NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058624

Metagenome Family F058624

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058624
Family Type Metagenome
Number of Sequences 134
Average Sequence Length 69 residues
Representative Sequence VKKKEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYLDRINHDKLKKVLDM
Number of Associated Samples 11
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 65.12 %
% of genes near scaffold ends (potentially truncated) 9.70 %
% of genes from short scaffolds (< 2000 bps) 44.03 %
Associated GOLD sequencing projects 9
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.045 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated
(97.761 % of family members)
Environment Ontology (ENVO) Unclassified
(97.761 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant corpus
(97.761 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.00%    β-sheet: 24.00%    Coil/Unstructured: 62.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF00078RVT_1 12.69
PF00665rve 11.94
PF03732Retrotrans_gag 2.24
PF00141peroxidase 2.24
PF00083Sugar_tr 1.49
PF02705K_trans 0.75
PF00098zf-CCHC 0.75
PF00582Usp 0.75
PF00324AA_permease 0.75
PF05970PIF1 0.75
PF13359DDE_Tnp_4 0.75
PF06813Nodulin-like 0.75
PF13378MR_MLE_C 0.75
PF00571CBS 0.75
PF00249Myb_DNA-binding 0.75
PF14543TAXi_N 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 11.94
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 11.94
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 11.94
COG4584TransposaseMobilome: prophages, transposons [X] 11.94
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 2.24
COG0507ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.75
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.75
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.75
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.75
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.75
COG3158K+ uptake protein KupInorganic ion transport and metabolism [P] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.04 %
UnclassifiedrootN/A8.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009500|Ga0116229_10000358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis57898Open in IMG/M
3300009500|Ga0116229_10006051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis19584Open in IMG/M
3300009500|Ga0116229_10021240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis8135Open in IMG/M
3300009500|Ga0116229_10022301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis7808Open in IMG/M
3300009500|Ga0116229_10030779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis6027Open in IMG/M
3300009500|Ga0116229_10040030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4930Open in IMG/M
3300009500|Ga0116229_10045157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4505Open in IMG/M
3300009500|Ga0116229_10073477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3201Open in IMG/M
3300009500|Ga0116229_10074514Not Available3171Open in IMG/M
3300009500|Ga0116229_10132428All Organisms → cellular organisms → Eukaryota2201Open in IMG/M
3300009500|Ga0116229_10134510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2180Open in IMG/M
3300009500|Ga0116229_10178144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1842Open in IMG/M
3300009500|Ga0116229_10347025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1246Open in IMG/M
3300009500|Ga0116229_10385381All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1172Open in IMG/M
3300009500|Ga0116229_10530084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis973Open in IMG/M
3300009500|Ga0116229_10587577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis916Open in IMG/M
3300009500|Ga0116229_11011775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis668Open in IMG/M
3300009510|Ga0116230_10002625Not Available17320Open in IMG/M
