NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058608

Metagenome / Metatranscriptome Family F058608

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058608
Family Type Metagenome / Metatranscriptome
Number of Sequences 134
Average Sequence Length 143 residues
Representative Sequence MRSRAILMCVAMAMAATAGWAQTSGGASPSGSPIEGVWRCEMHGLPAVTLTVTNEDGSLTGAVLFYLHRREPGQPETATPGVPEPLFHPKFDGKMLTFEVSHRRAHPPGSLQDGPVSFALKLDGADKAEFVNENEHDPNAPRYFLVKSAY
Number of Associated Samples 94
Number of Associated Scaffolds 134

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 63.16 %
% of genes near scaffold ends (potentially truncated) 50.00 %
% of genes from short scaffolds (< 2000 bps) 70.15 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.761 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(30.597 % of family members)
Environment Ontology (ENVO) Unclassified
(44.776 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.493 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 1.69%    β-sheet: 37.08%    Coil/Unstructured: 61.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.70
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtln12gtl0.65
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtln12gtl0.65
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtlm12gtl0.64
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtlo12gtl0.64
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtlm12gtl0.64
b.61.7.1: Extracellular hemoglobin linker subunit, receptor domaind2gtlo12gtl0.64
b.61.3.1: D-aminopeptidase, middle and C-terminal domainsd1ei5a21ei50.62
b.61.1.0: Avidin/streptavidind3szha_3szh0.62
b.61.3.1: D-aminopeptidase, middle and C-terminal domainsd1ei5a21ei50.62
b.61.1.0: Avidin/streptavidind3szha_3szh0.62


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 134 Family Scaffolds
PF01145Band_7 19.40
PF14534DUF4440 16.42
PF00392GntR 5.97
PF00873ACR_tran 3.73
PF02922CBM_48 2.99
PF01112Asparaginase_2 2.24
PF00903Glyoxalase 1.49
PF0209660KD_IMP 1.49
PF04879Molybdop_Fe4S4 1.49
PF13474SnoaL_3 1.49
PF07366SnoaL 0.75
PF05025RbsD_FucU 0.75
PF00709Adenylsucc_synt 0.75
PF03315SDH_beta 0.75
PF13358DDE_3 0.75
PF02517Rce1-like 0.75
PF06831H2TH 0.75
PF00255GSHPx 0.75
PF00892EamA 0.75
PF12695Abhydrolase_5 0.75
PF08281Sigma70_r4_2 0.75
PF00581Rhodanese 0.75
PF03403PAF-AH_p_II 0.75
PF13470PIN_3 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 134 Family Scaffolds
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 2.24
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 1.49
COG0104Adenylosuccinate synthaseNucleotide transport and metabolism [F] 0.75
COG0266Formamidopyrimidine-DNA glycosylaseReplication, recombination and repair [L] 0.75
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.75
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.75
COG1760L-serine deaminaseAmino acid transport and metabolism [E] 0.75
COG1869D-ribose pyranose/furanose isomerase RbsDCarbohydrate transport and metabolism [G] 0.75
COG4154L-fucose mutarotase/ribose pyranase, RbsD/FucU familyCarbohydrate transport and metabolism [G] 0.75
COG4188Predicted dienelactone hydrolaseGeneral function prediction only [R] 0.75
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.76 %
UnclassifiedrootN/A2.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004082|Ga0062384_101461752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium505Open in IMG/M
3300004092|Ga0062389_100433447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1444Open in IMG/M
3300005591|Ga0070761_10210897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1153Open in IMG/M
3300005591|Ga0070761_10921464All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005712|Ga0070764_10006634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5544Open in IMG/M
3300009633|Ga0116129_1004553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00686332Open in IMG/M
3300009633|Ga0116129_1212183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300010341|Ga0074045_10580524All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300014160|Ga0181517_10093819All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300014167|Ga0181528_10001954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006812654Open in IMG/M
3300014167|Ga0181528_10003591All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9503Open in IMG/M
3300014167|Ga0181528_10088424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1690Open in IMG/M
3300014167|Ga0181528_10144039All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1289Open in IMG/M
3300014167|Ga0181528_10154242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1242Open in IMG/M
3300014169|Ga0181531_10000970All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006818615Open in IMG/M
3300014169|Ga0181531_10153315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1393Open in IMG/M
