| Basic Information | |
|---|---|
| Family ID | F058832 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VRRPLPRLHAITDERIARRADLDDVARDLAAGGGANLAFHARG |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.39 % |
| % of genes near scaffold ends (potentially truncated) | 97.76 % |
| % of genes from short scaffolds (< 2000 bps) | 82.84 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.761 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.090 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.522 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 0.00% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF02911 | Formyl_trans_C | 82.09 |
| PF01327 | Pep_deformylase | 9.70 |
| PF02547 | Queuosine_synth | 2.24 |
| PF01702 | TGT | 2.24 |
| PF02699 | YajC | 1.49 |
| PF05496 | RuvB_N | 0.75 |
| PF04963 | Sigma54_CBD | 0.75 |
| PF07499 | RuvA_C | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 82.09 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 9.70 |
| COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 2.24 |
| COG0809 | S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase) | Translation, ribosomal structure and biogenesis [J] | 2.24 |
| COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 2.24 |
| COG1862 | Protein translocase subunit YajC | Intracellular trafficking, secretion, and vesicular transport [U] | 1.49 |
| COG0632 | Holliday junction resolvasome RuvABC DNA-binding subunit | Replication, recombination and repair [L] | 0.75 |
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.75 |
| COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.76 % |
| Unclassified | root | N/A | 2.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1039570 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300002911|JGI25390J43892_10033063 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300002912|JGI25386J43895_10049117 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300002912|JGI25386J43895_10176766 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004019|Ga0055439_10003554 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
| 3300004463|Ga0063356_103587909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 668 | Open in IMG/M |
| 3300005174|Ga0066680_10906289 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005177|Ga0066690_10188006 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300005180|Ga0066685_10095885 | All Organisms → cellular organisms → Bacteria | 1975 | Open in IMG/M |
| 3300005184|Ga0066671_10057006 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300005187|Ga0066675_11312454 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005450|Ga0066682_10130253 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300005450|Ga0066682_10596155 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
| 3300005471|Ga0070698_100997887 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005536|Ga0070697_100640366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 936 | Open in IMG/M |
| 3300005540|Ga0066697_10710750 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005545|Ga0070695_100109273 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300005552|Ga0066701_10316664 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300005553|Ga0066695_10201956 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300005560|Ga0066670_10228792 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005560|Ga0066670_10830673 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005598|Ga0066706_11204559 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005617|Ga0068859_100340092 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300005713|Ga0066905_101052799 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 720 | Open in IMG/M |
