NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F058663

Metatranscriptome Family F058663

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058663
Family Type Metatranscriptome
Number of Sequences 134
Average Sequence Length 116 residues
Representative Sequence LEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Number of Associated Samples 112
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 6.02 %
% of genes near scaffold ends (potentially truncated) 90.30 %
% of genes from short scaffolds (< 2000 bps) 99.25 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.284 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(85.821 % of family members)
Environment Ontology (ENVO) Unclassified
(97.015 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.060 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.51%    β-sheet: 22.12%    Coil/Unstructured: 43.36%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.03 %
UnclassifiedrootN/A5.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008834|Ga0103882_10075582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda552Open in IMG/M
3300009265|Ga0103873_1127302All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda522Open in IMG/M
3300012727|Ga0157531_1094395All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda541Open in IMG/M
3300018584|Ga0193340_1007232All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda764Open in IMG/M
3300018588|Ga0193141_1013646All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda619Open in IMG/M
3300018591|Ga0193398_1002843All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda705Open in IMG/M
3300018592|Ga0193113_1024108All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda642Open in IMG/M
3300018631|Ga0192890_1051594All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda512Open in IMG/M
3300018637|Ga0192914_1013072All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda632Open in IMG/M
3300018641|Ga0193142_1049103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda607Open in IMG/M
3300018651|Ga0192937_1025807All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda689Open in IMG/M
3300018651|Ga0192937_1027798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda664Open in IMG/M
3300018656|Ga0193269_1035440All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda734Open in IMG/M
3300018660|Ga0193130_1029746All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda708Open in IMG/M
3300018662|Ga0192848_1033643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda604Open in IMG/M
3300018673|Ga0193229_1020713All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda712Open in IMG/M
3300018688|Ga0193481_1064658All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda588Open in IMG/M
3300018697|Ga0193319_1039815All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda736Open in IMG/M
3300018698|Ga0193236_1060017Not Available501Open in IMG/M
3300018699|Ga0193195_1029703All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda639Open in IMG/M
3300018709|Ga0193209_1054741All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda565Open in IMG/M
3300018711|Ga0193069_1021816All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda719Open in IMG/M
3300018720|Ga0192866_1051582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda650Open in IMG/M
3300018720|Ga0192866_1074237All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda507Open in IMG/M
3300018729|Ga0193174_1054077All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda786Open in IMG/M
3300018733|Ga0193036_1035421All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda703Open in IMG/M
3300018740|Ga0193387_1049990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda600Open in IMG/M
3300018752|Ga0192902_1085685Not Available551Open in IMG/M
3300018763|Ga0192827_1048359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda743Open in IMG/M
3300018763|Ga0192827_1073675All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda590Open in IMG/M
3300018769|Ga0193478_1057557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda626Open in IMG/M
3300018770|Ga0193530_1063420All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda712Open in IMG/M
3300018770|Ga0193530_1067395All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda686Open in IMG/M
3300018784|Ga0193298_1100579All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda505Open in IMG/M
3300018794|Ga0193357_1052681Not Available674Open in IMG/M
3300018797|Ga0193301_1076369All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda679Open in IMG/M
3300018809|Ga0192861_1083036All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda598Open in IMG/M
3300018819|Ga0193497_1077525All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda608Open in IMG/M
3300018820|Ga0193172_1089768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda513Open in IMG/M