3300014169|Ga0181531_10657113All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300014489|Ga0182018_10009107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7334Open in IMG/M
3300014491|Ga0182014_10162438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1246Open in IMG/M
3300014492|Ga0182013_10006480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13249Open in IMG/M
3300014493|Ga0182016_10009336All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9741Open in IMG/M
3300014493|Ga0182016_10047543All Organisms → cellular organisms → Bacteria3385Open in IMG/M
3300014495|Ga0182015_10095553All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2068Open in IMG/M
3300014499|Ga0182012_10020736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685898Open in IMG/M
3300014499|Ga0182012_10725535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300014501|Ga0182024_10006522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae25576Open in IMG/M
3300014501|Ga0182024_10120865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683747Open in IMG/M
3300014501|Ga0182024_10179292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2928Open in IMG/M
3300014658|Ga0181519_10471679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300014658|Ga0181519_10523407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300017938|Ga0187854_10362518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300018040|Ga0187862_10865588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300018044|Ga0187890_10577072All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300019787|Ga0182031_1559541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1512Open in IMG/M
3300021181|Ga0210388_10000811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24941Open in IMG/M
3300021181|Ga0210388_10299871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1412Open in IMG/M
3300021405|Ga0210387_10127517Not Available2157Open in IMG/M
3300021433|Ga0210391_11347219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M
3300023091|Ga0224559_1001087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae15505Open in IMG/M
3300025463|Ga0208193_1025692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1515Open in IMG/M
3300025664|Ga0208849_1194813All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300027879|Ga0209169_10002822All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10335Open in IMG/M
3300028552|Ga0302149_1005832All Organisms → cellular organisms → Bacteria3396Open in IMG/M
3300028552|Ga0302149_1101489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300028560|Ga0302144_10005745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4135Open in IMG/M
3300028560|Ga0302144_10014332All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2579Open in IMG/M
3300028560|Ga0302144_10017994All Organisms → cellular organisms → Bacteria2287Open in IMG/M
3300028560|Ga0302144_10122231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium839Open in IMG/M
3300028565|Ga0302145_10054180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1403Open in IMG/M
3300028572|Ga0302152_10181777All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300028574|Ga0302153_10065163All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1226Open in IMG/M
3300028748|Ga0302156_10100613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1465Open in IMG/M
3300028762|Ga0302202_10489903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300028775|Ga0302231_10153181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium962Open in IMG/M
3300028776|Ga0302303_10229306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae637Open in IMG/M
3300028779|Ga0302266_10351871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300028780|Ga0302225_10044639All Organisms → cellular organisms → Bacteria2203Open in IMG/M
3300028780|Ga0302225_10344740All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300028783|Ga0302279_10115500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1391Open in IMG/M
3300028783|Ga0302279_10153039All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300028788|Ga0302189_10225908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300028801|Ga0302226_10255175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300028801|Ga0302226_10426565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300028909|Ga0302200_10469000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300029882|Ga0311368_10085022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2748Open in IMG/M
3300029882|Ga0311368_10216954All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1503Open in IMG/M
3300029883|Ga0311327_10511791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium734Open in IMG/M