3300009510|Ga0116230_10004855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Dicranidae → Pseudoditrichales → Ditrichaceae → Ceratodon → Ceratodon purpureus13164Open in IMG/M
3300009510|Ga0116230_10013493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis8048Open in IMG/M
3300009510|Ga0116230_10034189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4816Open in IMG/M
3300009510|Ga0116230_10061991All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3359Open in IMG/M
3300009510|Ga0116230_10084649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2764Open in IMG/M
3300009510|Ga0116230_10092768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2610Open in IMG/M
3300009510|Ga0116230_10100075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2487Open in IMG/M
3300009510|Ga0116230_10164699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1830Open in IMG/M
3300009510|Ga0116230_10168561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1805Open in IMG/M
3300009510|Ga0116230_10249182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1425Open in IMG/M
3300009510|Ga0116230_10368784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1123Open in IMG/M
3300009510|Ga0116230_10557724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis872Open in IMG/M
3300009510|Ga0116230_10671189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis779Open in IMG/M
3300009510|Ga0116230_10702001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis758Open in IMG/M
3300009510|Ga0116230_10867062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis667Open in IMG/M
3300009510|Ga0116230_10907508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis649Open in IMG/M
3300009510|Ga0116230_11027763All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis601Open in IMG/M
3300009510|Ga0116230_11345495All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis507Open in IMG/M
3300009627|Ga0116109_1075639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis682Open in IMG/M
3300009697|Ga0116231_10002838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta36121Open in IMG/M
3300009697|Ga0116231_10008249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis18379Open in IMG/M
3300009697|Ga0116231_10018228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis8165Open in IMG/M
3300009697|Ga0116231_10023884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis6028Open in IMG/M
3300009697|Ga0116231_10024654All Organisms → cellular organisms → Eukaryota5838Open in IMG/M
3300009697|Ga0116231_10046145All Organisms → cellular organisms → Eukaryota3250Open in IMG/M
3300009697|Ga0116231_10529968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis645Open in IMG/M
3300009701|Ga0116228_10039907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3849Open in IMG/M
3300009701|Ga0116228_10049663All Organisms → cellular organisms → Eukaryota3355Open in IMG/M
3300009701|Ga0116228_10119928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1940Open in IMG/M
3300009701|Ga0116228_10198411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1438Open in IMG/M
3300009701|Ga0116228_10220980All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1348Open in IMG/M
3300009701|Ga0116228_10224942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1334Open in IMG/M
3300009701|Ga0116228_10458599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis876Open in IMG/M
3300009701|Ga0116228_10466397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis867Open in IMG/M
3300009701|Ga0116228_10622216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis732Open in IMG/M
3300009701|Ga0116228_10807879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis629Open in IMG/M
3300009709|Ga0116227_10000492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina76849Open in IMG/M
3300009709|Ga0116227_10072450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2927Open in IMG/M
3300009709|Ga0116227_10083376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2661Open in IMG/M