3300018823|Ga0193053_1040565All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda751Open in IMG/M
3300018833|Ga0193526_1089297All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda657Open in IMG/M
3300018841|Ga0192933_1111635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda561Open in IMG/M
3300018847|Ga0193500_1086024All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda528Open in IMG/M
3300018850|Ga0193273_1052692All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda602Open in IMG/M
3300018852|Ga0193284_1043175All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda690Open in IMG/M
3300018856|Ga0193120_1098906All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda690Open in IMG/M
3300018867|Ga0192859_1064683All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda601Open in IMG/M
3300018897|Ga0193568_1089588All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1015Open in IMG/M
3300018901|Ga0193203_10182795All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda704Open in IMG/M
3300018908|Ga0193279_1084874All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda655Open in IMG/M
3300018921|Ga0193536_1227852All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda666Open in IMG/M
3300018934|Ga0193552_10155272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda652Open in IMG/M
3300018940|Ga0192818_10028869All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1003Open in IMG/M
3300018940|Ga0192818_10046677All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda887Open in IMG/M
3300018942|Ga0193426_10145221Not Available532Open in IMG/M
3300018943|Ga0193266_10081016All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda929Open in IMG/M
3300018947|Ga0193066_10168574All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda634Open in IMG/M
3300018947|Ga0193066_10202070Not Available567Open in IMG/M
3300018947|Ga0193066_10216200All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda543Open in IMG/M
3300018953|Ga0193567_10245133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda531Open in IMG/M
3300018955|Ga0193379_10158638All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda633Open in IMG/M
3300018957|Ga0193528_10192212All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda738Open in IMG/M
3300018958|Ga0193560_10266202All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda512Open in IMG/M
3300018960|Ga0192930_10190275All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda748Open in IMG/M
3300018963|Ga0193332_10186322All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda664Open in IMG/M
3300018966|Ga0193293_10041583All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda753Open in IMG/M
3300018969|Ga0193143_10106571All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda823Open in IMG/M
3300018972|Ga0193326_10076252All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda547Open in IMG/M
3300018974|Ga0192873_10378182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda578Open in IMG/M
3300018975|Ga0193006_10153563All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda686Open in IMG/M
3300018975|Ga0193006_10171854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda642Open in IMG/M
3300018976|Ga0193254_10159697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda511Open in IMG/M
3300018978|Ga0193487_10264801All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda536Open in IMG/M
3300018980|Ga0192961_10144100All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda726Open in IMG/M
3300018983|Ga0193017_10222308All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda589Open in IMG/M
3300018986|Ga0193554_10159190All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda817Open in IMG/M
3300018986|Ga0193554_10255657All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda661Open in IMG/M
3300018988|Ga0193275_10027948All Organisms → Viruses → Predicted Viral1244Open in IMG/M
3300018989|Ga0193030_10124404All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda817Open in IMG/M
3300018989|Ga0193030_10191075All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda673Open in IMG/M
3300018993|Ga0193563_10197123All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda657Open in IMG/M
3300018993|Ga0193563_10201866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda646Open in IMG/M
3300018995|Ga0193430_10061665All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda855Open in IMG/M
3300018995|Ga0193430_10077657All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda774Open in IMG/M
3300018996|Ga0192916_10164079All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda660Open in IMG/M
3300018998|Ga0193444_10132512All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda661Open in IMG/M
3300018998|Ga0193444_10161676All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda591Open in IMG/M