3300029907|Ga0311329_10280796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300029907|Ga0311329_10382530All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium991Open in IMG/M
3300029913|Ga0311362_10389673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1373Open in IMG/M
3300029913|Ga0311362_10408116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1325Open in IMG/M
3300029914|Ga0311359_11189378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium500Open in IMG/M
3300029917|Ga0311326_10197255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300029939|Ga0311328_10410054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300029943|Ga0311340_10381367All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1303Open in IMG/M
3300029944|Ga0311352_11084337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300029951|Ga0311371_10257394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682512Open in IMG/M
3300029951|Ga0311371_10480377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1649Open in IMG/M
3300029951|Ga0311371_10546979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1509Open in IMG/M
3300029952|Ga0311346_10587424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1002Open in IMG/M
3300029952|Ga0311346_11229360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300029953|Ga0311343_11384688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300029955|Ga0311342_10713230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium788Open in IMG/M
3300029993|Ga0302304_10102392All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1096Open in IMG/M
3300029994|Ga0302283_1093963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1258Open in IMG/M
3300029997|Ga0302302_1188805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300029999|Ga0311339_11917285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300030004|Ga0302186_10163837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium781Open in IMG/M
3300030007|Ga0311338_11714865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae569Open in IMG/M
3300030011|Ga0302270_10081432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2101Open in IMG/M
3300030057|Ga0302176_10164021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium882Open in IMG/M
3300030058|Ga0302179_10085354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1398Open in IMG/M
3300030225|Ga0302196_10252137All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300030399|Ga0311353_10606629All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium956Open in IMG/M
3300030503|Ga0311370_10020207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10240Open in IMG/M
3300030503|Ga0311370_10023738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9369Open in IMG/M
3300030503|Ga0311370_10390919All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681753Open in IMG/M
3300030508|Ga0302185_10099116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300030520|Ga0311372_10540944Not Available1691Open in IMG/M
3300030520|Ga0311372_11237033All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium952Open in IMG/M
3300030617|Ga0311356_10473261All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1228Open in IMG/M
3300030618|Ga0311354_10216177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682037Open in IMG/M
3300030646|Ga0302316_10071075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1522Open in IMG/M
3300030646|Ga0302316_10329444All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300030687|Ga0302309_10326224All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300030688|Ga0311345_11183976All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300030737|Ga0302310_10562575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300030741|Ga0265459_13522617All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300030862|Ga0265753_1058515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300030906|Ga0302314_10016053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12680Open in IMG/M
3300030906|Ga0302314_11304317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus aquaticus671Open in IMG/M
3300030906|Ga0302314_11521471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300030906|Ga0302314_11604253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300031028|Ga0302180_10011918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5903Open in IMG/M
3300031090|Ga0265760_10056489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1188Open in IMG/M
3300031233|Ga0302307_10376326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae723Open in IMG/M
3300031234|Ga0302325_10679259All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1490Open in IMG/M
