| Basic Information | |
|---|---|
| Family ID | F058788 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSLLPTILQAVGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGGK |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.84 % |
| % of genes near scaffold ends (potentially truncated) | 13.43 % |
| % of genes from short scaffolds (< 2000 bps) | 61.19 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (47.015 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (47.761 % of family members) |
| Environment Ontology (ENVO) | Unclassified (67.164 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.104 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF03354 | TerL_ATPase | 51.49 |
| PF04860 | Phage_portal | 36.57 |
| PF04586 | Peptidase_S78 | 2.99 |
| PF05065 | Phage_capsid | 1.49 |
| PF01844 | HNH | 1.49 |
| PF05119 | Terminase_4 | 0.75 |
| PF00877 | NLPC_P60 | 0.75 |
| PF00210 | Ferritin | 0.75 |
| PF07691 | PA14 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 51.49 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 2.99 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.49 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
| COG3747 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001847|RCM41_1015873 | All Organisms → Viruses → Predicted Viral | 3576 | Open in IMG/M |
| 3300002202|metazooDRAFT_1272907 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300002930|Water_101647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 4089 | Open in IMG/M |
| 3300003497|JGI25925J51416_10083557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 783 | Open in IMG/M |
| 3300004448|Ga0065861_1038833 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300004448|Ga0065861_1038851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
| 3300004448|Ga0065861_1041508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1634 | Open in IMG/M |
| 3300004460|Ga0066222_1061969 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300004460|Ga0066222_1128205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300004461|Ga0066223_1096970 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005527|Ga0068876_10226468 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005581|Ga0049081_10108584 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300006805|Ga0075464_10899783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 553 | Open in IMG/M |
| 3300007974|Ga0105747_1210321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300008072|Ga0110929_1042959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1643 | Open in IMG/M |
| 3300008113|Ga0114346_1085917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2217 | Open in IMG/M |
| 3300008119|Ga0114354_1036467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2891 | Open in IMG/M |
| 3300008450|Ga0114880_1054152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1683 | Open in IMG/M |
| 3300008962|Ga0104242_1005986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2207 | Open in IMG/M |
| 3300009068|Ga0114973_10057871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2269 | Open in IMG/M |
| 3300009068|Ga0114973_10061658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis gilva | 2187 | Open in IMG/M |
| 3300009082|Ga0105099_10877517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300009085|Ga0105103_10611073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300009151|Ga0114962_10023998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4265 | Open in IMG/M |
| 3300009151|Ga0114962_10385375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300009152|Ga0114980_10772336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300009154|Ga0114963_10016404 | All Organisms → Viruses → Predicted Viral | 4975 | Open in IMG/M |
| 3300009154|Ga0114963_10023616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4085 | Open in IMG/M |
| 3300009154|Ga0114963_10270130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300009154|Ga0114963_10311895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300009154|Ga0114963_10585450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300009154|Ga0114963_10677882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 535 | Open in IMG/M |