| 3300006031|Ga0066651_10217029 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300006034|Ga0066656_10033182 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300006046|Ga0066652_100502262 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300006797|Ga0066659_10196275 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300006797|Ga0066659_10370537 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300006800|Ga0066660_10893692 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006800|Ga0066660_11476821 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006845|Ga0075421_100767149 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300006845|Ga0075421_101573281 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300006853|Ga0075420_101772758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300006854|Ga0075425_102231277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
| 3300006904|Ga0075424_100020993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6695 | Open in IMG/M |
| 3300006914|Ga0075436_101304423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300007076|Ga0075435_100244607 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300007265|Ga0099794_10105509 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300007265|Ga0099794_10777264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300009012|Ga0066710_102079677 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300009012|Ga0066710_102888531 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300009089|Ga0099828_10168767 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300009089|Ga0099828_11001011 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009089|Ga0099828_11152228 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009090|Ga0099827_10699071 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300009137|Ga0066709_104625849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 503 | Open in IMG/M |
| 3300010159|Ga0099796_10366946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 624 | Open in IMG/M |
| 3300010301|Ga0134070_10066822 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300010304|Ga0134088_10252991 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300010333|Ga0134080_10021564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2392 | Open in IMG/M |
| 3300010333|Ga0134080_10172423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 926 | Open in IMG/M |
| 3300010333|Ga0134080_10312486 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300010333|Ga0134080_10583489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300010335|Ga0134063_10067669 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300010337|Ga0134062_10003892 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 5276 | Open in IMG/M |
| 3300010400|Ga0134122_12690861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300011269|Ga0137392_10870257 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300011270|Ga0137391_11345392 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300011270|Ga0137391_11483088 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300012096|Ga0137389_10327339 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300012096|Ga0137389_10514652 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300012198|Ga0137364_10000879 | All Organisms → cellular organisms → Bacteria | 13250 | Open in IMG/M |
| 3300012199|Ga0137383_11281553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300012205|Ga0137362_10950067 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012206|Ga0137380_10347670 | All Organisms → cellular organisms → Bacteria | 1323 | Open in IMG/M |
| 3300012206|Ga0137380_10491197 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300012210|Ga0137378_10014735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6802 | Open in IMG/M |