3300009709|Ga0116227_10638126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis806Open in IMG/M
3300009787|Ga0116226_10004297All Organisms → cellular organisms → Eukaryota12618Open in IMG/M
3300009787|Ga0116226_10054412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4049Open in IMG/M
3300009787|Ga0116226_10061436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3818Open in IMG/M
3300009787|Ga0116226_10070893Not Available3562Open in IMG/M
3300009787|Ga0116226_10089781All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3165Open in IMG/M
3300009787|Ga0116226_10159812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2344Open in IMG/M
3300009787|Ga0116226_10224523All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1946Open in IMG/M
3300009787|Ga0116226_10300805Not Available1653Open in IMG/M
3300009787|Ga0116226_10318975All Organisms → cellular organisms → Eukaryota1598Open in IMG/M
3300009787|Ga0116226_10347412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1522Open in IMG/M
3300009787|Ga0116226_10373586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1459Open in IMG/M
3300009787|Ga0116226_10393005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1416Open in IMG/M
3300009787|Ga0116226_10393582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1415Open in IMG/M
3300009787|Ga0116226_10481626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera1257Open in IMG/M
3300009787|Ga0116226_10735194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis974Open in IMG/M
3300009787|Ga0116226_10788659All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis933Open in IMG/M
3300009787|Ga0116226_10817118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis913Open in IMG/M
3300009787|Ga0116226_10829057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis905Open in IMG/M
3300009787|Ga0116226_10853876Not Available888Open in IMG/M
3300009787|Ga0116226_11092206All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis762Open in IMG/M
3300009787|Ga0116226_11098182All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis760Open in IMG/M
3300009787|Ga0116226_11126947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis747Open in IMG/M
3300009787|Ga0116226_11202840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis718Open in IMG/M
3300009787|Ga0116226_11248648All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis701Open in IMG/M
3300009787|Ga0116226_11308025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis681Open in IMG/M
3300009787|Ga0116226_11438309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis642Open in IMG/M
3300009787|Ga0116226_11451864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis639Open in IMG/M
3300009787|Ga0116226_11696509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis580Open in IMG/M
3300009787|Ga0116226_11733433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis573Open in IMG/M
3300009787|Ga0116226_11851612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis550Open in IMG/M
3300009787|Ga0116226_12108500All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis508Open in IMG/M
3300014201|Ga0181537_10127100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1743Open in IMG/M
3300025509|Ga0208848_1004488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha2790Open in IMG/M
3300027807|Ga0209208_10001471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida33300Open in IMG/M
3300027807|Ga0209208_10004517All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis19699Open in IMG/M
3300027807|Ga0209208_10004765Not Available19098Open in IMG/M
3300027807|Ga0209208_10007262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha15066Open in IMG/M
3300027807|Ga0209208_10022119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis7128Open in IMG/M
3300027807|Ga0209208_10022881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis6940Open in IMG/M