3300031236|Ga0302324_102104860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300031236|Ga0302324_102948001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300031258|Ga0302318_10385139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300031261|Ga0302140_10550482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium880Open in IMG/M
3300031524|Ga0302320_10276094All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2269Open in IMG/M
3300031708|Ga0310686_110052471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16173Open in IMG/M
3300031708|Ga0310686_110590752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis6487Open in IMG/M
3300031708|Ga0310686_111165507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae19234Open in IMG/M
3300031708|Ga0310686_112652706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis3288Open in IMG/M
3300031708|Ga0310686_115199628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium627Open in IMG/M
3300031837|Ga0302315_10018525All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5250Open in IMG/M
3300033405|Ga0326727_10034020All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8856Open in IMG/M
3300034065|Ga0334827_008702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4577Open in IMG/M
3300034124|Ga0370483_0161258All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300034163|Ga0370515_0351738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300034282|Ga0370492_0110613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1124Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa30.60%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog27.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.22%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog5.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.99%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.24%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.24%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil2.24%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost2.24%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.49%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.49%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.49%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.75%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.75%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.75%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.75%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300009633Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025664Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028909Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300029994Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4EnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030508Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062384_10146175213300004082Bog Forest SoilSPSGSPIEGVWRCEMHGLPAVTLTVTNEDGSLTGAVLFYLHRREPGQPETATPGVPEPLFHPKFDGKMLTFEVSHRRAHPPGSLQDGPVSFALKLDGADKAEFVNENEHDPNAPRYFLVKSAY*
Ga0062389_10043344733300004092Bog Forest SoilMRSRAILMCVAMAMAATAGWAQTSGGASPSGSPIEGVWRCEMHGLPAVTLTVTNEDGSLTGAVLFYLHRREPGQPETATPGVPEPLFHPKFDGKMLTFEVSHRRAHPPGSLQDGPVSFALKLDGADKAEFVNENEHDPNAPRYFLVKSAY*
Ga0070761_1021089713300005591SoilRGMPSRLLSKSVLTAMLLATGLSQASQPADPTSSQNAAITGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPSFDGKTFTFQVSHRRAHPPNSLNDPPVTFQLKLDGTRKAELVNENEEDPNAPVFILEKSAY*
Ga0070761_1092146413300005591SoilPSASSNASVAPVLGIWRCQMEGLPAVTLTMTNEGGTLTGAVLFYSHRGDPGQPVTATPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLEDTPVTFQLKLDGTDKAELVNETANDRNAPEYVLVKSVY*
Ga0070764_1000663473300005712SoilMRIKAILLCAVLAMLTSTGWAQPGGGTNANASPLEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRTEPGKAETATPGVPEPVFHPKFNGKTLTFEVSHRRAHPPGSLQDGPVNFALKIDGPDKAEFVNESEHDPKAPRYFLVKSAY*
Ga0116129_100455323300009633PeatlandMKSRDVLAGVVLAMMATSGWAAAGGANRGAGAAPIEGVWRCQMEGLPAVTLTVTEEGGTLTGAVLFYLHKREPGQPVSATPGAPEPLLNPRFDGKTLRFQVSHRRAHPPDSLQDEPVNFQLKLDGPNTGEFVNESEPDPNRPRYVLVKSAY*
Ga0116129_121218313300009633PeatlandMKSRNVLAGVLLAMLATSGWAAAGGANAGAGAASIEGVWRCQMEGLPAVTLTVTEEGGTLTGAVLFYLHKREPGQPVSATPGVPEPLLNPRFDGKTLRFQVSHRRAHPPGSFDDEPVNFQLRLDGPNRGEFVNE
Ga0074045_1058052413300010341Bog Forest SoilASGQGDSNLAPVVGIWRAQMEGLPAITLTVTDEGGSLTGAVLFYLHRRERGQPVTSTPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNASEPDPKAPAFVLVKSAY*
Ga0181517_1009381923300014160BogVAGEGESMRNRVVLALVALAMLSTAGFSQASVSGTVADKSPILGIWRCQMDGLPAVTLTVTDEGGSLRGAVLFYLHRRDPGQTVTATPGVPEPLFNPKFDGQTLAFEVSHRRAHPPGSLHDGPVSFKLRLDGADKAELVNESERDPNAPVFVFVRSEY*
Ga0181528_10001954143300014167BogMKTRMIVVRIAIMMLSTACLSQSSSKAINAPLLGIWRCQMDSLPAVTLNLTDENGSLTGAILFYLHRRDPGQPVTASPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLNDPPVTFQLKLNADGKAALINENERDPNAPAVIFTKSDY*
Ga0181528_1000359173300014167BogMRRIVMKTRIAVLCASLAVLAATAQSQSAAPSQPANTASIFGIWRCQMDGLPAVALNITDEGGSLSGAVLFYLHRRDPGQPVTASAGVPEPLFHPRFDGKTLSFEVSHRRAHPPRTLNDPPVAFQVTLQGPDKAQLINLSEAHDPNAPVYILVRSEY*