| 3300012210|Ga0137378_10978693 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012211|Ga0137377_10132193 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300012211|Ga0137377_10825906 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300012211|Ga0137377_11343290 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012211|Ga0137377_11945891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300012349|Ga0137387_10459852 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300012356|Ga0137371_10702565 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
| 3300012359|Ga0137385_10428576 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012360|Ga0137375_11278028 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012532|Ga0137373_10021450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6447 | Open in IMG/M |
| 3300012917|Ga0137395_10423565 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012917|Ga0137395_10537238 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300012917|Ga0137395_10998382 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012918|Ga0137396_10038135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3229 | Open in IMG/M |
| 3300012922|Ga0137394_10044083 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
| 3300012922|Ga0137394_10073767 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300012923|Ga0137359_10074517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2972 | Open in IMG/M |
| 3300012925|Ga0137419_10248058 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300012929|Ga0137404_11666831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300012930|Ga0137407_10813202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_70_11 | 883 | Open in IMG/M |
| 3300012972|Ga0134077_10575157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300014154|Ga0134075_10022275 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300015054|Ga0137420_1035757 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300015358|Ga0134089_10090367 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300015371|Ga0132258_10256711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4276 | Open in IMG/M |
| 3300017657|Ga0134074_1384727 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018071|Ga0184618_10177563 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300018071|Ga0184618_10177739 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
| 3300018078|Ga0184612_10448161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_70_11 | 642 | Open in IMG/M |
| 3300018079|Ga0184627_10162823 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300018433|Ga0066667_11888169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300019255|Ga0184643_1466260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4663 | Open in IMG/M |
| 3300019866|Ga0193756_1016419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1012 | Open in IMG/M |
| 3300020170|Ga0179594_10427281 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300021080|Ga0210382_10078610 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300021080|Ga0210382_10200217 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300021344|Ga0193719_10351711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300024187|Ga0247672_1034521 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300024330|Ga0137417_1101914 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300025922|Ga0207646_11632074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 555 | Open in IMG/M |
| 3300026089|Ga0207648_12249872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300026285|Ga0209438_1204280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300026300|Ga0209027_1066342 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300026301|Ga0209238_1029455 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300026306|Ga0209468_1024713 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300026307|Ga0209469_1142771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 533 | Open in IMG/M |
