil | MSLLADLDAFFQEHQHCGDLDSAVEGHRMWMTCTCGAAISRPADDD* |
JGI1027J12803_1005556622 | 3300000955 | Soil | AVTLLDALYAFYQEHARCGDLGSAIEGDRVWMTCTCGARIERDADRD* |
Ga0066398_102211421 | 3300004268 | Tropical Forest Soil | VSVTLLADLDAFYLEHQYSGELDSAVEDDRVWVTCTCGAVINRCADDE* |
Ga0066395_102906801 | 3300004633 | Tropical Forest Soil | VTLLADLDAFYPEHQYCGELDSAVEDDRVWMACTCGAVINRCADDD* |
Ga0066678_104520922 | 3300005181 | Soil | MRFLAALDASFQEHRRCGDLTGEVEGDRVWMTCSCSAGISRSAPVEDNR* |
Ga0066388_1000035711 | 3300005332 | Tropical Forest Soil | VPLFADLDAFYLEHERCGDLDSGLDGDRVWMACSARGAVINRNADDD* |
Ga0066388_1007800883 | 3300005332 | Tropical Forest Soil | MKIYQEHGRCGELNSAVDGDRVWMSCTCGAVICRCADDD* |
Ga0066388_1022987902 | 3300005332 | Tropical Forest Soil | VTLADLDAFYLEHQYCGELDSAVEDDRVWMACTCGAVINRCADDD* |
Ga0066388_1049896452 | 3300005332 | Tropical Forest Soil | VREQRNRDLLADLYAFFQEHQYCGELDGGVDGDRVWMACACGAAINRRADDA* |
Ga0066388_1052631582 | 3300005332 | Tropical Forest Soil | VRAQRGGFLADLCAFYLEHERCGELDSAVEGDRVWIACTCGAVISRRIHDD* |
Ga0066388_1068808472 | 3300005332 | Tropical Forest Soil | VALLDALYAFFQEHRRCGDLDGDRVSMACICGAAISRRADDD* |
Ga0008090_155317712 | 3300005363 | Tropical Rainforest Soil | MLLSDLDAFYLEHERCGDLDSTVEGERVWMTCTCGAVINRCADDD* |
Ga0070708_1001863852 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLLDALYAFCQKHERCGDLDSGLDGDLVWMTCTCGAAISRNADRD* |
Ga0070708_1002701293 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVLDALYAFYQEHERCGVLDSAVDGDRVWMTCTCGAVINRCADDD* |
Ga0070707_1021477372 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVGSPAVTLLADLDAFFQEHRRCGDLDSAVEGDRVWMTCTCGAAISRNADRD* |
Ga0070699_1016277442 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDQRVPHLISDLDAFLQEHRRCGDPDAAVEGDRVWMTCTCGAVISRRVDDD* |
Ga0066698_103070812 | 3300005558 | Soil | MHLADLDAFDLEHRCCGELESGVEDDRVWMMCTCGA |
Ga0066703_100676491 | 3300005568 | Soil | QEHRYCGELESGLEGDFVWMRCTCGAVIWRHQDD* |
Ga0066905_1008934511 | 3300005713 | Tropical Forest Soil | MRSSAKPTLLAVLYAFYRDHCRCGDLDSAVEDDRVWMTCTCGAVINRSADDD* |
Ga0066903_1001643662 | 3300005764 | Tropical Forest Soil | VTLFADLDAFDLEHEHCGELDSAIEDDRVWMSCTCGAVISRCADDD* |
Ga0066903_1003237281 | 3300005764 | Tropical Forest Soil | MTLLDALYAFYLEHERCGELDSGLDGDRIWMTCTCGALINRCADDD* |