3300018998|Ga0193444_10182026All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda552Open in IMG/M
3300018998|Ga0193444_10196913All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda527Open in IMG/M
3300019000|Ga0192953_10071582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda793Open in IMG/M
3300019003|Ga0193033_10222773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda519Open in IMG/M
3300019004|Ga0193078_10158439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda572Open in IMG/M
3300019006|Ga0193154_10197751All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda712Open in IMG/M
3300019006|Ga0193154_10204613All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda697Open in IMG/M
3300019007|Ga0193196_10045776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1546Open in IMG/M
3300019007|Ga0193196_10082624All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1261Open in IMG/M
3300019010|Ga0193044_10248289All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda549Open in IMG/M
3300019011|Ga0192926_10259783All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda743Open in IMG/M
3300019012|Ga0193043_10092726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1345Open in IMG/M
3300019012|Ga0193043_10240224All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda693Open in IMG/M
3300019012|Ga0193043_10285875All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda605Open in IMG/M
3300019019|Ga0193555_10257794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda558Open in IMG/M
3300019026|Ga0193565_10308040All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda521Open in IMG/M
3300019040|Ga0192857_10257311All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda583Open in IMG/M
3300019043|Ga0192998_10132896All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda692Open in IMG/M
3300019043|Ga0192998_10144601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda670Open in IMG/M
3300019055|Ga0193208_10112912All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1248Open in IMG/M
3300019055|Ga0193208_10125133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1201Open in IMG/M
3300019094|Ga0193040_1014126Not Available578Open in IMG/M
3300019101|Ga0193217_1029969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda662Open in IMG/M
3300019104|Ga0193177_1026067All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda676Open in IMG/M
3300019111|Ga0193541_1076155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda587Open in IMG/M
3300019133|Ga0193089_1075891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda810Open in IMG/M
3300019143|Ga0192856_1025305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda764Open in IMG/M
3300019143|Ga0192856_1047864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda607Open in IMG/M
3300019148|Ga0193239_10235740All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda665Open in IMG/M
3300019151|Ga0192888_10158844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda717Open in IMG/M
3300023685|Ga0228686_1057015All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda538Open in IMG/M
3300030752|Ga0073953_11409827All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda617Open in IMG/M
3300030951|Ga0073937_11903213All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda535Open in IMG/M
3300031037|Ga0073979_12286377All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda505Open in IMG/M
3300031056|Ga0138346_10040129All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda721Open in IMG/M
3300031522|Ga0307388_10764955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda647Open in IMG/M
3300031709|Ga0307385_10197863Not Available763Open in IMG/M
3300032481|Ga0314668_10695854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda504Open in IMG/M
3300032522|Ga0314677_10475935All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda666Open in IMG/M
3300032540|Ga0314682_10588601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda609Open in IMG/M
3300032651|Ga0314685_10769100All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda514Open in IMG/M
3300032666|Ga0314678_10359916All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda657Open in IMG/M
3300032713|Ga0314690_10057927All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1553Open in IMG/M
3300032730|Ga0314699_10534295All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda527Open in IMG/M
3300032732|Ga0314711_10485596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda635Open in IMG/M
3300032754|Ga0314692_10129041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda1287Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine85.82%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.72%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.48%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.49%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.75%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018584Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001758 (ERX1789699-ERR1719170)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018591Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782350-ERR1711882)EnvironmentalOpen in IMG/M