| 3300009155|Ga0114968_10219641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300009158|Ga0114977_10021399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4064 | Open in IMG/M |
| 3300009158|Ga0114977_10031710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3313 | Open in IMG/M |
| 3300009159|Ga0114978_10123080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1691 | Open in IMG/M |
| 3300009160|Ga0114981_10317580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300009163|Ga0114970_10120708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
| 3300009163|Ga0114970_10258886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300009163|Ga0114970_10567535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
| 3300009163|Ga0114970_10578712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300009164|Ga0114975_10022779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3794 | Open in IMG/M |
| 3300009164|Ga0114975_10118525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1525 | Open in IMG/M |
| 3300009165|Ga0105102_10256985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300009169|Ga0105097_10885127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300009182|Ga0114959_10061302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
| 3300009182|Ga0114959_10266996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300009183|Ga0114974_10044268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3009 | Open in IMG/M |
| 3300009183|Ga0114974_10207970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1191 | Open in IMG/M |
| 3300009183|Ga0114974_10478134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 702 | Open in IMG/M |
| 3300009184|Ga0114976_10072563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1994 | Open in IMG/M |
| 3300009184|Ga0114976_10225404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
| 3300009419|Ga0114982_1065825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1131 | Open in IMG/M |
| 3300009684|Ga0114958_10045064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2392 | Open in IMG/M |
| 3300010157|Ga0114964_10140150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1180 | Open in IMG/M |
| 3300010158|Ga0114960_10249647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300010160|Ga0114967_10090712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1799 | Open in IMG/M |
| 3300010334|Ga0136644_10071402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis gilva | 2195 | Open in IMG/M |
| 3300010334|Ga0136644_10390909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
| 3300010370|Ga0129336_10040078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2819 | Open in IMG/M |
| 3300010374|Ga0114986_1098605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300010885|Ga0133913_10105861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7537 | Open in IMG/M |
| 3300011115|Ga0151514_10921 | All Organisms → cellular organisms → Bacteria | 11826 | Open in IMG/M |
| 3300011995|Ga0153800_1008152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1011 | Open in IMG/M |
| 3300012000|Ga0119951_1002645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9701 | Open in IMG/M |
| 3300012000|Ga0119951_1010890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3721 | Open in IMG/M |
| 3300012352|Ga0157138_1002859 | All Organisms → Viruses → Predicted Viral | 2966 | Open in IMG/M |
| 3300012780|Ga0138271_1419470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300013004|Ga0164293_10009726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8070 | Open in IMG/M |
| 3300013295|Ga0170791_14451853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300014490|Ga0182010_10464258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300014811|Ga0119960_1024110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300014819|Ga0119954_1017036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
| 3300019784|Ga0181359_1006467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3913 | Open in IMG/M |
| 3300019784|Ga0181359_1031681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2044 | Open in IMG/M |
| 3300020160|Ga0211733_10256764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
| 3300020563|Ga0208082_1007667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2626 | Open in IMG/M |