Ga0181528_1008842443300014167BogMKIKIFSTVAAFAILATSAIAQSNSTAASAPLLGVWRCEMHGLPAVTLTVTDEGGNLNGAVLFYLHKTEPGKAETATPGVPEPLFNPKIDGQTLTFQVSHRRAHPPGSLQDAPVTFRVKLIGPDKAEFVNENEHDPNAPAYLLTKSEY*
Ga0181528_1014403923300014167BogFSQASVSGTVADKSPILGIWRCQMDGLPAVTLTVTDEGGSLRGAVLFYLHRRDPGQTVTATPGVPEPLFNPKFDGQTLAFEVSHRRAHPPGSLHDGPVSFKLRLDGADKAELVNESERDPNAPVFVFVRSEY*
Ga0181528_1015424223300014167BogMRSKVFLVCTALAMAATAVSAQTSSSANVSTPSIEGVWRCQMNGLPAITLTITQEGGSLSGAVLFYLHRREPGKAETATPGVPEPLFHPKFDGKTLTFEVSHRRAHPPQTLESRPVRFELKLDGSEKAELVKEGEDDPNAPVFMLVRSQY*
Ga0181531_1000097023300014169BogMRSRSAFLCALLIVIAAGAGSQTTGSKEGTGAANTASIEGVWRAQMDGLPAITLTITDESGSLSGAVLFYLHRRDEGRPVTATPGVPEPLFSPKFDGKILTFQVSHRRAHPPDSLQDAPVSFRLKLTGPDKGEFVNENEENPNAPVFVLVRSEY*
Ga0181531_1015331513300014169BogGRNAGHHGNRKTTGIETGAEEPGEETTMKIKIFSTVAAFAIMATFAIAQSNSTAASAPLLGVWRCEMHGLPAVTLTVTDEGGNLNGAVLFYLHKTEPGKAETATPGVPEPLFNPKIDGQTLTFQVSHRRAHPPGSLQDAPVTFRVKLIGPDKAEFVNENEHDPNAPAYLLTKSEY*
Ga0181531_1065711313300014169BogMTILAAVCAAQASGPGDARVAPVVGIWRAQMEGLPAITLTVTDEGGRLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGSAALVSESEPDPRAPAFV
Ga0182018_1000910723300014489PalsaMVRIAMAMTAAAGLAQAGSGANATVAPIEGVWRCEMNGLPAVTITVTNEGGSLTGAVLFYLHRRDPGKPETATPGIPEPLFNPKFDGKTLTFQVSHRRAHPPRTLEDGPVSFELKLDGTDKAELVNQNEHDPNMPKFVLVKSEY*
Ga0182014_1016243823300014491BogMLAMVGLSQTSRTDRAANTSDIVGIWRCQMDGLPAVTLTVTNEGGNLAGAVLFYLHRRDAGQPVTATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPESLNDGPVSFQLKLTGPGKGELVNEDERDPNAPKFVLTKSEY*
Ga0182013_10006480103300014492BogMRSKSSLLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQLVNENEQDPNAPVYVFVRSAY*
Ga0182016_1000933673300014493BogMRSKEIMAWIAMVMVAATGLAQAGTTNAVMAPIEGVWRCEMNGLPAVTLTVTNEGGNLTGAVLFYLHRRDPGIPETASPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGSLNDGPVSFALRLDGADKAEFVNENEHDPNAPRFLLVRSAY*
Ga0182016_1004754333300014493BogMMLALAAASSISQARQTKANADPSPIVGIWRCQMDGLPAVTLTVTDEGGSLTGAILFYLHRRDPGQPVTAIPGVPEPLFHPKFDGKVLTFQVSHRRAHPPESLQDEPAAFELKLAGNDKGDLVVENEHDPNAPQFVFVRSAY*
Ga0182015_1009555313300014495PalsaMRSSIVLMCVAFTAFAGSCAGQSSRPSSLDVAPVVGIWRAQMEGLPAMTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGADNAALVNESEPDPKAPAFVLVKSAY*
Ga0182012_1002073643300014499BogMRRRAIIAWLALGMAATAGLAQSGSATIGSVSPIEGVWRCEMNGLPAVTLTVTNEGGSLTGAVLFYLHRRDPGKAETATAGVPEPLFDPKFDGKTLTFQVSHRRAHPPGSLNDGPVSFALRLDGADKAEFVNENEHDPNAPRFFLVKSAY*
Ga0182012_1072553513300014499BogMKYRSILASIAMMMLAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPPVTFQLTLDANGNAALINENERDPNAPAFLFTRTDY*
Ga0182024_10006522153300014501PermafrostMLAATGLSQASQPADPINTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPTFDGKTFTFQVSHRRAHPPKSLNDAPVTFQLKLDGTQKAELVNENEKDPNAPVYVLERSAY*
Ga0182024_1012086543300014501PermafrostMVMTSMAGLAQTSSTSAASIEGIWRCQMEDLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGADRAEFVNENEHDLNAPVYVLVKSAY*
Ga0182024_1017929223300014501PermafrostMAMLATAGFAQANGTGNPTASTASIVGIWRCQMEGLPAITLTLTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGADRAEFVNENEHDPNAPRYFLVKSPY*
Ga0181519_1047167913300014658BogSANVSTPSIEGVWRCQMNGLPAITLTITQEGGSLSGAVLFYLHRREPGKAETATPGVPEPLFHPKFDGKTLTFEVSHRRAHPPQTLESRPVRFELKLDGSEKAELVKEGEDDPNAPVFMLVRSQY*
Ga0181519_1052340713300014658BogNRFVLALVALAMLSTAGFSQASVSGTVADKSPILGIWRCQMDGLPAVTLTVTDEGGSLRGAVLFYLHRRDPGQTVTATPGVPEPLFNPKFDGQTLAFEVSHRRAHPPGSLHDGPVSFKLRLDGADKAELVNESERDPNAPVFVFVRSEY*
Ga0187854_1036251823300017938PeatlandVLMAMLATAGFSQTNRPSEATDKASIEGVWRADMDGLPAITLTVTTENGSLTGAVLFYLHRRDPGQAITATPGVPEPLFNLKFDGTTLTFQVSHRRAHPPRTLNDPPVTFRLKLDGADRGELVNEDERDSNAPVFVLERSAY
Ga0187862_1086558813300018040PeatlandSGTGTATNKWPIEGVWRADMDGLPAITLTVTTENGSLTGAVLFYLHRRNPGQAITATPGVPEPLFNLKFDGTTLTFQVSHRRAHPPRTLNDPPVTFRLKLDGADRGELVNEDERDSNAPVFVLERSAY
Ga0187890_1057707213300018044PeatlandMRSSIVLMCVAFTAFAGSCAGQSSRPSSLDVAPVVGIWRAQMEGLPAMTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGADNAALVNESEPDPKAPAFVLVKSEY
Ga0182031_155954143300019787BogMRLRGASERGKRSSAARWWRVAAQMEGLPAVTLTITDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNASEPDPKAPAFVLVKSAY
Ga0210388_1000081173300021181SoilMAMAATAGWAQTSSSASVASIEGVWRCEMHGLPAVTLTVTDEGGSLTGAVLFYLHRSEPGKAETATAGVPEPLFHPQFDGNMLTFQVSHRRAHPPGSLQDEPVRFALKLDGADKAEFVDENEHDPNAPRYFLVKSAY
Ga0210388_1029987123300021181SoilMRSKAILVCIAMTMTATAGWTQASSAVSANIAAVEGVWRCDMHGLPAMTLTVTDEGGSLTGAVLFYLHRREPGKAETATPGVPEPLFNPKFDGNTLTFQVSHRRAHPPGSLNDEPVKFVLKLDGADNAEFVNESEHDPNAPRYFLVKSAY
Ga0210387_1012751723300021405SoilMRSKAILVCIAMTMTATAGWTQASSAVSANIAAVEGVWRCDMHGLPAMTLTVTDEGGSLTGAVLFYLHRREPGKAETATPGVPEPLFNPKFDGNTLTFQVSHRRAHPPGSLNDEPVKFALKLDEAGNAEFVNESEHDPNAPRYFLVKSAY
Ga0210391_1134721913300021433SoilMKSRITLSCIAIAMLAIASQATSTRAQTVRGKPIAPSDASVAPILGIWRCQMEGLPAVTLTVTDEGGTLTGAVLFYLHRRAPGQAVTATPGVPEPLFNPIFDGKALTFQVSHRRAHPPGSLEDAPVTFQVKLDSAGNAQLLNESANDPKAPVYVLVKSAY
Ga0224559_1001087143300023091SoilMKMRTVVVCSFLAMLAMAGLSQTGRTDRAANTSDIVGIWRCQMEGLPAVTLTVTDEGGSLAGAVLFYLHRRDAGQPVTATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPESLNDGPVSFQLKLTGTDKGELVNESERDPNAPVFVLTKSEY