Ga0066903_1008096403 | 3300005764 | Tropical Forest Soil | VRSETLTRHRAPSSLLPVTLLEDIEAFYQEHERCGELDSAVDGDQVWMTCTCGAVINGSADDD* |
Ga0066903_1008731321 | 3300005764 | Tropical Forest Soil | TVIDALYAFFHEYERRGDLDSGVDGDRVWMACTCGAVIYRCADDD* |
Ga0066903_1010028802 | 3300005764 | Tropical Forest Soil | VLFADLDAFYLKHERCGDLDSAVEDNRVCMTCTCGAVISRRVDDE* |
Ga0066903_1015295491 | 3300005764 | Tropical Forest Soil | VRRVTSSAVTLLAALYAFYLEHQYCGDLDSAVEGDRVWMACCAVINRGADDD* |
Ga0066903_1016116913 | 3300005764 | Tropical Forest Soil | AFYQEHERCGEIDSAVEDDRVWMTCTCGAVISRCTDDD* |
Ga0066903_1016478733 | 3300005764 | Tropical Forest Soil | VHQREARMTLFTDLDAFCLEHERCGELDSVVDGDCVWMACTCGAVINRCADND* |
Ga0066903_1021827662 | 3300005764 | Tropical Forest Soil | VTLLAALHAFFQEHERCGDLDSAVDGDRVWMVCSTWGAVINRCADD* |
Ga0066903_1024374632 | 3300005764 | Tropical Forest Soil | VTLLGDLDAFYLEHERCGEIDSAVERDRVWMTCTCGAVISRRIHDD* |
Ga0066903_1030706203 | 3300005764 | Tropical Forest Soil | LTLGTVRRGPEYPDDLDAFCLEHEHCGELDSAVEGDRVWMTRTCGAVISRCTDDD* |
Ga0066903_1033709201 | 3300005764 | Tropical Forest Soil | MTLFTDLDAFYLEHQYCGELDSAVQDDRVWMTCTCGAVINRCADDDD* |
Ga0066903_1063736012 | 3300005764 | Tropical Forest Soil | VAGVTLLADLDAFYLEHQYCGELDSAVEDGRVWMTCTCGAVINRCAGDD* |
Ga0066903_1072527892 | 3300005764 | Tropical Forest Soil | MLLADLDAFVQEHERCDDLDSAVDGDRVWMACTCGAVMNRCADDD* |
Ga0066903_1087732861 | 3300005764 | Tropical Forest Soil | GPEYPDDLDAFCLEHESCGDLDSAVESDRVWMACTSGAVINRCVDDD* |
Ga0066665_103251423 | 3300006796 | Soil | MLLADLYAFYLEHRTCGELDSRVEGELVWMTCTCGAVINAAALPQGDCD |
Ga0075425_1002253182 | 3300006854 | Populus Rhizosphere | MTVLDALSAFVQEHERCGDLDSGLDGDYVWMTCTCGARIEQDADYD* |
Ga0075425_1005721953 | 3300006854 | Populus Rhizosphere | VTLLADLDAFLQEHPRCGDLDGEVEGDRVWMACTCGAVINRYADDD* |
Ga0075425_1027824191 | 3300006854 | Populus Rhizosphere | VTVLDALYAFYQEDERCGDLDSGLDGDRVWMTCTCGAVINRS |
Ga0075435_1008826521 | 3300007076 | Populus Rhizosphere | VALLADLNAFCQEHRRCGDLDSAVEGDRVWMTCTCGAVINRSADDD* |
Ga0126374_101149712 | 3300009792 | Tropical Forest Soil | VTLLADLDAFYLEHQYCGELHSAVEDDRVWMTRTCGAVINRCADDD* |
Ga0126374_103650651 | 3300009792 | Tropical Forest Soil | VTLLADLDAFYQEHERRGERGQRLDGDRVWMACTCGAVINRGADDD* |
Ga0126374_113181492 | 3300009792 | Tropical Forest Soil | VLDPRGGTLFDALYAFFQEHQRCGDLDSAVENDRVWMACTCGALINRCADDD* |