| 3300021438|Ga0213920_1004264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5670 | Open in IMG/M |
| 3300021438|Ga0213920_1004985 | All Organisms → cellular organisms → Bacteria | 5003 | Open in IMG/M |
| 3300021438|Ga0213920_1016263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1959 | Open in IMG/M |
| 3300021438|Ga0213920_1060288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300021519|Ga0194048_10005521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6031 | Open in IMG/M |
| 3300021519|Ga0194048_10063682 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300021519|Ga0194048_10143451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
| 3300021600|Ga0194059_1253315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 526 | Open in IMG/M |
| 3300021952|Ga0213921_1004011 | All Organisms → Viruses → Predicted Viral | 3130 | Open in IMG/M |
| 3300021956|Ga0213922_1018985 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300021956|Ga0213922_1024498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300021962|Ga0222713_10321575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
| 3300022190|Ga0181354_1038956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1573 | Open in IMG/M |
| 3300022752|Ga0214917_10002671 | All Organisms → cellular organisms → Bacteria | 21403 | Open in IMG/M |
| 3300022752|Ga0214917_10031844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3938 | Open in IMG/M |
| 3300023174|Ga0214921_10053277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3523 | Open in IMG/M |
| 3300023174|Ga0214921_10232923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300023179|Ga0214923_10020646 | All Organisms → cellular organisms → Bacteria | 5897 | Open in IMG/M |
| 3300027659|Ga0208975_1043454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300027708|Ga0209188_1047274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1934 | Open in IMG/M |
| 3300027708|Ga0209188_1049673 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300027708|Ga0209188_1074302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
| 3300027712|Ga0209499_1016350 | All Organisms → cellular organisms → Bacteria | 3557 | Open in IMG/M |
| 3300027712|Ga0209499_1038026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2065 | Open in IMG/M |
| 3300027712|Ga0209499_1039483 | All Organisms → Viruses → Predicted Viral | 2017 | Open in IMG/M |
| 3300027733|Ga0209297_1065616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1611 | Open in IMG/M |
| 3300027733|Ga0209297_1111006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1165 | Open in IMG/M |
| 3300027734|Ga0209087_1004726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7356 | Open in IMG/M |
| 3300027734|Ga0209087_1009788 | All Organisms → Viruses → Predicted Viral | 4935 | Open in IMG/M |
| 3300027734|Ga0209087_1067904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
| 3300027734|Ga0209087_1150564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
| 3300027736|Ga0209190_1005325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8237 | Open in IMG/M |
| 3300027736|Ga0209190_1046333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2229 | Open in IMG/M |
| 3300027736|Ga0209190_1083535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1512 | Open in IMG/M |
| 3300027741|Ga0209085_1000414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31497 | Open in IMG/M |
| 3300027741|Ga0209085_1007989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5406 | Open in IMG/M |
| 3300027741|Ga0209085_1020312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3204 | Open in IMG/M |
| 3300027741|Ga0209085_1123101 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300027747|Ga0209189_1280478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300027749|Ga0209084_1045580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2141 | Open in IMG/M |
| 3300027749|Ga0209084_1047385 | All Organisms → Viruses → Predicted Viral | 2087 | Open in IMG/M |
| 3300027759|Ga0209296_1221906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300027764|Ga0209134_10158810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
| 3300027777|Ga0209829_10136383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