Ga0208193_102569223300025463PeatlandMKSRDVLAGVVLAMMATSGWAAAGGANRGAGAAPIEGVWRCQMEGLPAVTLTVTEEGGTLTGAVLFYLHKREPGQPVSATPGAPEPLLNPRFDGKTLRFQVSHRRAHPPDSLQDEPVNFQLKLDGPNTGEFVNESEPDPNRPRYVLVKSAY
Ga0208849_119481313300025664Arctic Peat SoilTNRASSAMEATDRASITGIWRAQMDGLPAITLTVTDEGGSLAGAVLFYLHRRDPGQSVTATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGSLHDGPVRFQLKLSGADKGEFVNENEQDPNAPVFVLKKSTY
Ga0209169_1000282283300027879SoilMRIKAILLCAVLAMLTSTGWAQPGGGTNANASPLEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRTEPGKAETATPGVPEPVFHPKFNGKTLTFEVSHRRAHPPGSLQDGPVNFALKIDGPDKAEFVNESEHDPKAPRYFLVKSAY
Ga0302149_100583223300028552BogMRSKSILASVLITISAATGISQANRPNETASTAPIVGIWRCEMDGLPAVTLNVTDESGSLKGAVLFYLHRRDPGQPVTATPGVPEPLFDPKFDGKVLRFQVSHRRAHPPGSLQDVPVSFELKLNDDGKAELVNQSEPDLNMPVFIFARSAY
Ga0302149_110148913300028552BogMRSKSSLLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQLVNENEQDPNA
Ga0302144_1000574523300028560BogMRSKSSLLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQLVNENEQDPNAPVYVFVRSAY
Ga0302144_1001433253300028560BogMKLRIIVTFSAIMMLATACHSQPNSKASNTPILGIWRCQMDGLPAVTLNLTDENGSLAGAILFYLHRRDPGQPVTASPGVPEPLFNPMFDGKTLTFQVSHRRAHPPGSLGDRPVTFQLKLHGDGKAALINENESDPNAPAFIFTKNDY
Ga0302144_1001799423300028560BogMRSKSILASVLITISAATGISQANRPNETASTAPIVGIWRCEMDGLPAVTLNVTDESGSLKGAVLFYLHRRNPGQPVTATPGVPEPLFDPKFDGKVLRFQVSHRRAHPPGSLQDVPVSFELKLNDDGKAELVNQSEPDLNMPVFIFARSAY
Ga0302144_1012223113300028560BogMKYRSILASIAMMMLAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPP
Ga0302145_1005418023300028565BogMKNKILLACAMLAMLVTTALSQPSAPSPAANTAPILGIWRCQMEGLPAVTLTLTDESGSLTGAVLFYLHRRDPGQPVTATPGVPEPLFHPRFDGQTLTFEVSHRRAHPPRTLNDPPVTFELRLNGADKAQLIFEHRKADPNAPVYILVRSAY
Ga0302152_1018177723300028572BogMKYRRILASIAMMMLAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPPVTFQLTLDANGNAALINENERDPNA
Ga0302153_1006516323300028574BogMRSKVVSMCVAMTMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYALVKSDY
Ga0302156_1010061323300028748BogMKYRSILASIAMMMLAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPPVTFQLTLDANGNAALINENERDPNAPAFLFTRTDY
Ga0302202_1048990313300028762BogTGISQANRPNETASTAPIVGIWRCEMDGLPAVTLNVTDESGSLKGAVLFYLHRRDPGQPVTATPGVPEPLFDPKFDGKVLRFQVSHRRAHPPGSLQDVPVSFELKLNDDGKAELVNQSEPDLNMPVFIFARSAY
Ga0302231_1015318113300028775PalsaMRSSIVLMCVAFTAFAGSCAGQSSRPSSLDVAPVVGIWRAQMEGLPAMTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGADNAALVNESEPDPKAPAFVLVKSAY
Ga0302303_1022930623300028776PalsaMRSRTFMIWIAMAMTAAAGLAQAGSGANASMAPIEGVWRCEMNGLPAVTLTVTNESGDLSGAVLFYLHRRDPGKPETATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGAHQAELVNENEQDPNAPLFVLVRSAY
Ga0302266_1035187113300028779BogTMLASVCAAQVSGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYALVKSDY
Ga0302225_1004463943300028780PalsaMRIGSVLICTMLATMAPTGWAQTNDTANSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0302225_1034474013300028780PalsaMRSRTFMIWIAMAMTAAAGLAQAGSGANASVAPIEGVWRCEMNGLPAVTLTVTNESGDLSGAVLFYLHRRDPGKPETATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGAHQAELVNENEQDPNAPLFVLVRSAY
Ga0302279_1011550023300028783BogVRQRIILACALFTLAAVPASAQPSATAQPAATAPIAGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLIHPRFDGHTLTFEVSHRRAHPPRTLNDPPVTFELRLIGDGQAQLVNDHEQADPHAPMYMLVHSAY
Ga0302279_1015303913300028783BogMKLRIIVTFSAIMMLATACHSQPNSKASNTPILGIWRCQMDGLPAVTLNLTDENGSLAGAILFYLHRRDPGQPVTASPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLGDPPVSFQLKLDPDGKTASSSGNEHDPNAPIYVFTRTDY
Ga0302189_1022590813300028788BogMKYRSILASIAMMMLAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPPVTFQLTLDANGNAALINENERDPNAPAFLFT
Ga0302226_1025517513300028801PalsaCIAIAMLAIAIPATSTLAPAVLAKPSASSNASVAPVLGIWRCQMEGLPAVTLTMTNEGGTLTGAVLFYLHRRDPGQPVTATPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLEDTPVTFQLKLDGTDKAELVNETANDRNAPEYVLVKSVY
Ga0302226_1042656513300028801PalsaQIVGVWRCEMHGLPAVTLTVTDEDGSLTGAVLFYLHKMAQGQAETATPGVPEPIFHPSFDGKTLTFEVSHRRAHPPQSLDDAPMRFEVRLNGDGRAELVSAMEDDPKAPRYFMEKSAY
Ga0302200_1046900013300028909BogMRSKSILASVLITISAATGISQANRPNETASTAPIVGIWRCEMDGLPAVTLNVTDESGSLKGAVLFYLHRRNPGQPVTATPGVPEPLFDPKFDGKVLRFQVSHRRAHPPGSLQDVPVSFELKLNDDGKAELVNQSEPDLNMPVF
Ga0311368_1008502253300029882PalsaMKSRITSICIAIAMLAIAIPATSTLAPAVLAKPSASSNASVAPVLGIWRCQMEGLPAVTLTMTNEGGTLTGAVLFYLHRRDPGQPVTATPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLEDTPVTFQLKLDGTDKAELVNETANDRNAPEYVLVKSVY
Ga0311368_1021695423300029882PalsaVLMCVAMSMLAGGCTAQTSRPSDASLAPVVGVWRAQMEGLPAMTLTVTDEGGSLTGAVLFYLHRREPGQPATATPGVPEPLSHPQFDGKTLMFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNESEPDPRAPAYVLVKSAY
Ga0311327_1051179123300029883BogMTMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYALVKSDY
Ga0311329_1028079633300029907BogRSGEINQGRSIVRQRIILACALFTLAAVPASAQPSATAQPAATAPIAGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLIHPRFDGHTLTFEVSHRRAHPPRTLNDPPVTFELRLIGDGQAQLVNDHEQADPHAPMYMLVHSAY