Ga0126380_102225463 | 3300010043 | Tropical Forest Soil | VTLLADLDAFYLEHQYSGELDSAVEDDRVWVTCPCGAVINRCADDE* |
Ga0126384_105278842 | 3300010046 | Tropical Forest Soil | VTLLAALYAFFLEHERCGELDSAVDGDRVGMACTWGAVINRCADDD* |
Ga0126382_100239014 | 3300010047 | Tropical Forest Soil | VSVTLLADLDAFYLEHQYSGELDSAVEDDRVWVTCPCGAVINRCADDE* |
Ga0126382_100930913 | 3300010047 | Tropical Forest Soil | VALLDALYAFYQEHQRCGDLDSRLDGDRVWMACTCGAAINRCADDD* |
Ga0126382_104358512 | 3300010047 | Tropical Forest Soil | VRGAEEGGGVTLLDALYAFFQEHRRCGDLDSGLDGDRVWVACTCGAVINRCANDD* |
Ga0126382_122362922 | 3300010047 | Tropical Forest Soil | EDRGGQAHVTLLDALYAFYQEHERRGNLDSGLDGNRVWIACTCGAAINRCAGDD* |
Ga0126373_132343942 | 3300010048 | Tropical Forest Soil | VRLLDALRAFVQEHEYCGELDSAVEGAHVWMTCTCGAVINHSADDD* |
Ga0126370_107205273 | 3300010358 | Tropical Forest Soil | VTLLEDIEAFYREHERCGELDSAVDGDRVWMTCTCGAMINRSADDD* |
Ga0126370_115164782 | 3300010358 | Tropical Forest Soil | LLDDLDALYLEHERCGELDSAVEGDRVWMTCTCGAVISRCADDD* |
Ga0126376_113854172 | 3300010359 | Tropical Forest Soil | VEDRGHHTNVTLLDALYAFYQEHERRGDLDSAVEGERVWMTCSCGAVIRRRVDDE* |
Ga0126376_126939471 | 3300010359 | Tropical Forest Soil | VALLDALYAFYQKHERWGDLDSGLDGDRVWMACTCGAVISRRVDDD* |
Ga0126376_131909401 | 3300010359 | Tropical Forest Soil | VRAQRGGLLADLYAFYLDHERCGELGSAVEDDRVWMTCTCGAVIKRCADDD* |
Ga0126372_103523642 | 3300010360 | Tropical Forest Soil | FTDLDAFYLEHQLLLELDSAVGGDRVWMTCTCGAVINRCADDD* |
Ga0126372_104198932 | 3300010360 | Tropical Forest Soil | VTLLADLDAFYQEHERRGELGQRLDGDRVWMACTCGAVINRGADDD* |
Ga0126372_105273552 | 3300010360 | Tropical Forest Soil | LVSVTLLDALYAFYQEHERCGDLDSGLDVDRVWMACTCRAVINPCADDD* |
Ga0126372_116918192 | 3300010360 | Tropical Forest Soil | VTLLADLDAFYLEHERRGDLDSGFDGDRVWMACTCGAAINRCTEDD* |
Ga0126372_120388761 | 3300010360 | Tropical Forest Soil | MTLLADLDAFYQEHERCGALDSADDGDRVWMACRCGAAINRCADDD* |
Ga0126377_105849661 | 3300010362 | Tropical Forest Soil | VTLLAVLYAFFQEHEYCGDLDSAAEDDRVWMACTCGAVINRCADDD* |
Ga0126377_116190152 | 3300010362 | Tropical Forest Soil | VTLLADLDAFYLEHQYCGELDSAVEDDRVWMACPCGAVINRCAEDE* |
Ga0126379_100601402 | 3300010366 | Tropical Forest Soil | VTLLADLDAFYPEHQYCGELDSAVEDDRVWVTCPCGAVINRCADDE* |
Ga0126381_1007192222 | 3300010376 | Tropical Forest Soil | VRDPGDRHLLDDLGALYLEHERCGELDSAVEGDRVWMTCTCGAVISRCADDD* |