3300018592Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782094-ERR1712047)EnvironmentalOpen in IMG/M
3300018631Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000709 (ERX1789487-ERR1719508)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018656Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018662Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000526 (ERX1782276-ERR1711878)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018688Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002199 (ERX1789672-ERR1719470)EnvironmentalOpen in IMG/M
3300018697Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789701-ERR1719308)EnvironmentalOpen in IMG/M
3300018698Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001473 (ERX1809465-ERR1739846)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018729Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789694-ERR1719374)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018794Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782102-ERR1711992)EnvironmentalOpen in IMG/M
3300018797Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001622 (ERX1809762-ERR1740131)EnvironmentalOpen in IMG/M
3300018809Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789406-ERR1719516)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018833Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789510-ERR1719289)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018841Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000884 (ERX1789477-ERR1719315)EnvironmentalOpen in IMG/M
3300018847Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003005 (ERX1789704-ERR1719166)EnvironmentalOpen in IMG/M
3300018850Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001578 (ERX1782388-ERR1711941)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018856Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001006 (ERX1782473-ERR1712200)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018897Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002777EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018921Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002809 (ERX1789458-ERR1719341)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018960Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789423-ERR1719357)EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018978Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018983Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000)EnvironmentalOpen in IMG/M
3300018986Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000596EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019004Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782445-ERR1712173)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019094Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001489 (ERX1809466-ERR1739840)EnvironmentalOpen in IMG/M
3300019101Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000077 (ERX1782274-ERR1712235)EnvironmentalOpen in IMG/M
3300019104Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000314 (ERX1782308-ERR1711955)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019148Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001477 (ERX1789676-ERR1719431)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030752Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031056Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103882_1007558213300008834Surface Ocean WaterWGPTVDMLLDENIKVVFTCFNQEHFQDSLERLDYVFVKYIYKGPNTWVSGHTKQSPMDPNMIWASNQFLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS*
Ga0103873_112730213300009265Surface Ocean WaterVDLLLDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAFDMKTLTLIEEPSEENLAEAEDEFERLLNETS*
Ga0157531_109439513300012727FreshwaterWGPTVDLLLDENVKVIFTCFNEEQYTQAIDRLDYVFAKYIYKGLNNWVSGNVKQTPHDPNMVWASNQYLIVFQGRTVDMKTLTLIEEPTEQNLEEAEAEFERLLEENP*
Ga0193340_100723213300018584MarineFWERFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193141_101364623300018588MarineGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193398_100284313300018591MarineLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0193113_102410813300018592MarineERFIQTKKVERPDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0192890_105159413300018631MarineTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192914_101307213300018637MarineTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193142_104910323300018641MarineEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0192937_102580713300018651MarineDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192937_102779813300018651MarineDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193269_103544013300018656MarineAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193130_102974613300018660MarineAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192848_103364313300018662MarineFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193229_102071313300018673MarineIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193481_106465813300018688MarineWERFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193319_103981513300018697MarineAIHPRLEGEFWGPTVDLLLDENIKCVFTCFNTEQYKQAQERLDYVFAKYIYKGPNPWVSGNVKQTPHDPNMVWASNQYIIVFQGRTVDMKTLTLIEEPTEENLDDAEAEFERLLEQNE