3300027807|Ga0209208_10029931All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis5606Open in IMG/M
3300027807|Ga0209208_10042260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4198Open in IMG/M
3300027807|Ga0209208_10047772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3777Open in IMG/M
3300027807|Ga0209208_10060287All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3082Open in IMG/M
3300027807|Ga0209208_10063668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2936Open in IMG/M
3300027807|Ga0209208_10076982All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2483Open in IMG/M
3300027807|Ga0209208_10105826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1881Open in IMG/M
3300027807|Ga0209208_10108866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1836Open in IMG/M
3300027807|Ga0209208_10174578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1240Open in IMG/M
3300027860|Ga0209611_10001189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida43492Open in IMG/M
3300027860|Ga0209611_10001729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina37773Open in IMG/M
3300027860|Ga0209611_10002275All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta33677Open in IMG/M
3300027860|Ga0209611_10002364All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis33117Open in IMG/M
3300027860|Ga0209611_10002384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha33026Open in IMG/M
3300027860|Ga0209611_10002453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha32637Open in IMG/M
3300027860|Ga0209611_10005653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis20823Open in IMG/M
3300027860|Ga0209611_10008906All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota15441Open in IMG/M
3300027860|Ga0209611_10010706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis13428Open in IMG/M
3300027860|Ga0209611_10016991Not Available9195Open in IMG/M
3300027860|Ga0209611_10024308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis6620Open in IMG/M
3300027860|Ga0209611_10027728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis5846Open in IMG/M
3300027860|Ga0209611_10030330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis5345Open in IMG/M
3300027860|Ga0209611_10033806All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis4823Open in IMG/M
3300027860|Ga0209611_10042960All Organisms → cellular organisms → Eukaryota3863Open in IMG/M
3300027860|Ga0209611_10048292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3475Open in IMG/M
3300027860|Ga0209611_10052185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3253Open in IMG/M
3300027860|Ga0209611_10052286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3248Open in IMG/M
3300027860|Ga0209611_10053324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis3191Open in IMG/M
3300027860|Ga0209611_10074910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2423Open in IMG/M
3300027860|Ga0209611_10085350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis2197Open in IMG/M
3300027860|Ga0209611_10099999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis1956Open in IMG/M
3300027860|Ga0209611_10586666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Marchantiophyta → Marchantiopsida → Marchantiidae → Marchantiales → Marchantiaceae → Marchantia → Marchantia polymorpha → Marchantia polymorpha subsp. ruderalis617Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated97.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.75%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.75%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009510Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009627Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10EnvironmentalOpen in IMG/M
3300009697Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300025509Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0116229_10000358163300009500Host-AssociatedVKKREFKKGDLVMMFNAQHHRKVCKKLSPKWFGPFVIMKVFVDNGFYELENVDGLPYPYRINHDKLKKVLDM*