| 3300027900|Ga0209253_10631644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300027963|Ga0209400_1368816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300027969|Ga0209191_1134460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
| 3300028025|Ga0247723_1000283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33974 | Open in IMG/M |
| 3300028025|Ga0247723_1007551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4596 | Open in IMG/M |
| 3300028025|Ga0247723_1054281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1132 | Open in IMG/M |
| 3300028392|Ga0304729_1010662 | All Organisms → Viruses → Predicted Viral | 4308 | Open in IMG/M |
| 3300029753|Ga0135224_1031938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300031784|Ga0315899_11665775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300031999|Ga0315274_10122512 | All Organisms → cellular organisms → Bacteria | 3342 | Open in IMG/M |
| 3300033233|Ga0334722_10862756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300033992|Ga0334992_0004060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10761 | Open in IMG/M |
| 3300033994|Ga0334996_0142843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 47.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 5.22% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.48% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.99% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.99% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.24% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.49% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.49% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.49% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.75% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.75% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.75% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.75% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.75% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.75% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.75% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.75% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.75% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.75% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012780 | Freshwater microbial communities from Lake Croche, Canada - C_130625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029753 | Marine harbor viral communities from the Indian Ocean - SRH3 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM41_10158736 | 3300001847 | Marine Plankton | LLATILQAAGIAIISIGAGLVYLPAGILAAGVGVLLFGLAVDKGDK* |
| metazooDRAFT_12729071 | 3300002202 | Lake | VPTILQAVGLSIIAVGCSLIFIPAGIIVAGIGILLFGIAMERNN* |
| Water_1016472 | 3300002930 | Estuary Water | MLATILQAVGVVVVAVGAGLIYVPAGLVLFGVGVLLFGLALDKGGE* |
| JGI25925J51416_100835572 | 3300003497 | Freshwater Lake | LLPTILQASGIALIAVGAGLVFVPAGIVLAGVGVLLFGLAWEKSGK* |
| Ga0065861_10388332 | 3300004448 | Marine | MILLATILQAVGVGLVALGAGLIYPPVGLILFGAGVLLFGLALDKGGK* |
| Ga0065861_10388512 | 3300004448 | Marine | MLSTILQALGIAVVAVGAGLIFVPAGVILAGVGVLLFGLALDKGDK* |
| Ga0065861_10415081 | 3300004448 | Marine | MRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0066222_10619692 | 3300004460 | Marine | VLATILQAVGVVTVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK* |
| Ga0066222_11282051 | 3300004460 | Marine | VRMRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0066223_10969702 | 3300004461 | Marine | VLATILQAVGVAVVAVGAGLVYVPAGLILFGVGVLLFGLALDKGGK* |
| Ga0068876_102264682 | 3300005527 | Freshwater Lake | MPLLSTILQAVGISVIAIAISLIYIPAGLVVAGTGVLLFGLALERRNK* |
| Ga0049081_101085842 | 3300005581 | Freshwater Lentic | VLPTILQAFGIAVVAFGAGLIFVPAGIVLAGVGLLLFGLALDKGGE* |
| Ga0075464_108997832 | 3300006805 | Aqueous | LLPTILQALGIAVVAVGAGLIYFPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0105747_12103212 | 3300007974 | Estuary Water | MRLLPTILQALGIAVIAVGAGLVFVPAGVVLAGVGVLLFGLALDKGGK* |
| Ga0110929_10429592 | 3300008072 | Water Bodies | MNLLPSILQASGIAVVALGAGLVYVPAGLIVAGIGILLFGLAWERSSK* |
| Ga0114346_10859173 | 3300008113 | Freshwater, Plankton | MNLLATILQASGIAVISVGVSLIFIPAGLVVAGVGVLLFGLALDKGGK* |
| Ga0114354_10364675 | 3300008119 | Freshwater, Plankton | LLPTILQATGIALIAVGAGLVFLPAGIVLAGVGVLLFGLAWEKSGK* |