| 3300026310|Ga0209239_1214796 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026310|Ga0209239_1216101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300026328|Ga0209802_1071226 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300026537|Ga0209157_1147738 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300026540|Ga0209376_1310772 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026540|Ga0209376_1341481 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300026547|Ga0209156_10078990 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300026547|Ga0209156_10184278 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300026547|Ga0209156_10282891 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300026555|Ga0179593_1285088 | All Organisms → cellular organisms → Bacteria | 3077 | Open in IMG/M |
| 3300027383|Ga0209213_1018275 | Not Available | 1304 | Open in IMG/M |
| 3300028145|Ga0247663_1088249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300028536|Ga0137415_11159294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300028711|Ga0307293_10210459 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300028819|Ga0307296_10310326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_70_11 | 861 | Open in IMG/M |
| 3300031720|Ga0307469_11684605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
| 3300032954|Ga0335083_10683052 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300033808|Ga0314867_132007 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.72% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.99% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.75% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10395702 | 3300002557 | Grasslands Soil | LPRLHAITDERIARRRDLDAVARALAEGGGSDFAFHARGRELT |
| JGI25390J43892_100330631 | 3300002911 | Grasslands Soil | VTRAGRGALPRLHAVTDEXIAKRPNLDDVARALVAGGGERLALHARGRGLSGL |
| JGI25386J43895_100491173 | 3300002912 | Grasslands Soil | VKPPLPRLHAITDERIARRADLADVASALATAAGGDVALHA |
| JGI25386J43895_101767662 | 3300002912 | Grasslands Soil | VRSLPALPRLHAITDERIARRPDLDTVAQQLAAGGREHLAF |
| Ga0055439_100035545 | 3300004019 | Natural And Restored Wetlands | VRPAFPKLHAVTDERIARRPDVEQISAALARGAPDLALHARGHT |
| Ga0063356_1035879092 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VKPALPRLHAITDERIARRADLSTVARALADGGGSDLALHARGRGLSGLEHY |
| Ga0066680_109062891 | 3300005174 | Soil | MRPPLPRLHAITDERIARRPELGDVATTLAAGGGADLALHA |
| Ga0066690_101880061 | 3300005177 | Soil | VRPPLPRLHAVTDERVARRADLHVVAAELAAGAEQQLALHARGHD |
| Ga0066685_100958854 | 3300005180 | Soil | MRAGGALPRLHAITDERIARRSDIDGIATALSEGGGRELAIHARGRALTG |
| Ga0066671_100570064 | 3300005184 | Soil | VTSPLPRLHAITDERIARRPDLDSVAAALAEGGGSDLALHARGRQLTGL |
| Ga0066675_113124542 | 3300005187 | Soil | VTRAAGGALPRLHAITDDRIARRPDLDDVARALAAGGGEWLAFHA |
| Ga0066682_101302531 | 3300005450 | Soil | VKPPLPRLHAITDERIARRADLGAVARQLGAAGGDQLAFHAR |
| Ga0066682_105961551 | 3300005450 | Soil | MRPLLPRLHAITDERIARRPDLDLIAAALAQGGGSDLAFHARG |
| Ga0070698_1009978872 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKALPALPRLHAVTDERIARRPDLDRVAQQLTTGGREDLAFHARGRALSGL |
| Ga0070697_1006403662 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPALPRLHAITDERIARRADLDLLLDDLAGIELAAHARGRSLSGREHY |
| Ga0066697_107107501 | 3300005540 | Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGGRED |
| Ga0070695_1001092734 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTPLPRLHAITDERIARRGDLDDIARELATGGGSQLAFHARGRQL |
| Ga0066701_103166641 | 3300005552 | Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGGCEDLAFHAR |
| Ga0066695_102019563 | 3300005553 | Soil | VTHAAPLPRLHAITDEPIARRSDLVEVAGQLAAGGGEDLALHARGH |
| Ga0066670_102287921 | 3300005560 | Soil | VTSPLPRLHAITDERIARRPDLDSVAAALAEGGGSDLALHARG |
| Ga0066670_108306731 | 3300005560 | Soil | VTHAAPLPRLHAITDERIARRSDLDEVAGQLAAGGGEDLALHARG |