Ga0116229_10005729233300009500Host-AssociatedVKKREFEESDLIMMFDIRYHRKANKNLLPKWFGPFIIKNVFTNNEFYDFKNVDGSLYLDCVNHDKLKKVLDI*
Ga0116229_1000605153300009500Host-AssociatedVKKKEFKKGDLVMMFDVRHHHRAYNKLLPKWFGPSVIRKVFTYNGSYELENVNGSPYSNRVNHDKLKKVLDM*
Ga0116229_1002124013300009500Host-AssociatedVKKKEFKEGDLVMMFDTRHHHRAYKKLLLKWFGPFLIKKVFADNGSYELKNVNGSPYPNRINHDKLKKVLDM*
Ga0116229_1002230133300009500Host-AssociatedVKKKEFKEGDLVMRFNARHHRKAYKKLLPKWFRPFVIKKVFADNGSYEFENVDGSPYPGRINHDKLKKVLDM*
Ga0116229_10030779113300009500Host-AssociatedMKKIKFKEGDLVMMFDVRHHRRVYKKLLPKWFGPFVIKKMFTDNGSYELENVDGSPYLDCINHNKLKKVLDM*
Ga0116229_1004003063300009500Host-AssociatedMFNA*HHHRAYKKLLPKWFGPFVIKTVFVDNGSYELENVNGSPYPDRVNHDKLKKVLDM*FQGRNP*
Ga0116229_10045157113300009500Host-AssociatedVKKKEFREGDLVMMFNARHHRKAYKKLLPKRSRPFVIKKVFADNGSYELENVDGSPYPDRINHDKLKKILDM*
Ga0116229_1007347723300009500Host-AssociatedVKNREFKEGDFVMTFDILHHPMVYKKLLPKWFGPFVIRKEFADTGSYEFENVNGSPYPNHIGHDKLKKVLNM*
Ga0116229_1007451413300009500Host-AssociatedMFDI*HHCRVYKKYLPKWFGPFVIKKMFTNNEYYELENVNGSPYLDCVNHDKLKKNLNM*FQGRNP*
Ga0116229_1013242823300009500Host-AssociatedVKKREFKEGDLVMMFDVRHHRKAYKKLLPKWFGPFVIKKVFIDNGFYELENVDGSPYPDRINHDKLKKALDM*
Ga0116229_1013451013300009500Host-AssociatedVKKKEFKEGDLVMLFDPRHHHKAYKKLLPKWFEPFVIKKVFADNKSYELENVNDSPYSNRINLDKLKKVLDM*
Ga0116229_1017814413300009500Host-AssociatedVKKEEFKEGDLVMMFNVRHHHMAYKKLLPKWFGPFVIRKVFINNGFYELENVDGSPYVDRINHDKLKKVLNM*
Ga0116229_1034702513300009500Host-AssociatedVKKREFKEGDLVMMFDIRHHRRVYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSSYPDRVNHDKLKKVLDM*
Ga0116229_1038538113300009500Host-AssociatedVKKREFKEGDLVMMFDARHHRRAYKKLLPKWFRPFVIKEVFADNGSYELENVDGSPYPDRVNHDKLKKVLDM*
Ga0116229_1053008413300009500Host-AssociatedVKKREFKEGDLVIMFDARHHCRAYKKLLPKWFGPFVIKEVFVDNGSYELENVDGSPYPDRVNHDKLKKILDM*
Ga0116229_1058757723300009500Host-AssociatedVKKKEFKEGDLVMMFNARHHHMAYKKLLPKWFGPFVIRKVFINNGFYELENVDGSPYLDC
Ga0116229_1101177523300009500Host-AssociatedVKKREFKEGDLVMMSDARHHRKAYKKLLPKWFGPFVIKKVFANNGSYELENVDGSPYPDRVNHDKLKKVLDM*
Ga0116230_1000262573300009510Host-AssociatedMGFKEGEFVMMFNIRDHCRVYKKLLPKWFGPFVIKKLFEDNGFYELENVDGSPYPDRINHDKLKKV*
Ga0116230_10004855123300009510Host-AssociatedMFNVQNHHRAYNKLLPKWFGPFVIKNMFVHNGYYELKNVDGSSYLNHVDHDKLKKVLDM*
Ga0116230_10013493123300009510Host-AssociatedVKKKEFKEGDLVMMFDVRHHRKAYKKLLPKWFGPFVIKKVFVDNGSYKFENVDGSSYPDYINHDKLKKVLDICNSEYEIHNEFESDII*
Ga0116230_1003418943300009510Host-AssociatedVKKKEFKEGDLVMIFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGFYELENVGGSPYTDRINHDKLKKVLDM*
Ga0116230_1006199113300009510Host-AssociatedVKKKKFKKNDLVMMFDIWHHYNVYKKLLPKWFGPFVIRKMFVDNGSYEFENVDGSPNLDCINHDKLKKVLDM*
Ga0116230_1008464923300009510Host-AssociatedVKKREFKEGDLVMMFDARHHHKAYKKLLLKWFGPFIIRKVYADNGFYELENVNGSPYPDRINHDKLKKVLDM*
Ga0116230_1009276813300009510Host-AssociatedMEFKKGDLVIMFDSRHHCKAYKKLLPKWFRPFIIKVYANNESYEQKNVDGSPYLDRINHDKLKKVLDM*
Ga0116230_1010007543300009510Host-AssociatedMKVKKKEFKESDLVMMFDARHHCKAYKKLLPKWFGLFVIKKVFDDNGSYELENVDGSPYPNHINHDKLKKVLDK*
Ga0116230_1016469943300009510Host-AssociatedVKKKEFKEGDLVMMFNARHHHRAYKKLLSKWFGPFIIKKVFVDNGSSELENVDGSPYLDHINHDKLKKVLDM*
Ga0116230_1016856113300009510Host-AssociatedMFDSRHHRKAYNKLLPKWFGPFVIKKVYVNNGFYELKNVDGSPYLDRINHDKLKKVLDM*
Ga0116230_1024918223300009510Host-AssociatedVNKKEFKKGDLVIMFDSRHHRKAYKKLLPKWFGPFVIKKVYANNGSYELKNVDGSPYLNRINHDKLKKVLNM
Ga0116230_1036878433300009510Host-AssociatedVKKKEFKEGDLVMMFDARHHRRVYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYPDRINHDKLKK
Ga0116230_1055772423300009510Host-AssociatedVKKKEFKEGDLVMMFDARHHRKAYKKLLPKWFGPFVIKNVFADNGFYELENVDGSPYPDRINHDKLKKVLHM*
Ga0116230_1067118913300009510Host-AssociatedVKRKEFKKGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYPDHINHDTLKKVLDM*
Ga0116230_1070200133300009510Host-AssociatedVKKKEFKKGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFVDNESYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116230_1086706213300009510Host-AssociatedVKKRKFKEGDLVMMFDARHHCRVYKKLLPKWFGPFVIMKVFVDNGSYEIENVNGSPYPYRINHDKLKKKLDM*