Ga0126381_1043131521 | 3300010376 | Tropical Forest Soil | VTLLAALYAFYLEHQYCGDLDSAVEGDRVWMACCAVINRGADDD* |
Ga0126381_1050377802 | 3300010376 | Tropical Forest Soil | VTLLADLDAFYPEHQYCGELDSAVDGDRVWMACTCGAVINRCTADD* |
Ga0126383_101541582 | 3300010398 | Tropical Forest Soil | VGGIERQIDQAGVTLIDALYAFFLEHERCGELDSAVEDDRVWMTCTCGAPIRRRVDDD* |
Ga0126383_106123541 | 3300010398 | Tropical Forest Soil | LYAFYQEHERCGEIDSAVEDDRVWMTCTCGAVISRCTDDD* |
Ga0126383_116396572 | 3300010398 | Tropical Forest Soil | MTLLADLDAFYQEHERCGDLDSGLDGDRVWMACTCGVVINRYTDDE* |
Ga0126383_123172311 | 3300010398 | Tropical Forest Soil | MLDFDSHSVLSALYAFFQEHERCGDLDSAVDAVWMTCTCGAVISRCADDD* |
Ga0126375_102475891 | 3300012948 | Tropical Forest Soil | VTLLADLDAFYPEHQYCGELDSAVDGDRVWMTCTCGAVIKRCADD |
Ga0126375_102870811 | 3300012948 | Tropical Forest Soil | LTLLADVDAFYQEHERCGDLDSGLDGDHVWMACTCGVVISRYADED* |
Ga0126375_116601451 | 3300012948 | Tropical Forest Soil | LLDALYAFYQERERCGELDSAVENDRDWMACRCGAVINRCADDD* |
Ga0126369_101203955 | 3300012971 | Tropical Forest Soil | LASAGVTVLADLYAFYQEHERCGEIDSAVEDDRVWMTCTCGAVISRCTDDD* |
Ga0126369_119627821 | 3300012971 | Tropical Forest Soil | VTSSAVTLLAALYAFYLEHQYCGDLDSAVEGDRVWMACCAVINRRADDD* |
Ga0132258_103930116 | 3300015371 | Arabidopsis Rhizosphere | MTLLDDLHAFVQDRERCGDLDSAVEDDRVWMTRTCGAVINRSADDG* |
Ga0132255_1014300741 | 3300015374 | Arabidopsis Rhizosphere | KSLLADLAAFLQEHSRRGDLDSGLDGDRVWMACSTRGAVINRCTDDD* |
Ga0182041_112407132 | 3300016294 | Soil | DRAGVTLIAALYTFYQEHERCGELDSAVDGDRVWMACTCGAVINRCADDD |
Ga0182032_117646461 | 3300016357 | Soil | ADLDAFFQEHERCGELDSAVDGDRVWMRCTCGAVINRCADDD |
Ga0182034_104893711 | 3300016371 | Soil | LVIAAPGSLLPVTLLDSLYAFYQEHERCGELDSAVEGDRVWMACTCGAVINRSANDD |
Ga0182037_101930972 | 3300016404 | Soil | YAFREHHCCGDLDGGVDGDRVWMACIACGAVINRCADDE |
Ga0182037_106150272 | 3300016404 | Soil | VTLLAALHAFSQEHERCGELDSAVDGDRVWMSCTCGAVINRCADDD |
Ga0207684_105512941 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVLDALYAFYQEHERCGVLDSAVDGDRVWMTCTCGAVINRCADAD |
Ga0207646_102180402 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVLDALYAFYQEHERCGVLDSAVDGDRVWMTCTCGAVINRCADDD |
Ga0207669_104973612 | 3300025937 | Miscanthus Rhizosphere | VVSLLDDLHAFVQNHEHCGDLDSAVEGERVWMTCTCGAVINRSADDD |
Ga0209684_10053752 | 3300027527 | Tropical Forest Soil | LADLYAFYQEHERCGDLDSGLDVDRVWMACTCRAVINPCADDD |