| Ga0066706_112045592 | 3300005598 | Soil | VKPPLPRLHAITDERIARRADLGAVARQLGAAGGDQLAFHARGRALSGLEH |
| Ga0068859_1003400921 | 3300005617 | Switchgrass Rhizosphere | VRPPLPRLHAITDERIARRPDLEDIAAELAKGGGSQLAFHARGRELSGHEH |
| Ga0066905_1010527992 | 3300005713 | Tropical Forest Soil | VRAPLPRLHAITDERTARRPDLDAVAGALADGGGSNLAFHARGRGLTGREHYD |
| Ga0066651_102170291 | 3300006031 | Soil | VRRPLPRLHAITDERIARRADLDEVARELAAGGGANLA |
| Ga0066656_100331821 | 3300006034 | Soil | VRPPLPRLHAVTDERIARRADLDDLARELATGGGADLAFH |
| Ga0066652_1005022622 | 3300006046 | Soil | VNEGLPRLHAITDERIARRGDLDMTATAIAAGAPGRVAVHARGRTLSGREHFTL |
| Ga0066659_101962753 | 3300006797 | Soil | VTHAAPLPRLHAITDEPIARRADLDEIAAALASGGREHLALHARGRALS |
| Ga0066659_103705371 | 3300006797 | Soil | VTHAAPLPRLHAITDERIARRSDLDTVAAALASGG |
| Ga0066660_108936921 | 3300006800 | Soil | VTHAAPLPRLHAITDEPIARRSDLVEVAGQLAAGGGEDLALHARGHTLTG |
| Ga0066660_114768211 | 3300006800 | Soil | VTRAGRGVLPRLHAITDERIARRADLDEVARALAAGGGDPLAFHARGRTLSGLEH |
| Ga0075421_1007671492 | 3300006845 | Populus Rhizosphere | VRPPLPRLHAITDERIARRPDLEDVARALASAGGANLALHARGRGLSG |
| Ga0075421_1015732812 | 3300006845 | Populus Rhizosphere | MRPRLPRLHAITDERVARQPNLGDRARGLASAGGSNLALHARGRR |
| Ga0075420_1017727582 | 3300006853 | Populus Rhizosphere | VRPALPRLHAITDERVARRTDLHEVARELATAGGANLALHARG |
| Ga0075425_1022312771 | 3300006854 | Populus Rhizosphere | VRQPLPRLHAITDERIARRVDLDDVARELAKGGGSQLAFHARGRGLSGREHY |
| Ga0075424_10002099310 | 3300006904 | Populus Rhizosphere | VKALPALPRLHAVTDERIARRPDLGTVAQQLAAGGGEHLAFHARGRALSGLEHF |
| Ga0075424_1002123635 | 3300006904 | Populus Rhizosphere | VRRALPRLHAITDERIARRTDLAEILAALTDIPLAAHARGHL |
| Ga0075436_1013044231 | 3300006914 | Populus Rhizosphere | VKPTLPRLHAITDDAVARRPDLDAIARGLSAGGGEHLAFHARGHGLSGREVF |
| Ga0075435_1002446071 | 3300007076 | Populus Rhizosphere | VRQPLPRLHAITDERIARRADLDDVARELAKGGGSQLAFHARGRGLSGR |
| Ga0099794_101055093 | 3300007265 | Vadose Zone Soil | VRSPLPRLHAITDERIARRADLPDIARELAKGGGSELAFHARGRSLSGRE |
| Ga0099794_107772642 | 3300007265 | Vadose Zone Soil | VRQALPRLHAITDERIARRADLPDIARELAKGGGSELAFHA |
| Ga0066710_1020796771 | 3300009012 | Grasslands Soil | VTHVAPLPRLHAITDERIARRADLDEITRQLAAGGAGELASHARVRG |
| Ga0066710_1028885311 | 3300009012 | Grasslands Soil | LRPPLPRLHAITDERIARRADLDAVARALADGGGSDLAF |
| Ga0099828_101687674 | 3300009089 | Vadose Zone Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLTAGGREDLAF |
| Ga0099828_110010111 | 3300009089 | Vadose Zone Soil | VRPALPRLHAITDERIARRPDLAAIIDELAAGGGPELAFHA |
| Ga0099828_111522281 | 3300009089 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSIVAQQLAAGGREQLAFHARGRALSG |
| Ga0099827_106990711 | 3300009090 | Vadose Zone Soil | VKPPLPRLHAITDERIARRADLGDVATALATAAGVD |
| Ga0066709_1046258491 | 3300009137 | Grasslands Soil | VTQAGRGARGALPRLHAITDERIARRPDLVDSARALATGGGERLAFHARGRA |
| Ga0075423_103386081 | 3300009162 | Populus Rhizosphere | VRRALPRLHAITDERIARRVDVDDILDALAGVDMAAHARGHALSG |
| Ga0099796_103669462 | 3300010159 | Vadose Zone Soil | LHAITDERIARRPDLDLIAAALAQGGGSDPAFHARGR |
| Ga0134070_100668221 | 3300010301 | Grasslands Soil | VRSPLPRLHAITDERIARRPDLGDIARELAAGGGADLA* |
| Ga0134088_102529911 | 3300010304 | Grasslands Soil | VKRGAKTAGGTPLPRLHAITDERIARRADLDEVARELAAGGGDGLAFHARG |
| Ga0134080_100215641 | 3300010333 | Grasslands Soil | VKSLPALPRLHAITDERIARRPNLGEITRQLAAGAGPELALHARGRALSGLEHY |
| Ga0134080_101724232 | 3300010333 | Grasslands Soil | MRPPLPRLHAITDERIARRPDLDLIAAALAQGGGSDLAFHARGR |
| Ga0134080_103124861 | 3300010333 | Grasslands Soil | VTHATPLPRLHAITDERIARRADLDEIARQLAAGGGEH |
| Ga0134080_105834892 | 3300010333 | Grasslands Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGGCEDLAFHARGRALSGLE |
| Ga0134063_100676693 | 3300010335 | Grasslands Soil | VKSLPALPRLHAITDERIARRPDLGEITRLLAAGAG |
| Ga0134062_100038921 | 3300010337 | Grasslands Soil | VKALPALPRLHAITDERIARRPDLGEITRLLAAGAG |