Ga0116230_1090750813300009510Host-AssociatedVKKKEFNKGDLVMMFDAQHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELENVDDSPYPDRINHDKLKKVLDM*
Ga0116230_1102776313300009510Host-AssociatedVKKKEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELQNVDGSPYPNRVNHDKLKKVLNM*
Ga0116230_1134549513300009510Host-AssociatedMMFDTRHHCKAYKELLPKWFVVIRKMFADNGSYEFENVNGSPYLDRINQDKLKKVLDMKFRRHNP*
Ga0116109_107563913300009627PeatlandVKRREFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116231_10002838213300009697Host-AssociatedVKKKEFKEGDLVMMFNARHHHMVYKKLLPKWFGPFVIRKVFINNGFYELENVDGSPYLDRINHDKLKKVLDM*
Ga0116231_10007510253300009697Host-AssociatedVKKREFEESDLIMMFDIRYHRKANKKLLPKWFGPFIIKNVFTNNEFYDFKNVDGSLYLDCVNHDKLKKVLDI*
Ga0116231_10008249183300009697Host-AssociatedVKKREFKEGDLVMMFDVRHHRRAYKKLLPKWFRPFVIKDVFADNGSYELENVDGSPYLDRVNHDKLKKVLDM*
Ga0116231_10018228123300009697Host-AssociatedVKKKEFKEGDLVMMFDTRHHHRAYKKLLLKWFGPFLIKKVFADNGSYELKNVDGSPYPNRINHDKLKKVLNM*
Ga0116231_1002388413300009697Host-AssociatedMKKIKFKEGDLVMMFDVRHHRRAYKKLLPKWFGPFVIKKMFTDNGSYELENVDGSPYLDCINHNKLKKVLDM*
Ga0116231_1002465453300009697Host-AssociatedVKKREFKEGDLVMMFDVRHHRKAYKKLLPKWFGPFVIKKVFVDNGFYELENVDGSPYPDRINHDKLKKALDM*
Ga0116231_1004614523300009697Host-AssociatedVKEKEFREGDLVVMFDARHHRRAYNKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116231_1052996813300009697Host-AssociatedKKREFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSSYPDRVNHDKLKKVLDM*
Ga0116228_1000817313300009701Host-AssociatedVQVHQKNFFDKKVKKKEFKEGDLVMMFNVRHHRKAYKKLLLKWFGHFVIKNVFVDNGFYELENVDGSPYLDRINHEKLKKVLDM*
Ga0116228_1003990723300009701Host-AssociatedVKKKEFKEGDLVMMFNARHHCRAYKKLLPKWFGPFVIKKVFVDNGSYKLQNVDGSPYLDRVNHDKLKKVLNM*
Ga0116228_1004966353300009701Host-AssociatedVKKKEFKEGDLVMMFDARHDHRAYKKLLPKWLRPFVIKKMFADNGSYELENVDGSPYLDHINHDKLKKVLDM*
Ga0116228_1011992813300009701Host-AssociatedVKKKEFKEGDLVMIFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGFYELENVDGSPYTDRINHDKLKKVLDM*
Ga0116228_1019841123300009701Host-AssociatedMFDPRHHRRAYKKLLPKWFGPFVIKNVFVDNGSYELENVDGSPYPDCINHDKLKKVLDM*
Ga0116228_1022098013300009701Host-AssociatedMMFDVRHHHKAYKKLLPKWFRPFVIKNVFVDNGSYELENVDGSPYPDHINHDKLKKVLDM
Ga0116228_1022494213300009701Host-AssociatedVNKKEFKKGDLVIMFDSRHHRRAYKKLLPKWFGPFVIKKVYANNGSYELKNVDGSPYLNRINHDKLKKVLNM*
Ga0116228_1045859923300009701Host-AssociatedVKKKEFKKGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNESYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116228_1046639723300009701Host-AssociatedVKKKKFKEGDLVMMFDARHHRRAYTKLLPKWFGPFVIKKVFINNGSYEFENVDGSPYLDRINHDKLKTVLDM*
Ga0116228_1062221613300009701Host-AssociatedVKKREFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKMFADNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116228_1080787913300009701Host-AssociatedVKKRKFKEGDLVMMFDARHHCRVYKKLLPKWFGPFVIMKVFVDNGSYELENVNGSPYPYRINHDKLKKKLDM*
Ga0116227_10000492683300009709Host-AssociatedMKKKDFKEGDLIMMFNVQHHRKVYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYLNCINHDRLKKNLDM*
Ga0116227_1007245023300009709Host-AssociatedVKKKEFRDGDLVMMFNARHHLKAYKKLLSKRSRPFVIKKVFADNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116227_1008337643300009709Host-AssociatedVKKNEFREGDLVMMFDARHHRRAYKKLLSKWFGPFVIKKVFADNGFYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116227_1063812623300009709Host-AssociatedVKKREFKEGDLVMMFNAQHHRRAYNKLLPKWFGPFVIKKVFVDNGFYELGNVDGSPYPDRVNHDKLKKVLDM*
Ga0116226_1000429783300009787Host-AssociatedVKRKEFKEIDLVMMFDIRHHDRVYKKLLPKWFGTFVIKKVFINNGFYEFENVDGSPYLDHINHEKFKKVLDM*
Ga0116226_1005441233300009787Host-AssociatedVKKKEFKKSDLVMMFDVQHHRKAYKKLLPKWFGPFVIKKVYTDNGSYELENVDGLPYPNRINHDKLKKVLDM*
Ga0116226_1006143613300009787Host-AssociatedMMFNTQHHFRAYNKLLPKWFGPFVIRKVFVDNGFYELENVDGSPYPDCINHDKLEKKLNM
Ga0116226_1007089323300009787Host-AssociatedMFDIWHHRKVYKKLLPKWFGRFVIRKVFVDNESYEFENVDGSPYRNCINHDKLKKVLDM*
Ga0116226_1007892623300009787Host-AssociatedMFDARHHRRAYKKLLPKWFGTFVMKKVFVDNGSYELENVDDSPYPNHINHDKLKKVLDM*