Ga0311329_1038253023300029907BogMKPRSILVPLAMMIFATACFAQSSAGKINSAPILGVWRSQMEGLPAVTLTVTDEGGSLAGAVLFYLHRREPGQPVTVTPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLGDPPVSFQLKLDPDGKTASSSGNEHDPNAPIYVFTRTDY
Ga0311362_1038967313300029913BogMRSRLFGISVLAAVLAATGLSQASQPADSTNTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFLPRFDGKTFTFQVSHRRAHPPGTLNDAPVTFQLKLDGAGKAQLLMNESENDPNAPVYILEKSAY
Ga0311362_1040811623300029913BogMRSKVVSMCVAITMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYALVKSDY
Ga0311359_1118937813300029914BogVFLMWVAMTMLASVCAAQAGGSTDSSVAPVVGVWRAQMEGLPGITLTVTDEGGNLSGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGNTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNESENDPKAPAFVLVKSAY
Ga0311326_1019725513300029917BogLSQPSAPSPAANTAPILGIWRCQMEGLPAVTLTLTDESGSLTGAVLFYLHRRDPGQPVTATPGVPEPLFHPRFDGQTLTFEVSHRRAHPPRTLNDPPVTFELRLNGADKAQLIFEHRKADPNAPVYILVRSAY
Ga0311326_1048810113300029917BogMRSKSILASVLITISAATGISQANRPNETASTAPIVGIWRCEMDGLPAVTLNVTDESGSLKGAVLFYLHRRDPGQPVTATPGVPEPLFDPKFDGKVLRFQVSHRRAHPPGSLQDVPVSFELKLNDDGKAE
Ga0311328_1041005423300029939BogEPTHRNRSGEINQGRSIVRQRIILACALFTLAAVPASAQPSATAQPAATAPIAGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLIHPRFDGHTLTFEVSHRRAHPPRTLNDPPVTFELRLIGDGQAQLVNDHEQADPHAPMYMLVHSAY
Ga0311340_1038136713300029943PalsaMKSRVVLMCVAMSMLAGGCTAQTSRPSDASLAPVVGVWRAQMEGLPAMTLTVTDEGGSLTGAVLFYLHRREPGQPATATPGVPEPLSHPQFDGKTLMFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNESEPDPRAPAYVLVKSAY
Ga0311352_1108433713300029944PalsaMRSKLLSASVLTATLAATGLLQASQPADPTNTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPVFDGKTFTFQVSHRRAHPPGSLNDAPVTFQLKLDGT
Ga0311371_1025739413300029951PalsaMKLQAVILSTGMAALTAVCFAHPKNTDTPNADPAPVIGVWRCDMHSLPAVTLTVTNEGGSLNGAVLFYLHKMEKGQPETATPGVPEPLIHPSFDGKTFTFQVSHRRAHPPQSLNDGPVTLALKLSGSGKAELVNTSENDPNAPVYEFVKNDY
Ga0311371_1048037723300029951PalsaMCAAFALMASAGLAQATKPGEMTTGAAPVEGVWRCDMNGLPAVTLTVTNESASLTGAVLFYLHRRDPGKPETATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGTLEDAPVTFELRLDGPDKAEFVNDTERDPNAPRFVLVRSAY
Ga0311371_1054697933300029951PalsaAGLAQAGSGANATVAPIEGVWRCEMNGLPAVTITVTNEGGSLTGAVLFYLHRRDPGKPETATPGIPEPLFNPKFDGKTLTFQVSHRRAHPPRTLEDGPVSFELKLDGTDKAELVNQNEHDPNMPKFVLVKSEY
Ga0311346_1058742413300029952BogAIGCFSQSGAVNKANAAPILGVWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTAAPGVPEPLFNPTFGGKTLTFRVSHRRAHPPGSLGDPPVTFQLTLDANGNAALINENERDPNAPAFLFTRTDY
Ga0311346_1122936013300029952BogMRSRLFGISVLAAVLAATGLSQASQPADSTNTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFLPRFDGKTFTFQVSHRRAHPPRTLNDAPVTFQLK
Ga0311343_1138468813300029953BogMRSKVVSMCVAMTMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYA
Ga0311342_1071323023300029955BogLSQANRPSKTPDRAPILGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTATPGVPEPLFSPSFDGKTFTFQVSHRRAHPPGSLHDVPVSFELKLNGPDKAELVNEDENDPNGPRYILVRSAY
Ga0302304_1010239223300029993PalsaMRIGSVLICTMLATMAPTGWAQTNDTANSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSA
Ga0302283_109396313300029994FenMKLRIIVTFSAIMMLATACHSQPNSKASNTPILGIWRCQMDGLPAVTLNLTDENGSLAGAILFYLHRRDPGQPVTASPGVPEPLFNPMFDGKTLTFQVSHRRAHPPGSLGDRPVTFQLKLHGDGKAA
Ga0302302_118880513300029997PalsaAIAMLAIAIPATSTLAPAVLAKPSASSNASVAPVLGIWRCQMEGLPAVTLTMTNEGGTLTGAVLFYLHRRDPGQPVTATPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLEDTPVTFQLKLDGTDKAELVNETANDRNAPEYVLVKSVY
Ga0311339_1191728513300029999PalsaMKSRITSICIAIAMLAIAIPATSTLAPAVLAKPSASSNASVAPVLGIWRCQMEGLPAVTLTMTNEGGTLTGAVLFYLHRRDPGQPVTATPGVPEPLFNPTFDGKTLTFQVSHRRAHPPGSLEDTPVTFQLKLDGTDKAEL
Ga0302186_1016383723300030004BogMRSKSSLLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQLVNENEQDP
Ga0311338_1171486523300030007PalsaMATAATAGWAQTSGAASASVASIEGVWRCEMHGLPAMTLTVTDEGGNLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNENEHDPNAPRYFLVKSVY
Ga0302270_1008143213300030011BogMRSKVVSMCVAITMLASVCAAQVSGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPAYALVKSDY
Ga0302176_1016402123300030057PalsaMRIGSVLICTMLATMAPTGWAQTNDTANSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFL
Ga0302179_1008535423300030058PalsaMASAGLAQATKPGEMTTGAAPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0302196_1025213713300030225BogMRSKVVSMCVAMTMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAP
Ga0311353_1060662923300030399PalsaVSLVGITMAMLASTGWAQTNSAANSSVAQVEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNENEHDPNAPRYFLVKSVY
Ga0311370_1002020793300030503PalsaMKIRFLLLCAMALVIAPALHAQSNTNKQDITGIWRCQMEGLPAVTLTVTNEEGSLTGAVLFYLHRREPGHAVTATPGVPEPLFHPSFDGKTFTFDVSHRRAHPPQTMNDGPVTFQLKLDGPDKAELLNENEHDPNAPVYILTRTAY
Ga0311370_1002373833300030503PalsaMRSSIVLMCVAFTAFAGSCAGQSSRPSSLDVAPVVGIWRAQMEGLPAMTLTVSDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGADNAALVNESEPDPKAPAFVLVKSAY
Ga0311370_1039091913300030503PalsaMRSKLFNISVLIAVLAATALSLASQPADSKITSDAAITGIWRCQMDGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTAAPGVPEPLFHPSFDGKTFTFQVSHRRAHPPESLNDAPVTFQLRLDGAQKAELV