Ga0207428_101682184 | 3300027907 | Populus Rhizosphere | GAALEAFSLEHEYCGELDSAVENDHVWMTCTCGAVINRPADHD |
Ga0318534_101262101 | 3300031544 | Soil | VTLLAALHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0318541_101509152 | 3300031545 | Soil | RLIVASGSFVGVTLLAALHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0318538_103739852 | 3300031546 | Soil | LAALHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0310915_106227021 | 3300031573 | Soil | VPLFADLDAFFQEHERCGELDSAVDGDRVWMRCTCGAVINRCADDD |
Ga0310915_112806421 | 3300031573 | Soil | MSDLDAFFLEQERCGELDSADRVWMMCTCGAVISRCADDD |
Ga0318555_101924802 | 3300031640 | Soil | LVIAAPGSLLPVTLLNALYAFSQEHERCGELDSAVDGDRVWMACTCGAVISRCADDD |
Ga0318542_101135281 | 3300031668 | Soil | SSVAGVTLLADLDAFYREHECCGELDSAVEDDRVWMTCTCGAVISRCAHDD |
Ga0318561_104652752 | 3300031679 | Soil | VPPLDTLYALYLEHEHCGELQSAVEDDRVWMACTCGAVINRSADDD |
Ga0306917_103683202 | 3300031719 | Soil | VTLLDALYAFFQEHECCGDLDSGLDGDHGWMTCTRGAVINRSADDD |
Ga0307469_102316104 | 3300031720 | Hardwood Forest Soil | VALLADPDAYYLEHEPCDAIDSAVETNRVWMTCTCGAVTNRCADDD |
Ga0307468_1000617842 | 3300031740 | Hardwood Forest Soil | VTLLADLDAFFQEHPRCGDPDSAVEGDRVWMTCTCGAVIGTARPDDD |
Ga0307468_1018076881 | 3300031740 | Hardwood Forest Soil | VTVLLLPPAFVQEHERCGDLDSAVEGNRVWMICTCGAVISRSADDD |
Ga0318502_109585842 | 3300031747 | Soil | LHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0318509_100818713 | 3300031768 | Soil | VTLLAALHAFSQEHERCGELDSAVDGDRVWMACGAVIN |
Ga0318498_101572052 | 3300031778 | Soil | LVIAAPGSLLPVTLLNALYAFSQEHERCGDLDSAVDGDHVWMVCSAAR |
Ga0318566_100481374 | 3300031779 | Soil | VALLDALYAFYQEHERCGDLDSGLEGDRVWMACSASINRCADDD |
Ga0318576_100816151 | 3300031796 | Soil | RRGRGLARRPLFFQEHERCGELDSAVDGDRVWMACTCGAVISRCADDD |
Ga0318523_104596572 | 3300031798 | Soil | FYLEPERCGDLDSAVDGDRVWMTCTCGAVINRCADDD |
Ga0307473_102781581 | 3300031820 | Hardwood Forest Soil | MLLAALYAFFQEHERCGDLDRGLDGDRVWKACTCGAVINRCADDD |
Ga0310917_108803701 | 3300031833 | Soil | SLLPVTLLNALYAFSQEHERCGELDSAVDGDRVWMACTCGAVISRCADDD |
Ga0318512_103872802 | 3300031846 | Soil | VALLDALYAFCQEHERRGDRDSAVDGDRVWMACGAVINGCADDE |
Ga0306919_100262426 | 3300031879 | Soil | VTLLADLDAFYREHECCGELDSAVEDDRVWMTCTCGAVISRCAHDD |