| Ga0134122_126908611 | 3300010400 | Terrestrial Soil | VRAPLPRLHAITDERIARRADLPEVARQLAAAGGANL |
| Ga0137392_108702571 | 3300011269 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSIVAQQLAAGGREQLAFH |
| Ga0137391_113453922 | 3300011270 | Vadose Zone Soil | VKPPLPRVHAVTDERVARRADLDRVAADLAAGGGAALA |
| Ga0137391_114830882 | 3300011270 | Vadose Zone Soil | VRPALPRLHAITDERIARRADLPEIARELAKGGGSQLAFHA |
| Ga0137389_103273393 | 3300012096 | Vadose Zone Soil | MRPALPRLHAITDERVARRPDLDEIAHDLAAGGGAELAFHARGH |
| Ga0137389_105146521 | 3300012096 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSMVAQQLAAGGR |
| Ga0137364_1000087917 | 3300012198 | Vadose Zone Soil | VRAALPRLHAITDERIARRSDLDAVARALSDGGGSDLAIHARG |
| Ga0137383_112815532 | 3300012199 | Vadose Zone Soil | VRAALPRLHAITDERIARRSDLDAVARALSDGGGSDLAIHARGRALT |
| Ga0137362_109500671 | 3300012205 | Vadose Zone Soil | VKSVPVLPRLHAITDERIARRPDLGEVTRQLAAGAGSELALHA |
| Ga0137380_103476703 | 3300012206 | Vadose Zone Soil | VRAALPRLHAITDERIARRSDLDAVARALSDGGGSDLAIHARGRELTGLEH |
| Ga0137380_104911971 | 3300012206 | Vadose Zone Soil | VRPPLPRLHAITDERIARRADLPEVARELAAGGGAAMAF |
| Ga0137378_100147351 | 3300012210 | Vadose Zone Soil | VKPPLPRLHAITDERIARRADLGAVARQLGAAGGDQLAFHARGRTLSG |
| Ga0137378_109786932 | 3300012210 | Vadose Zone Soil | VKTLPALPRLHAVTDERIARRPDLGEITRQLVAGAGSELA |
| Ga0137377_101321935 | 3300012211 | Vadose Zone Soil | VTHAAPLPRLHAITDERIARRSDLDTVAAALASGGREQLAFHARGHTL |
| Ga0137377_108259062 | 3300012211 | Vadose Zone Soil | VRTPLPRLHAITDERIARRSDIDAIAVALAQSGGSDLAFHA |
| Ga0137377_113432901 | 3300012211 | Vadose Zone Soil | VKSLPALPRLHAITDERIARRPDLGEITRQLAAGAGSELALHAR |
| Ga0137377_119458911 | 3300012211 | Vadose Zone Soil | VRQPLPRLHAITDERIARRVDLDLIAAALAEGGGSDLAFHARG |
| Ga0137387_104598522 | 3300012349 | Vadose Zone Soil | VKSVPVLPRLHAITDERIARRPDLSTVAQQLAVGGG |
| Ga0137371_107025651 | 3300012356 | Vadose Zone Soil | LHAITDERIARRPDIDVVARALAEGGGLDLAFHARGRELTGL |
| Ga0137385_104285762 | 3300012359 | Vadose Zone Soil | VRPPLPRLHAITDERIARRPDLPDIARELAAGAGEHLAFHARG |
| Ga0137375_112780282 | 3300012360 | Vadose Zone Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGGREDLAFHARGRALSGLEH |
| Ga0137373_100214501 | 3300012532 | Vadose Zone Soil | VRAALPRLHAITDERIARRSDLDAVARALSDGGGSDLAIHARGR |
| Ga0137395_104235652 | 3300012917 | Vadose Zone Soil | VKPPLPRVHAVTDERVARRADLDRVAADLAAGGGAALAFHARG |
| Ga0137395_105372381 | 3300012917 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSIVAQQLAAGGREQLAFHARGR |
| Ga0137395_109983822 | 3300012917 | Vadose Zone Soil | VKPPLPRLHAITDERIARRAALPDVARELAAGGEAAMAFHARG |
| Ga0137396_100381351 | 3300012918 | Vadose Zone Soil | VKPPLPRLHAITDERVARRADLADVASALAAGGGADLALH |
| Ga0137394_100440831 | 3300012922 | Vadose Zone Soil | LPRIHAITDERIARRGDLDSIATALAEGGGADVALHARGRALTGAEHYDLAL |
| Ga0137394_100737671 | 3300012922 | Vadose Zone Soil | LHAITDERIARRPDLDLIAAALAQGGGSELAFHAR |
| Ga0137359_100745175 | 3300012923 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSIVAQQLAAGGREQLAFHARGRALSGLEHF |
| Ga0137419_102480583 | 3300012925 | Vadose Zone Soil | VRQPLPRLHAITDERIARRADLPDIARELAKGGGSELAFHA |
| Ga0137404_116668311 | 3300012929 | Vadose Zone Soil | VRPPLPRLHAITDERIARRPDLDVIAAALAVGGGTELAFHARGHKLTG |
| Ga0137407_108132021 | 3300012930 | Vadose Zone Soil | VRPPLPRLHAVTDERIARRADLDDTARRLAEVGGANLALHARGRNLTG |
| Ga0134077_105751572 | 3300012972 | Grasslands Soil | VRPPLPRLHAVTDERIARRADLDDAARQLAEVGGANLALHA |
| Ga0134075_100222755 | 3300014154 | Grasslands Soil | VTHATPLPRLHAITDERIARRADLDEIARQLAAGGGEQLAFHARG |
| Ga0137420_10357571 | 3300015054 | Vadose Zone Soil | VRAVLPRLHAITDERIARRSDFDTVASALADGGGADLAIHARGRELTGF |
| Ga0134089_100903671 | 3300015358 | Grasslands Soil | VKPPVPRLHAIIDERIARRADLGAVARQLAAAGGEELA |
| Ga0132258_102567111 | 3300015371 | Arabidopsis Rhizosphere | VRPPLPRLHAITDERTARRSDLRDVARELAAGGGS |