Ga0116226_1008978123300009787Host-AssociatedMMFDVRHHRKAHNKLLPKWFRPFVIKKMFADNGSYELKNVDGSPYPDRINHDKLKKVLNM
Ga0116226_1015981223300009787Host-AssociatedMFNVWHHRKAYKKLLLKWFGHFVINNVFVDNGFYEFENVDGSPYLDRINHEKLKNVLDM*
Ga0116226_1021216323300009787Host-AssociatedMVFDTQHHCRAYKKLLPKWFGPFAIKNVFVDNGSYELENVDGSPYLNRINHDKLKNVLDM
Ga0116226_1022452323300009787Host-AssociatedMMFDTRHHRKAYKKLLPKWFGLFVIRKIFADNGSYEFENVDGSPYLDRINQDKLKKVLDMKFRGHNP*
Ga0116226_1030080523300009787Host-AssociatedMMFNVQNHHRAYEKLLPKWFKTFVIKNMFVDNGYYELKNVDGSSYLNHVDHDKLKKVLDM
Ga0116226_1031897533300009787Host-AssociatedVKKKEFKEGDLVMMFDARHHRRAHKKLLPKWFGPFVIKKVFVNNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116226_1034741223300009787Host-AssociatedMGFKEGELVMMFDIRDHCRVYKKFLPKWFGPFVIKKLFEDNGFYELENVDGSLYLNRINHDKLKKV*
Ga0116226_1037358613300009787Host-AssociatedVKKKEFKENDFVMMFDARHHRRAYNKLLPKWFGPFVIKKVFVDNGSYELETVDGSPYPDHINHDKLKKVLDM*
Ga0116226_1039300513300009787Host-AssociatedVKKREFKEGDLVMMFDARHHHKAYKKLLLKWFGPFIIRKVYGDNGFYELENVNGSPYPDRINHDKLKKVLDM*
Ga0116226_1039358213300009787Host-AssociatedLVMMFDVRHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYPDHINHDKLKKVLDM*
Ga0116226_1048162633300009787Host-AssociatedVKKKEFKEGDLVMMFNARHHNRAYKKLLPKWFGPFVIKKVFVDNGSSELENVDGSPYLDRINHDKLKKVLNM*
Ga0116226_1073519413300009787Host-AssociatedVAQTQQKKFFNEKVNKKEFKKGDLVMMFNSRHHRRAYKKLLPKWFGPFVIKKVYANNGSYELKNVDSSPYLDRINHDKLKMF*
Ga0116226_1078865913300009787Host-AssociatedMMFNARHHRRAYKKLLPKWFGPFVIKKMFVDNGSYELQNVDGSPYPNRVNHDKLKKVLNM
Ga0116226_1081711813300009787Host-AssociatedVKKKEFKEGDLVMMFKARHHHRAYKKLLPKWFGPFVIKKVFIDNGSYELENVDGSPYPKRINHDKLKKVLDM*
Ga0116226_1082905713300009787Host-AssociatedRHHCRVYKKLLPKWFGPFVIMKVFVDNGSYELENVNGSPYPYRINHDKLKKNLDM*
Ga0116226_1085387613300009787Host-AssociatedVKKNEFKKIDFVMMFDIQHHGRAYKKLLLKWFGTFVIRKVFINNGFYEFENVDGSPYLDHINHEKFKKVLDM*
Ga0116226_1109220613300009787Host-AssociatedKKEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELQNVDGSPYPNRVNHDKLKKVLNM*
Ga0116226_1109818213300009787Host-AssociatedVKKKEFKEGDLVMMFDTQHRHRAYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYPDCINHDKLKKVLDM*
Ga0116226_1112694713300009787Host-AssociatedVKKKEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYLDRINHDKLKKVLDM*
Ga0116226_1120284013300009787Host-AssociatedVKKKEFKKGDLVMMFDIRHHRRAFKKLLPKWFGPFVIKVFADNGSYELENVDGSPYPDRINHDKWKKVLDM*
Ga0116226_1124864823300009787Host-AssociatedVKKKEFKEGDLVMMFKARHHHRAHKNLLPKWFGPFVIKKVFIDNGSYELENVDGSPYPERINHD*
Ga0116226_1130802523300009787Host-AssociatedMMFNAQHHHKAYKKILPKWFGPFVIKKMFINNGSYEFKNVDGSPYLYHVNHDKLKKVLDM
Ga0116226_1143830923300009787Host-AssociatedAHARHHRRAYKKLLPKWFGPFVIKKVFVDNESYELDNVDGSPYPDRINHDKLKRVLDM*
Ga0116226_1145186413300009787Host-AssociatedMMFDAQHHCRVYKKLLPKWFGPFVIKKVFADNGSYEFQNVDGSPYPDRVNHDKLKKVLNM
Ga0116226_1169650913300009787Host-AssociatedFDVRHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYPDRINHDKLKKVLDM*
Ga0116226_1173343313300009787Host-AssociatedVKKQEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFANNRFYDLQNVDGSPYPNRVNHDKLKKVLNM*
Ga0116226_1185161213300009787Host-AssociatedVKKKEFKEGDLVMMFDTRHHRRAYKKLLPKWFGPFVIKKVFADNGSYELQNVDGSPYPDRVNHDKLKKVLD
Ga0116226_1210850013300009787Host-AssociatedLVMMFDVRHHRRAYKKLLPKWFGPFVIKKVFVDNGFYELENVDGSPYPDRIHHDKLKKVLDM*
Ga0181537_1012710013300014201BogVKKRVFKTGDLVMMYDSRHFRRAHKKLLPKWFGPYEIKEVFATNGTYSLRNLDGTNYPDRVNHDKLKKPYVNLLD*
Ga0208848_100448813300025509Arctic Peat SoilVMMYDSRHFRRAHKKLLPKWFGPYEIKEVFATNGTYSLRNLDGTNYPDRVNHDKLKKAYVDLLDS
Ga0209208_1000147143300027807Host-AssociatedMMFNVQNHHRAYNKLLPKWFGPFVIKNMFVHNGYYELKNVDGSSYLNHVDHDKLKKVLDM
Ga0209208_1000451773300027807Host-AssociatedVKKKEFKEGDLVMIFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGFYELENVDGSPYTDRINHDKLKKVLDM
Ga0209208_1000476573300027807Host-AssociatedMGFKEGEFVMMFNIRDHCRVYKKLLPKWFGPFVIKKLFEDNGFYELENVDGSPYPDRINHDKLKKV
Ga0209208_1000726263300027807Host-AssociatedVKKKEFKEGDLVMMFDVRHHRKAYKKLLPKWFGPFVIKKVFVDNGSYKFENVDGSSYPDYINHDKLKKVLDICNSEYEIHNEFESDII