Ga0318544_103854031 | 3300031880 | Soil | VTLLADLDAFYREHECCGELDSAVEDDRVWMTCTCGAVISRC |
Ga0306925_116272852 | 3300031890 | Soil | RPLFFQEHERCGELDSAVDGDRVWMACTCGAVINRCADDD |
Ga0306925_120851411 | 3300031890 | Soil | YAFYQEPERCGELDSAVDGDRVWMACSACGAVINRCADDD |
Ga0306923_101600795 | 3300031910 | Soil | GRGLARRPLFFQEHERCGELDSAVDGDRVWMACTCGAVINRCADDD |
Ga0310912_107343181 | 3300031941 | Soil | SSGGRLDALYAFYQEHDRCGDLDSGLDGDRVWMPCGACGAVINRGADDD |
Ga0310912_110408121 | 3300031941 | Soil | VTLLAALHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADD |
Ga0310913_109121482 | 3300031945 | Soil | VTLLADLDAFYLEHQYCGELDSAVAGDRVWMACTCGTVINRCAD |
Ga0306926_124025201 | 3300031954 | Soil | VTLLDALYAFYQEHERCGDLDSGFDGDRVWMACNACGAVINRCAHDDQ |
Ga0318549_101331682 | 3300032041 | Soil | ALYAFREHHCCGDLDGGVDGDRVWMACIACGAVINRCADDE |
Ga0318556_107247281 | 3300032043 | Soil | LYAFYQEHDRCGDLDSGLDGDRVWMPCGACGAVINRGADDD |
Ga0318506_104727902 | 3300032052 | Soil | VTLLAALHAFSQEHERCGELDSAVDGDRVWMACGAVI |
Ga0318575_101373981 | 3300032055 | Soil | LLAALHAFSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0318504_105943242 | 3300032063 | Soil | LYAFCQEHERRGDRDSAVDGDRVWMACTCGAAINRCADDD |
Ga0318510_101598792 | 3300032064 | Soil | FSQEHERCGELDSAVDGDRVWMACGAVINGCADDE |
Ga0318513_104655771 | 3300032065 | Soil | VTLLNALYAFSQEHERCGELDSAVDGDRVWMACTCGAVIS |
Ga0306924_106391221 | 3300032076 | Soil | RIIGAPRTCFSVPLFADLDAFFQEHERCGELDSAVDGDRVWMRCTCGAVINRCADDD |
Ga0318577_103108112 | 3300032091 | Soil | VTLLADLDAFYREHECCGELDSAVEDDRVWMTCTCGAV |
Ga0307470_107200471 | 3300032174 | Hardwood Forest Soil | VTLLADLDAFFQEHPRCGDPDSAVEGDRVWMTCTCGAVIGTAR |
Ga0307471_1018669151 | 3300032180 | Hardwood Forest Soil | VTVLLLPPAFVQEHERCGDLDSAVEGNRVWMICTCGAVISRSADDE |
Ga0307472_1003799612 | 3300032205 | Hardwood Forest Soil | VALLADLNAFFQEHRRCGDLDSAVEGDRAWMTCTCGAVISRSADDD |
Ga0307472_1007470972 | 3300032205 | Hardwood Forest Soil | GAEESRGVPLLTDLGAFYLEHEHCGDLDSAVERDRVWMTYTCGAVITRYADDDD |
Ga0306920_1018408361 | 3300032261 | Soil | YAFFQEHECCGDLDSGLDGDHGWMTCTRGAVINRSADDD |
Ga0306920_1031360381 | 3300032261 | Soil | VPLFADLDAFFQEHERCGELDSAVDGDRVWMRCTCGAVINRCAD |
Ga0335085_110797711 | 3300032770 | Soil | MTLLDDLHAFFQEHARCGDLDNGLDGDRVWVACSACGAAINRCADDD |
Ga0318519_103561151 | 3300033290 | Soil | LYALYLEHEHCGELQSAVEDDRVWMACTCGAVINRSADDD |
⦗Top⦘ |