Ga0193236_106001713300018698MarineFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193195_102970323300018699MarineVDLLLDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGVNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193209_105474113300018709MarineIHPRLEGEFWGPTVDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193069_102181613300018711MarineEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192866_105158213300018720MarineRFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192866_107423713300018720MarineTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193174_105407713300018729MarineEIVMAIHPRLEGEFWGPTVDLLLDENIKCVFTCFNTEQYKQAQERLDYVFAKYIYKGPNPWVSGNVKQTPHDPNMVWASNQYIIVFQGRTVDMKTLTLIEEPTEENLDDAEAEFERLLEQNE
Ga0193036_103542113300018733MarineEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193387_104999013300018740MarineWERFIQTKKVEKPDVVMAIHPHLDGEFWGPTVDLLLDENIKVVFTCFNKDNYEESLERLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNEGS
Ga0192902_108568523300018752MarineKVEKPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0192827_104835913300018763MarineFWERYIQTKKVEKPDIVMAIHPRLEGEFWGPTVDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0192827_107367513300018763MarineEFWGPTVDLLLDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGVNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193478_105755713300018769MarineWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193530_106342023300018770MarinePHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193530_106739513300018770MarineEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193298_110057913300018784MarineFWGPTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193357_105268113300018794MarineVEKPDVVMAIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYMVVFQGRSVDMKTLTLIEEPSEENLDEAEDQFERLLNESGSGS
Ga0193301_107636913300018797MarineFWERYIQTKKVERPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0192861_108303613300018809MarineVMAIHPRLDGEFWGPTVDLLLDENIKVVFTCFNKDNYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193497_107752513300018819MarineQTKKVERPDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193172_108976813300018820MarineAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193053_104056523300018823MarineKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193526_108929713300018833MarineFWERFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193302_108841313300018838MarineVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0192933_111163513300018841MarineERYVQSKKVEKPDVVMTIHPHLEGEFWGPTVDLLLDENIKTAFTAFNEEHFKQAIERLDYVFAKYVYKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEQN
Ga0193500_108602413300018847MarineDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193273_105269213300018850MarineWGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDQFERLLHESS
Ga0193284_104317513300018852MarineDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGPNPWVSQHTKQSPVDPNMIWASNQYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFEKLLNQGS
Ga0193120_109890613300018856MarineDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSRHTKQSPMDPNMIWASNQYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFEKLLNEGS
Ga0192859_106468313300018867MarineLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193568_108958823300018897MarineVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193203_1018279513300018901MarineWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193279_108487413300018908MarineWGPTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFAKYIYKGPNPWVSLHTKQSPMDPNMIWASNQFMVVFQGRAVDMKTLTLIEEPSEENLDEAEDQFERLLNESGS
Ga0193536_122785213300018921MarineENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193552_1015527213300018934MarineWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192818_1002886923300018940MarineMVFTMTSGRGSSRRKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAK
Ga0192818_1004667713300018940MarineERFIQAKKVEIPDVVMAIHPHLEGEFWGPTVDLLLDENITTAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAAE
Ga0193426_1014522113300018942MarineHGENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193266_1008101613300018943MarineMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193066_1016857413300018947MarineLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0193066_1020207013300018947MarineIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193066_1021620013300018947MarineVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYIYKGLNPWVSGHVKQTPHDANMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193567_1024513313300018953MarineDFWERFILTKKVEKPDVVMAIHPQLEGEFWGPTVDLLLDENIKTVFTAFNEEHFKQALERLDYVFAKYIYKGPNTWVSGHVKQTPHDPNQIWASNQYLIVFQGRAVDMKTLTLIEEPTEENLAEAEDEFERLLNETG
Ga0193379_1015863813300018955MarineFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193528_1019221213300018957MarineKPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193560_1026620213300018958MarineAIHPRLESEFWVPTLDLLLDENIKTVLTTFNKDQFIAILEKLDPLYAKYIYRGPNPWVSGHVKQTPHDANMVWASNQFLIVFQGRTVDLNTLTLIEDPNEDETNRAEEEFEKLLEGL
Ga0192930_1019027513300018960MarineFILAKKVEVPDVVMAIHPHLEGEFWGPTVDLLLDENVTTAFTAFNEEHFKQALERLDYVFAKYIFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193332_1018632213300018963MarinePDVVMAIHPRLDGEFWGPTVDLLLDENIKVVFTCFNKDNYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193293_1004158313300018966MarineIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEA
Ga0193143_1010657113300018969MarineQAKKVEVPDIVMAIHPHLEGEFWGPTVDMLLDENVITCFTAFNEEHFKQAQERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYIIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEGN
Ga0193326_1007625213300018972MarineWERFVLTKKVERPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0192873_1037818223300018974MarineDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193006_1015356313300018975MarineAIHPHLEGEFWGPTVDLLLDENVTTAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAN
Ga0193006_1017185413300018975MarineVTAFTAFNEGHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193254_1015969713300018976MarineMKKVEKPDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193487_1026480113300018978MarineDVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNET
Ga0192961_1014410013300018980MarineMAIHPHLEGEFWGPTVDLLLDENIVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193017_1022230813300018983MarineWGPTVDLLLDENIKTCFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193554_1015919013300018986MarineVVMAIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYMVVFQGRSVDMKTLTLIEEPSEENLDEAEDQFERLLNESGSGS
Ga0193554_1025565713300018986MarineEKPDIVMAIHPRLEGEFWGPTVDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193275_1002794813300018988MarineVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193030_1012440413300018989MarineERFIQTKKVEKPDVVMAIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYIVVFQGRAVDMKTLTLIEEPSEENLDEAEDQFERLLNESGS
Ga0193030_1019107513300018989MarineLLDENITTAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAAE
Ga0193563_1019712313300018993MarineENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193563_1020186613300018993MarineENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193430_1006166513300018995MarineERFIHTKKVEKPDVVMAIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYMVVFQGRAVDMKTLTLIEEPSEENLDEAEDQFERLLNESGS
Ga0193430_1007765723300018995MarineVVMAIHPHLDGEFWGPTVDLLLDENIKVVFTCFNKDNYEESLERLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNEG
Ga0192916_1016407913300018996MarineLLLDENRLVVFTCFNKDNYEESLERLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNEGS
Ga0193444_1013251223300018998MarineDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193444_1016167613300018998MarineLGGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193444_1018202613300018998MarineRLEGEFWGPTVDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193444_1019691313300018998MarineMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDQFERLLHESS
Ga0192953_1007158213300019000MarineVMSIHPHLEGEFWGPTVDMLLDENIVTCFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYMIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEGN
Ga0193033_1022277313300019003MarineENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGKNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193078_1015843913300019004MarineMGGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193154_1019775113300019006MarineEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193154_1020461313300019006MarineCFNKDHYEESLDRLDYVFVKYLYKGPNPWVSRHTKQSPMDPNMIWASNQYLVVFQGRSVDMKTLTLIEEPSEENLAEAEDEFEKLLNQGP
Ga0193196_1004577613300019007MarineMAIHPRLEGEFWGPTVDLLLDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGVNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193196_1008262413300019007MarineMTFGKDLSKPKVEKPDIVMAIHPRLEGEFWGPTVDLLLDENIKIVFTCFNKDHYEESLERLDYVFVKYIYKGVNPWVSGHTKQSPLDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193044_1024828923300019010MarineGPTVDLLLDENIVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0192926_1025978313300019011MarineRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYMVVFQGRSVDMKTLTLIEEPSEENLDEAEDQFERLLNESGSGS