| Ga0134074_13847271 | 3300017657 | Grasslands Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGG |
| Ga0184618_101775632 | 3300018071 | Groundwater Sediment | MRPPLPRLHAITDERIARRPDVDVIARALADGGGSDLAFHARGRELTG |
| Ga0184618_101777392 | 3300018071 | Groundwater Sediment | MRPALPRLHAITDERIARRPDVDVIARALADGGGSDLAFHARGRELTG |
| Ga0184612_104481612 | 3300018078 | Groundwater Sediment | VRPPLPRLHAITDERIARRADLHEVARELARSGGANLALH |
| Ga0184627_101628231 | 3300018079 | Groundwater Sediment | VKPPLPRLHAVTDERIARRADLDLIVRQLATAGPALT |
| Ga0066667_118881691 | 3300018433 | Grasslands Soil | VRAALPRLHAITDERIARRSDLDAVARALSDGGGSDLAIHA |
| Ga0184643_14662607 | 3300019255 | Groundwater Sediment | VRPALPRLHAITDERIARRGDLDEVARELAIAGGANLALHARG |
| Ga0193756_10164191 | 3300019866 | Soil | VKSVPALPRLHAITDERIARRPDLGEIAQRLALGGGDRMAFHARGRALSGLE |
| Ga0179594_104272811 | 3300020170 | Vadose Zone Soil | VNEGLPRLHAITDERIARRRDLDVTATAIAAGAPGRVAVHARGRTLSGRE |
| Ga0210382_100786101 | 3300021080 | Groundwater Sediment | MRPALPRLHAITDERIARRPDVDVIARALADGGGSDLAFHARGR |
| Ga0210382_102002171 | 3300021080 | Groundwater Sediment | VKSVPALPRLHAITDERIARRPDVGEIAQRLALGGGDRM |
| Ga0193719_103517111 | 3300021344 | Soil | VRPPLPRLHAITDERIARRPDLDLIATALAMGGGTELAFHARGHTLTGLEQFE |
| Ga0247672_10345212 | 3300024187 | Soil | VRPPLPRLHAITDGPIARRTDIETIARALADGGGSDLAIH |
| Ga0137417_11019143 | 3300024330 | Vadose Zone Soil | VRQPLPRLHAITDERIARRADLPDIARELGKGGGSELAFHARGRSLSGREH |
| Ga0207646_116320741 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPPLPRLHAVTDERIARRADLDDTARQLAEVGGANLALHARGRAL |
| Ga0207648_122498722 | 3300026089 | Miscanthus Rhizosphere | VRPPLPRLHAITDERIARRPDLESIAAELAKGGGSQLAFH |
| Ga0209438_12042802 | 3300026285 | Grasslands Soil | MRPSLPRLHAITDERIARRPDLDLIAAALAQGGGSDLAFH |
| Ga0209027_10663421 | 3300026300 | Grasslands Soil | VTHAAPLPRLHAITDERIARRADLDEITRQLAAGGAA |
| Ga0209238_10294551 | 3300026301 | Grasslands Soil | VRRPLPRLHAITDERIARRADLDDVARDLAAGGGANLAFHARG |
| Ga0209468_10247131 | 3300026306 | Soil | MRPPLPRLHAITDERIARRPDLDLIAAALAQGGGSDLAFHAR |
| Ga0209469_11427711 | 3300026307 | Soil | VKALLALPRLHAVTDERIARRPDLDRVAQQLAAGGCEDLAFHARGRALSGLEH |
| Ga0209239_12147961 | 3300026310 | Grasslands Soil | VTHAAPLPRLHAITDERIARRADLDEITRQLAAGGAAELALHARGRGLSGLEHY |
| Ga0209239_12161011 | 3300026310 | Grasslands Soil | VKPALARLHAITDERIARRPDLDLIATALAEGGGSDL |
| Ga0209802_10712263 | 3300026328 | Soil | VRSLPALPRLHAITDERIARRPDLDTVAQQLAAGGREHLAFHARG |
| Ga0209157_11477381 | 3300026537 | Soil | VRQPLPRLHAITDERIARRADLPDIARELAKGGGSELAF |
| Ga0209376_13107722 | 3300026540 | Soil | VTHAAPLPRLHAITDERIARRADLDEVARQLAAGGGED |
| Ga0209376_13414812 | 3300026540 | Soil | VKALPALPRLHAVTDERIARRPDLDRVAQQLAAGGCEDLAFH |
| Ga0209156_100789903 | 3300026547 | Soil | LPRLHAITDERIARRRDLDAVARALAEGGGSDFAFHARGRELTGLEHY |
| Ga0209156_101842781 | 3300026547 | Soil | VTSPLPRLHAITDERIARRPDLDSVAAALAEGGGSDLA |
| Ga0209156_102828912 | 3300026547 | Soil | LHAITDERIARRADLDDIARQLAAGGSGDLALHARGRALS |
| Ga0179593_12850887 | 3300026555 | Vadose Zone Soil | VKSLPTLPRLHAITDERIARRPDLSIVAQQLAAGGREQLAFHARGRALS |
| Ga0209213_10182751 | 3300027383 | Forest Soil | VTSVPTLPRLHAITDERIARRPDLERVAQQLASGGGEQLAFHARGRALSGL |
| Ga0247663_10882491 | 3300028145 | Soil | VRPPLPRLHAITDERIARRPDLEDIAAELAKGGGSQLAFH |
| Ga0137415_111592941 | 3300028536 | Vadose Zone Soil | VRPPLPRLHAITDERIARRPDLDLIAAALAKGGGSDL |
| Ga0307293_102104591 | 3300028711 | Soil | VRPALPRLHAITDERIARRGDLDEVARELAIAGGANLALHTRGR |
| Ga0307296_103103261 | 3300028819 | Soil | VRAPLPRLHAITDERIARRADLDHVARALSSAGGANLALHARGRALSGAEHYD |
| Ga0307469_116846051 | 3300031720 | Hardwood Forest Soil | VNTPQPRLHAITDERIARRGDLEEIARELAKGGGSDLAFHARGRQL |
| Ga0335083_106830521 | 3300032954 | Soil | VTAARIPLPRLHAVTDERITRLPDLDDRARALGAAGAALHARGH |
| Ga0314867_132007_2_172 | 3300033808 | Peatland | MRPMRPPLPRLHAFTDERVARGADVAGRAGALARGAGPDIALHARGRALTGLEHFTL |
| ⦗Top⦘ |