| Ga0114880_10541522 | 3300008450 | Freshwater Lake | MNLLATILQASGIAVISLGVSLIFFPAGLVVAGVGVLLFGLALDKGGK* |
| Ga0104242_10059862 | 3300008962 | Freshwater | LLATVLQALGISIISIGAGLVYVPAGILLAGVGVLLFGLALDRGGK* |
| Ga0114973_100578713 | 3300009068 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFFPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0114973_100616581 | 3300009068 | Freshwater Lake | MIVLATILQAVGVMTVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK* |
| Ga0105099_108775171 | 3300009082 | Freshwater Sediment | MNLLPTILQASGIALIAVGAGLVFVPAGVVIAGVGVLLFGLAWEKSGK* |
| Ga0105103_106110731 | 3300009085 | Freshwater Sediment | IGYCSRVFRVLRMSLLPTILQALGITVIAVGAGLIFVPAGVLVAGVGLLLFGLAWERSGK |
| Ga0114962_100239984 | 3300009151 | Freshwater Lake | MSMLSTILQALGIAVVAVGAGLIFVPAGLILAGIGVLLFGLALDKGDK* |
| Ga0114962_103853752 | 3300009151 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0114980_107723361 | 3300009152 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0114963_100164043 | 3300009154 | Freshwater Lake | MLSTILQALGIAVVAVGAGLVFVPAGVILAGVGVLLFGLALDKGDK* |
| Ga0114963_100236161 | 3300009154 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLF |
| Ga0114963_102701301 | 3300009154 | Freshwater Lake | MRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFG |
| Ga0114963_103118952 | 3300009154 | Freshwater Lake | MNVLATILQAVGVVTVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK* |
| Ga0114963_105854501 | 3300009154 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVG |
| Ga0114963_106778821 | 3300009154 | Freshwater Lake | RMRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0114968_102196411 | 3300009155 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0114977_100213993 | 3300009158 | Freshwater Lake | MRLFSTILQAVGVAVIAFGAGLIFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0114977_100317103 | 3300009158 | Freshwater Lake | MTLLPTILQAFGIAVIATGISLIFLPAGVVAFGAGFLLFGLAWEKSGK* |
| Ga0114978_101230802 | 3300009159 | Freshwater Lake | MRLFSTILQAVGVAVIAFGAGLIFVPAGVLLAGVGVLLCGLALDKGGK* |
| Ga0114981_103175801 | 3300009160 | Freshwater Lake | LLPTILQAVGVAVISVAAGLVFVPAGVLFAGVGVLLFGLALDKGGK* |
| Ga0114970_101207082 | 3300009163 | Freshwater Lake | MNLIPTILQGLGIAVISVGVSLFYLPAGLVIAGAGILLFGLAWERKNK* |
| Ga0114970_102588862 | 3300009163 | Freshwater Lake | MILLPTILQALGIAVIAVGAGLIFFPAGVLLAGVGVLLFGLALDKGDR* |
| Ga0114970_105675352 | 3300009163 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFIPAGVLFAGVGVLLFGLALDKGGK* |
| Ga0114970_105787121 | 3300009163 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFFPAGVLLAGVGVLLFGLALDKGGR* |
| Ga0114975_100227792 | 3300009164 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFIPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0114975_101185252 | 3300009164 | Freshwater Lake | LLPTILQAVGVAVIAFGAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0105102_102569852 | 3300009165 | Freshwater Sediment | MSLLPTILQALGITVIAVGAGLIFVPAGVLVAGVGLLLFGLAWERSGK* |
| Ga0105097_108851272 | 3300009169 | Freshwater Sediment | MSLLPTILQALGITVIAVGAGLIFVPSGVLVAGVGLLLFGLAWERSGK* |
| Ga0114959_100613023 | 3300009182 | Freshwater Lake | MSLLPTILQALGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0114959_102669962 | 3300009182 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGIGVLLFGLALDKGDK* |
| Ga0114974_100442682 | 3300009183 | Freshwater Lake | MILLPTILQALGIAVIAVGAGLIFVPAGVLLAGVGVLLFGLALDKGDR* |
| Ga0114974_102079702 | 3300009183 | Freshwater Lake | LLPTILQALGIAVVAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0114974_104781342 | 3300009183 | Freshwater Lake | MIVLATILQAVGVGLVALGAGLIYPPVGLILFGAGVLLFGLALDKGGK* |
| Ga0114976_100725633 | 3300009184 | Freshwater Lake | MSLLPTILQAVGVAVISVAAGLVFIPAGVLFAGVGVLLFGLALDKGGK* |
| Ga0114976_102254041 | 3300009184 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFVPAGVLFAGVGVLLFGLALDKGGK* |
| Ga0114982_10658252 | 3300009419 | Deep Subsurface | MILLPTILQAVGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDR* |
| Ga0114958_100450642 | 3300009684 | Freshwater Lake | MRLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGVK* |
| Ga0114964_101401501 | 3300010157 | Freshwater Lake | MRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLL |
| Ga0114960_102496472 | 3300010158 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLTYVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0114967_100907122 | 3300010160 | Freshwater Lake | MSLLPTILQAFGIAVVAFGAGLIFVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0136644_100714023 | 3300010334 | Freshwater Lake | MRLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK* |
| Ga0136644_103909092 | 3300010334 | Freshwater Lake | MRLLPTILQAVGVAVISIAAGLVFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0129336_100400782 | 3300010370 | Freshwater To Marine Saline Gradient | MILLPTILQALGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGGK* |
| Ga0114986_10986052 | 3300010374 | Deep Subsurface | MILLPTILQALGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDR* |
| Ga0133913_1010586119 | 3300010885 | Freshwater Lake | MSLLPTILQAVGVAVISVAAGLVFIPAGVLFAGVGVL |
| Ga0151514_109216 | 3300011115 | Freshwater | MTLLPTILQALGIIVIATGISLVFFPAGLIAFGAGFLLFGLALEKSSK* |
| Ga0153800_10081522 | 3300011995 | Freshwater | MNVLPTILQAFGIAVVAFGAGLIFVPAGIVLAGVGLLLFGLALDKGGE* |
| Ga0119951_100264512 | 3300012000 | Freshwater | LIATVLQALGISIISIGAGLVYVPAGILLAGVGVLLFGLALDRGGK* |
| Ga0119951_10108902 | 3300012000 | Freshwater | MILFPTILQAVGITVIAVSAGLVFIPAGVFVAGVGILLFGLAWERSGK* |
| Ga0157138_10028594 | 3300012352 | Freshwater | LVATILQIAGVTVIAVGAGLIYPPLGVVLAGVGLVIFGLAIERSK* |
| Ga0138271_14194702 | 3300012780 | Freshwater Lake | MNVLATILQAVGVAVVAVGAGLVYLPAGLILFGVGILLFGLALDKGGK* |
| Ga0164293_100097262 | 3300013004 | Freshwater | MSLLPTILQAFGITVIAVGAGLIFVPAGVLVAGVGLLLFGLAWERSGK* |
| Ga0170791_144518532 | 3300013295 | Freshwater | MIVLATILQAVGVVTVAVGAGLVYVPASLILIGVGVLLFGLALDKGGK* |
| Ga0182010_104642582 | 3300014490 | Fen | MRLLPTILQALGIAVIAVGAGLIFVPAGVLLAGVGVLLFGLALDKGGK* |
| Ga0119960_10241102 | 3300014811 | Aquatic | LLPTILQASGIAFIAVGAGLVFVPAGVVLAGVGVLLFGLALDKGGK* |
| Ga0119954_10170361 | 3300014819 | Freshwater | LLATVLQALGISIISISAGLVYVPAGILLAGVGVLLFGLALDRGGK* |
| Ga0181359_10064672 | 3300019784 | Freshwater Lake | LLPTILQASGIALIAVGAGLVFVPAGIVLAGVGVLLFGLAWEKSGK |
| Ga0181359_10316812 | 3300019784 | Freshwater Lake | LLPTILQASGIALIAVGAGLVFLPAGIVLAGVGVLLFGLAWEKSGK |
| Ga0211733_102567642 | 3300020160 | Freshwater | MILLPTILQALGIAVVAVGAGLIFVPAGIVLAGVGLLLFGLALDKGGK |
| Ga0208082_10076673 | 3300020563 | Freshwater | MSLLPTILQAFGITVIAVGAGLIFVPAGVLVAGVGLLLFGLAWERSGK |
| Ga0213920_10042644 | 3300021438 | Freshwater | VLATILQAVGVVTVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK |
| Ga0213920_10049852 | 3300021438 | Freshwater | LIATIFQAVGVAVISVGLGLFFLPAGVVAAGVGCLLFGLALERGK |
| Ga0213920_10162632 | 3300021438 | Freshwater | LLATVLQALGISIISIAAGLVYVPAGILLAGVGVLLFGLALDRGGK |
| Ga0213920_10602882 | 3300021438 | Freshwater | MILLATILQAVGVGLVALGAGLIYPPVGLILFGVGVLLFGLALDKGGK |
| Ga0194048_100055214 | 3300021519 | Anoxic Zone Freshwater | MSLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0194048_100636821 | 3300021519 | Anoxic Zone Freshwater | GIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0194048_101434511 | 3300021519 | Anoxic Zone Freshwater | MLATILQAVGVVTVAVGAGLVYIPAGIVLFGVGVLLFGLALDKGGK |
| Ga0194059_12533152 | 3300021600 | Anoxic Zone Freshwater | MLATILQAVGVAVVAVGAGLIYVPAGFILVGVGVLLFGLALDKDGE |
| Ga0213921_10040112 | 3300021952 | Freshwater | MILLATILQAVGVGLVALGAGLIYPPVGLILFGVGVLLFGLALDKGVK |
| Ga0213922_10189852 | 3300021956 | Freshwater | LLPTILQAFGIAVIAVGAGLIFVPAGIVLFGVGVLLFGLALDKGVK |
| Ga0213922_10244981 | 3300021956 | Freshwater | LLPTILQALGIAVVAVGAGLIYFPAGVVLAGVGVLLFGLALDKGDK |
| Ga0222713_103215752 | 3300021962 | Estuarine Water | MNLLASVLQASGIAVIALGAGLVYVPAGLIVAGVGILLFGLAWERSSK |
| Ga0181354_10389562 | 3300022190 | Freshwater Lake | MNLLATILQASGIAVISVGVSLIFIPAGLVVAGVGVLLFGLALDKGGK |
| Ga0214917_1000267119 | 3300022752 | Freshwater | LSLLPTIFQAIGIAVISFAVGLIFVPAGLICAGVGVLLFGLALERSK |
| Ga0214917_100318445 | 3300022752 | Freshwater | LLSTILQATGIAVIALGAGLVYVPAGLIVAGVGILLFGLAWERSSK |
| Ga0214921_100532772 | 3300023174 | Freshwater | MTLLPTILQATGISIIALATSLVYAPAGLFIAGVGVLLFGLAWERKGK |
| Ga0214921_102329232 | 3300023174 | Freshwater | MSLLPTILQAFGIAVVAVGAGLIFVPAGVVLAGVGLLLFGLALDKGVK |
| Ga0214923_100206461 | 3300023179 | Freshwater | LLATVLQALGISIISIGAGLVYVPAGILLAGVGVLLFGLALDRGGK |
| Ga0208975_10434542 | 3300027659 | Freshwater Lentic | VLPTILQAFGIAVVAFGAGLIFVPAGIVLAGVGLLLFGLALDKGGE |