Ga0193043_1009272613300019012MarineWERFVQTKKVEKPDIVMAIHPRLESEFWVPTLDLLLDENIKTVLTTFNKDQFIAILEKLDPLYAKYIYRGPNPWVSGHVKQTPHDANMVWASNQFLIVFQGRTVDLNTLTLIEDPNEDETNRAEEEFEKLLEGL
Ga0193043_1024022413300019012MarineAIHPHLEGEFWGPTVDLLLDENIVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193043_1028587513300019012MarineAIHPHLEGEFWGPTVDLLLDENIVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0193555_1025779413300019019MarineWGPTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFVKYIYKGPNPWVSRHTKQSPMDPNMIWASNQYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFEKLLNEGS
Ga0193565_1030804013300019026MarineTRKMERPELVMAIHPRLEGEFWGPTVDLLLDENIKTVFTCFNVEQFKQAQERLDYVFAKYIYKGPNEWVSGNVKQTPHDPNMVWASNQYIIVFQGRTVDMKTLTLIEEPTEENLVDAEAEFERLLEDN
Ga0192857_1025731113300019040MarineWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0192998_1013289613300019043MarineLLLDENVTTAFTAFNEEHFKQALERLDYVFAKYIFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0192998_1014460113300019043MarineKPDVVMAIHPRLEGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193208_1011291223300019055MarineLILVNILLLSAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193208_1012513333300019055MarineMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0193040_101412613300019094MarineMENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNETS
Ga0193217_102996913300019101MarineTVDMLLDENIKVVFTCFNKDHYEESLERLDYVFVKYLYKGPNTWVSGHTKQSPMDPNMIWASNQYLIVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0193177_102606713300019104MarineGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193541_107615513300019111MarineVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHQKQSPMDPNMIWASNTYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNET
Ga0193089_107589113300019133MarineLEGEFWGPTVDLLLDENIKTCFTCFNDEQFKQAKERLDYVFAKYIYKGPNPWVSGNVKQTPHDPNMVWASNQYIIIFQGRTVDMKTLTLIEEPSEENLDSAEAEFERLLEEEN
Ga0192856_102530513300019143MarineWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSQHTKQSPMDPNMIWASNQYMVVFQGRSVDMKTLTLIEEPSEENLDEAEDQFERLLNESGSGS
Ga0192856_104786413300019143MarineRYIQTKKVERPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVYKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNESS
Ga0193239_1023574013300019148MarineEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAQ
Ga0192888_1015884413300019151MarineWERFILTKKVEKPDVVMAIHPQLEGEFWGPTVDLLLDENIKTVFTAFNEEHFKQALERLDYVFAKYIYKGPNTWVSGHVKQTPHDPNQIWASNQYLIVFQGRAVDMKTLTLIEEPTEENLAEAEDEFERLLNETG
Ga0228686_105701513300023685SeawaterERPDVVMAIHPRLEGEFWGPTIDLLLDENIKVVFTCFNKDHYDEMLDRLDYVFVKYIYKGPNPWVSGHTKQSPMDPNMIWASNSYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFERLLNESS
Ga0073953_1140982713300030752MarineDFWERFIQAKKVEVPDIVMAIHPHLEGEFWGPTVDLLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGMNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0073937_1190321313300030951MarineFWGPTVDLLLDENIKTVFTAFNEEHFKQALERLDYVFAKYIYKGPNTWVSGHVKQTPHDPNQIWASNQYLIVFQGRAVDMKTLTLIEEPTEENLAEAEDEFERLLNETG
Ga0073979_1228637713300031037MarineGEFWGPTVDMLLDENIKVVFTCFNKDHYEESLDRLDYVFVKYIYKGPNPWVSRHTKQSPMDPNMIWASNQYLVVFQGRAVDMKTLTLIEEPSEENLAEAEDEFEKLLNEGS
Ga0138346_1004012913300031056MarineMLAQTLAIHPHLEGEFWGPTVDLLLDENVTTAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAN
Ga0307388_1076495523300031522MarineLLDENVVTAFTAFNEEHFKQALERLDYVFAKYIFKGPNPWVSGHVKQTPHDPNMIWASNQYLIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEAE
Ga0307385_1019786313300031709MarineLAKKVEKPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFNQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPSEQNLAEAEDEFERLLNEAS
Ga0314668_1069585413300032481SeawaterERPDIVMAIHPKLEGEFWGPTVDLLLDENIKTCFTCFNKEQFKQAIERLDYVFAKYVFKGPNPWVSMNVKQTPHDPNMVWSSNQFLIVFQGRTVDMKTLTLIEEPTEETLEDAEAQFERLLQENDE
Ga0314677_1047593513300032522SeawaterWGPTVDLLLDENIKTCFTCFNKEQFKQALERLDYVFAKYIFKGPNPWQSMNVKQTPHDHNMVWSSNQFIIVFQGRTVDMKTLTLIEEPTEEILEDAEAEFERLLQENDD
Ga0314682_1058860113300032540SeawaterEFWGPTVDLLLDENIKTCFTCFNKEQFKQALERLDYVFAKYIFKGPNPWQSMNVKQTPHDHNMVWSSNQFIIVFQGRTVDMKTLTLIEEPTEEILEDAEAEFERLLQENDD
Ga0314685_1076910013300032651SeawaterIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0314678_1035991613300032666SeawaterDLLLDENIKTCFTCFNKEQFKQALERLDYVFAKYIFKGPNPWQSMNVKQTPHDHNMVWSSNQFIIVFQGRTVDMKTLTLIEEPTEEILEDAEAEFERLLQENDG
Ga0314690_1005792723300032713SeawaterMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0314699_1053429513300032730SeawaterPDVVMAIHPRLEGEFWGPTVDLLLDENIKVAFTAFNEEHFKQALERLDYVFAKYVFKGLNPWVSGHVKQTPHDPNMIWASNQYLIVFQGRTVDMKTLTLIEEPTEENLAEAEDEFERLLNEAS
Ga0314711_1048559613300032732SeawaterHPKLEGEFWGPTVDLLLDENIKTCFTCFNKEQFKQALERLDYVFAKYIFKGPNPWQSMNVKQTPHDHNMVWSSNQFIIVFQGRTVDMKTLTLIEEPTEEILEDAEAEFERLLQENDD
Ga0314692_1012904113300032754SeawaterDLLLDENIKTCFTCFNKEQFKQALERLDYVFAKYIFKGPNPWQSMNVKQTPHDHNMVWSSNQFIIVFQGRTVDMKTLTLIEEPTEEILEDAEAEFERLLQENDD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.