Ga0209208_1002211923300027807Host-AssociatedMMFDVRHHRRAYKKLLPKWFGPFVNRKVYVDNGFYELENVNGSPYPDRINHDKLKKVLDM
Ga0209208_1002288193300027807Host-AssociatedMFDSRHHRKAYNKLLPKWFGPFVIKKVYVNNGFYELKNVDGSPYLDRINHDKLKKVLDM
Ga0209208_1002993113300027807Host-AssociatedVKKKEFKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFVDNGSYELQNVDGSPYRDRVNHDKLKKVLNM
Ga0209208_1004226033300027807Host-AssociatedMMFDIWHHYNVYKKLLPKWFGPFVIRKMFVDNGSYEFENVDGSPNLDCINHDKLKKVLDM
Ga0209208_1004777213300027807Host-AssociatedMMFDARHHCRVYKKLLPKWFGPFVIMKVFIDNGFYELENVNGSPYPYCIIHDKLKFFLDM
Ga0209208_1006028713300027807Host-AssociatedVKKKEFKEGDLVMMFDARHHRRVYKKLLPKWFGPFVIKKVFADNGSYELENVDGSPYPDRINHDKLKKVLDM
Ga0209208_1006366823300027807Host-AssociatedMMFDARHHHKAYKKLLLKWFGPFIIRKVYADNGFYELENVNGSPYPDRINHDKLKKVLDM
Ga0209208_1007698213300027807Host-AssociatedMEFKKGDLVIMFDSRHHCKAYKKLLPKWFRPFIIKVYANNESYEQKNVDGSPYLDRINHDKLKKVLDM
Ga0209208_1010582623300027807Host-AssociatedMMFDPRHHRRAYKKLLPKWFGPFVIKNVFVDNGSYELENVDGSPYPDCINHDKLKKVLDM
Ga0209208_1010886633300027807Host-AssociatedMKVKKKEFKESDLVMMFDARHHCKAYKKLLPKWFGLFVIKKVFDDNGSYELENVDGSPYPNHINHDKLKKVLDK
Ga0209208_1017457823300027807Host-AssociatedVKKNEFKEGDLIMMFDIRHHRRAYKKLLPKWFGPFVIKKVFVNNGFYELENVDGSPYLDRINHDKLKKVLNM
Ga0209611_10001189363300027860Host-AssociatedMRFNARHHRKAYKKLLPKWFRPFVIKKVFADNGSYEFENVDGSPYPGRINHDKLKKVLDM
Ga0209611_1000172983300027860Host-AssociatedMMFDVRHHHRAYKKLLPKWFGPFVIKKMFVDNVSYEFEIVNGSLYPDHINHDKLKKILHM
Ga0209611_10002275153300027860Host-AssociatedMTFDIRHHHKVYRKLLPKWFSPFVIRKVFINNGPYELKNVDDSPYLDRINHDKSKKKLDM
Ga0209611_10002364243300027860Host-AssociatedMFDIRYHRKANKNLLPKWFGPFIIKNVFTNNEFYDFKNVDGSLYLDCVNHDKLKKVLDIXSIVSLGMI
Ga0209611_10002384313300027860Host-AssociatedMKKIKFKEGDLVMMFDVRHHRRAYKKLLPKWFGPFVIKKMFTDNGSYELENVDGSPYLDCINHNKLKKVLDM
Ga0209611_10002453133300027860Host-AssociatedMFNAQHHRKVCKKLSPKWFGPFVIMKVFVDNGFYELENVDGLPYPYRINHDKLKKVLDMXFXGQNP
Ga0209611_1000565343300027860Host-AssociatedMMFDARHHRRAYKKLLPKWFGPFIIKKVFAYNGSYELENVDGSPYPGYVNHDKLKKVLNMSIMSLGVT
Ga0209611_1000890643300027860Host-AssociatedVKKEEFKEGDLVMMFNVRHHHMAYKKLLPKWFGPFVIRKVFINNGFYELENVDGSPYVDRINHDKLKKVLNM
Ga0209611_10010706233300027860Host-AssociatedVKKKEFREGDLVMMFNARHHRKAYKKLLPKRSRPFVIKKVFADNGSYELENVDGSPYPDRINHDKLKKILDM
Ga0209611_1001699153300027860Host-AssociatedMFDIXHHCRVYKKYLPKWFGPFVIKKMFTNNEYYELENVNGSPYLDCVNHDKLKKNLNMXFQGRNP
Ga0209611_1002430813300027860Host-AssociatedVKKREFKEGDLVMMFDVRHHRKAYKKLLPKWFGPFVIKKVFVDNGFYELENVDGSPYPDRINHDKLKKALDM
Ga0209611_1002772823300027860Host-AssociatedVKKREFKEGDLVMMFDARHHRRAYKKLLPKWFRPFVIKEVFADNGSYELENVDGSPYPDRVNHDKLKKVLDM
Ga0209611_1003033073300027860Host-AssociatedMKKKEFKESDLVMMFDVRHHHRVCKKLLPKWFGPFVIKNVFADNGFYELENVDGSPYPDRINHDTFKKVLDM
Ga0209611_1003380623300027860Host-AssociatedMFNAXHHHRAYKKLLPKWFGPFVIKTVFVDNGSYELENVNGSPYPDRVNHDKLKKVLDMXFQGRNP
Ga0209611_1004296013300027860Host-AssociatedVKKKEFKEGDLVMMFDTRHHHRAYKKLLLKWFGPFLIKKVFADNGSYELKNVDGSPYPNRINHDKLKKVLDM
Ga0209611_1004829213300027860Host-AssociatedVKKREFKEGDLVIMFDARHHCRAYKKLLPKWFGPFVIKEVFVDNGSYELENVDGSPYPDRVNHDKLKKILDM
Ga0209611_1005218513300027860Host-AssociatedVKEKEFREGDLVVMFDARHHRRAYNKLLPKWFGPFVIKKVFVDNGSYELENVDGSPYPDRINHDKLKKVLDM
Ga0209611_1005228623300027860Host-AssociatedMMSDARHHRKAYKKLLPKWFGPFVIKKVFANNGSYELENVDGSPYPDRVNHDKLKKVLDM
Ga0209611_1005332453300027860Host-AssociatedMMFNARHHHMAYKKLLPKWFGPFVIRKVFINNGFYELENVDGSPYLDCINHDKLKKVLDM
Ga0209611_1007491023300027860Host-AssociatedMLFDPRHHHKAYKKLLPKWFEPFVIKKVFADNKSYELENVNDSPYSNRINLDKLKKVLDM
Ga0209611_1008535043300027860Host-AssociatedVKKREFKEGDLVMMFDIRHHRRVYKKLLPKWFGPFVIKKVFVDNGSYELENVDGSSYPDRVNHDKLKKVLDM
Ga0209611_1009999913300027860Host-AssociatedVKNREFKEGDFVMTFDILHHPMVYKKLLPKWFGPFVIRKEFADTGSYEFENVNGSPYPNHIGHDKLKKVLNM
Ga0209611_1058666623300027860Host-AssociatedKEGDLVMMFDARHHRRAYKKLLPKWFGPFVIKKVFADNGSYELGNIDGSPYPDRVNHDKLKKVLDM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.