| Ga0209188_10472743 | 3300027708 | Freshwater Lake | MSLLPTILQALGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209188_10496731 | 3300027708 | Freshwater Lake | RVFLLVRMRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209188_10743022 | 3300027708 | Freshwater Lake | VLATILQAVGVAVVAVGAGLVYVPAGLILFGVGVLLFGLALDKGGK |
| Ga0209499_10163505 | 3300027712 | Freshwater Lake | VLATILQAVGVAVVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK |
| Ga0209499_10380263 | 3300027712 | Freshwater Lake | VLATILQAVGVVTVAVGAGLVYVPAGLILFGVGVLLFGLALDKGGK |
| Ga0209499_10394832 | 3300027712 | Freshwater Lake | MRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209297_10656162 | 3300027733 | Freshwater Lake | MTLLPTILQAFGIAVIATGISLIFLPAGVVAFGAGFLLFGLAWEKSGK |
| Ga0209297_11110062 | 3300027733 | Freshwater Lake | MSLLPTILQAFGIAVVAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209087_10047266 | 3300027734 | Freshwater Lake | MILLATILQAVGVGLVALGAGLIYPPVGLILFGAGVLLFGLALDKGGK |
| Ga0209087_10097882 | 3300027734 | Freshwater Lake | MRLFSTILQAVGVAVIAFGAGLIFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209087_10679042 | 3300027734 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFIPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209087_11505641 | 3300027734 | Freshwater Lake | MSLLPTILQAVGVAVISVAAGLVFIPAGVLFAGVGVLLFGLALDKGGK |
| Ga0209190_10053253 | 3300027736 | Freshwater Lake | VLATILQAVGVMTVAVGAGLVYVPAGIVLFGVGVLLFGLALDKGGK |
| Ga0209190_10463332 | 3300027736 | Freshwater Lake | MNLLPTILQAVGVAVISVAAGLVFFPAGVLLAGVGVLLFGLALDKGGR |
| Ga0209190_10835352 | 3300027736 | Freshwater Lake | MSLLPTILQAFGIAVVAFGAGLIFVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209085_100041429 | 3300027741 | Freshwater Lake | MLSTILQALGIAVVAVGAGLVFVPAGVILAGVGVLLFGLALDKGDK |
| Ga0209085_10079894 | 3300027741 | Freshwater Lake | VRMRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209085_10203122 | 3300027741 | Freshwater Lake | VLATILQAVGVAVVAVGAGLVYLPAGLILFGVGILLFGLALDKGGK |
| Ga0209085_11231011 | 3300027741 | Freshwater Lake | MRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGL |
| Ga0209189_12804781 | 3300027747 | Freshwater Lake | MRLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209084_10455801 | 3300027749 | Freshwater Lake | MRLLPTILQAFGIAVVAVGAGLIYVPAGVVLAGVGVLL |
| Ga0209084_10473852 | 3300027749 | Freshwater Lake | MRLLPTILQAVGVAVISIAAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209296_12219062 | 3300027759 | Freshwater Lake | LLPTILQALGIAVVAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209134_101588101 | 3300027764 | Freshwater Lake | LLPTILQALGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGGK |
| Ga0209829_101363831 | 3300027777 | Freshwater Lake | RMRLLPTILQAVGVAVISVAAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0209253_106316442 | 3300027900 | Freshwater Lake Sediment | MSLLPTILQALGITVIAVGAGLIFVPAGVLVAGVGLLLFGL |
| Ga0209400_13688161 | 3300027963 | Freshwater Lake | VLRISLLPTILQAFGIAVVAFGAGLIFVPAGVVLAGVGVLLFGLALDKGDK |
| Ga0209191_11344601 | 3300027969 | Freshwater Lake | RISLLPTILQAVGVAVIAFGAGLVFVPAGVLLAGVGVLLFGLALDKGGK |
| Ga0247723_100028356 | 3300028025 | Deep Subsurface Sediment | MNLLATILQASGIAVISVGVSLIFLPAGLVVAGLGVLLFGLALDKGGK |
| Ga0247723_10075513 | 3300028025 | Deep Subsurface Sediment | MILLPTILQAVGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGDR |
| Ga0247723_10542812 | 3300028025 | Deep Subsurface Sediment | MSLLPTILQAVGIAVIAVGAGLIFVPAGVVLAGVGVLLFGLALDKGGK |
| Ga0304729_10106624 | 3300028392 | Freshwater Lake | MLSTILQALGIAVVAVGAGLIFVPAGVILAGVGVLLFGLALDKGDK |
| Ga0135224_10319382 | 3300029753 | Marine Harbor | LLATILQIVGVSVISVAAGLVYVPAGVLLAGVGVLLFGLALERSGK |
| Ga0315899_116657751 | 3300031784 | Freshwater | LFVLRIILLPTILQASGIALIAVGAGLVFLPAGIVLAGVGVLLFGLAWEKSGK |
| Ga0315274_101225122 | 3300031999 | Sediment | LLPTILQAFGIAAIAFGAGLIFVPAGIVLAGVGVLLFGLAWEKSSK |
| Ga0334722_108627561 | 3300033233 | Sediment | MSLLPTILQAFGIAVVAVGAGLIFVPAGVVLAGVGLLLFGLALDKGDK |
| Ga0334992_0004060_8426_8572 | 3300033992 | Freshwater | MNLLATILQASGIAVISVGVSIIFLPAGLVVAGVGILLFGLALDKGGK |
| Ga0334996_0142843_278_418 | 3300033994 | Freshwater | LLPTILQALGIAVIAVGAGLIFVPAGVVLAGVGLLLFGLAWERSGK |
| ⦗Top⦘ |