Ga0302185_1009911613300030508BogMRSKSSLLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQ
Ga0311372_1054094433300030520PalsaMRSRVSLVGIAMAMLASTGWAQTNSAANSSVAQVEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNESEHDPNAPRYFLVKSAY
Ga0311372_1123703323300030520PalsaMRSKLIRVSVLTATLAATGLLQASQPADPTNTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPSFDGKTLTFQVSHRHAHPPESLNDPPVTFALKLAGPDKAQLANESESDPNAPVYEFVKSDY
Ga0311356_1047326133300030617PalsaMAMLASTGWAQTNSAANSSVAQVEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNENEHDPNAPRYFLVKSVY
Ga0311354_1021617713300030618PalsaMRSRTFMIWIAMAMTAAAGLAQAGSGANASVAPIEGVWRCEMNGLPAVTLTVTNESGDLSGAVLFYLHRRDPGKPETATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGAHQAELVNENEQDPNAP
Ga0302316_1007107533300030646PalsaVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0302316_1032944413300030646PalsaMKIRFLLLCAMALVIAPALHAQSNTNKQDITGIWRCQMEGLPAVTLTVTNEEGSLTGAVLFYLHRREPGQAVTATPGVPEPLFHPSFDGKTFTFDVSHRRAHPPQTMNDGPVTFQLKLDGPDKA
Ga0302309_1032622413300030687PalsaMKLQAVILSTGMAALTAVCFAQPKNTDTPNADPAPVIGVWRCDMHSLPAVTLTVTNEGGSLNGAVLFYLHKMEKGQPETATPGVPEPLIHPSFDGKTFTFQVSHRRAHPPQSLNDGPVTLALKLSGSGKAELVN
Ga0311345_1118397613300030688BogLFGISVLAAVLAATGLSQASQPADSTNTPDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFLPRFDGKTFTFQVSHRRAHPPGTLNDAPVTFQLKLDGAGKAQLLMNESENDPNAPVYILEKSAY
Ga0302310_1056257523300030737PalsaAMLASTGWAQTNSAANSSVAQVEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNENEHDPNAPRYFLVKSVY
Ga0265459_1352261723300030741SoilMRSRLFSVSVLTAMLAATGLSRASQPADPINTPDAAITGIWRCQMEGLPAVTLTVTEEGGSLSGAVLFYLHRREPGRPVTATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGTLHDGPVSFELKLDGADKGEFV
Ga0265753_105851523300030862SoilMKSRIVLGCVVMAMTTIAGLAQTSSASAASIVGIWRCQMEGLPAVTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGSLSDGPVSFELKMDGADKGEFVNENEHDPNAPRYFLVKSEY
Ga0302314_1001605313300030906PalsaQTNDTANSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0302314_1130431723300030906PalsaLVIAPALHAQSNTNKQDITGIWRCQMEGLPAVTLTVTNEEGSLTGAVLFYLHRREPGHAVTATPGVPEPLFHPSFDGKTFTFDVSHRRAHPPQTMNDGPVTFQLKLDGPDKAELLNENEHDPNAPVYILTRTAY
Ga0302314_1152147113300030906PalsaMRSRVSLVGIAMAMLASTGWAQTNSAANSSVAQVEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRSEPGKAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDEPASFALKLDGADKAEFVNESEHDPNAPRYFLV
Ga0302314_1160425313300030906PalsaAATGLSQASQPADPTNTPNAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPSFDGKTLTFQVSHRHAHPPESLNDPPVTFALKLAGPDKAQLANESESDPNAPVYEFVKSDY
Ga0302180_1001191873300031028PalsaNSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0265760_1005648923300031090SoilMRSRIVLGCVVMAMTTMAGPAQTSSASAASIEGVWRCQMEGLPAVTLTLTDEGGGLTGAVLFYLHRREPGQAVTATPGVPEPLFNPRFDGKTLTFQVSHRRAHPPGSLQDGPVNFALKLDGADRAEFVNENEHDPNAPVYMLVRSAY
Ga0302307_1037632623300031233PalsaMRSRTFMIWIAMAMTAAAGLAQAGSGANASVAPIEGVWRCEMNGLPAVTLTVTNESGDLSGAVLFYLHRRDPGKPETATPGVPEPLFNPKFDGKTLTFQVSHRRAHPPGSLNDGPVNFALKLDGAHQAELVNENEQDPNAPLFVLVR
Ga0302325_1067925923300031234PalsaMRSKAIMVRIAMAMTAAAGLAQAGSGANATVAPIEGVWRCEMNGLPAVTITVTNEGGSLTGAVLFYLHRRDPGKPETATPGIPEPLFNPKFDGKTLTFQVSHRRAHPPRTLEDGPVSFELKLDGTDKAELVNQNEHDPNMPKFVLVKSEY
Ga0302324_10210486023300031236PalsaMRSKLFNISVLIAVLAATALSLASQPADSKITSDAAITGIWRCQMDGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPSFDGKTLTFQVSHRHAHPPESLNDPPVTFALKLAGPDKAQLANESESDPNAPVYEFVKSDY
Ga0302324_10294800113300031236PalsaARLITAEVGEMKSRIALVGVAITMLAMASLAQAGSPGETGFTPILGVWRCQMEGLPAVTLTMTDEGGTLTGAVLFYLHRRNPGLPVTATPGAPEPLFNPKFDGKTLTFQVSHRRAHPPGSLQDAPVTFQLKLDGAGNAELVNENEHDPNAPTYVLVKCAY
Ga0302318_1038513913300031258BogMRSKVVSMCVAMTMLASVCAAQASGSDDSSVAPVVGVWRAQMEGLPAMTLTVTDEGGSLSGAVLFYLHRREPGQPVTATPGAPEPLLHLQFDGKTLTFQVSHRRAHPPGSMQDGPVTFRLMLDGAGNAALVSVSEPDPNAPA
Ga0302140_1055048213300031261BogPSATAQPAATAPIAGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLIHPRFDGHTLTFEVSHRRAHPPRTLNDPPVTFELRLIGDGQAQLVNDHEQADPHAPMYMLVHSAY
Ga0302320_1027609443300031524BogMKLGIVTACALMAMLPVTGLSQANRPSKTPDRAPILGIWRCQMEGLPAVTLTVTDEGGSLTGAVLFYLHRRDPGQPVTATPGVPEPLFSPSFDGKTFTFQVSHRRAHPPGSLHDVPVSFELKLNGPDKAELVNEDENDPNGPRYILVRSAY
Ga0310686_11005247183300031708SoilMRSKAILLCAVLAMAATAGWAQPGGSTNASASPIEGVWRCEMRGLPAVTLTVTNEGGSLAGAVLFYLHRTEPGQAETATPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVNFALKLDGPDKAEFVNENEHDPNAPRYFLVKSAY
Ga0310686_11059075233300031708SoilMRSRVVLMCVAMTMLAGACAAQAAGSSDSSLAPVVGIWRSQMEGLPAMTLTVTDEGGALSGAVLFYLHRREPGQPVTATPGVPEPLFNPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNESEPDPKAPAFVLVKSEY
Ga0310686_11116550763300031708SoilMKSRMMLMCAALGMLACSGAAQTDAPANIGVKSIVGIWRSQMEGLPAITLTVTDEGGSLTGAVLFYLHRREPGQETTATPGVPEPLFNPKFEGRTLTFQVSHRRAHPPGSLEDAPVTFRVTLDDADHAVLMNESAYDPKAPVYVLVKTAY
Ga0310686_11265270663300031708SoilMRIKAILLCAALAMLTSAGWAQPGGGTNANASPLEGVWRCEMHGLPAVTLTVTNEGGSLTGAVLFYLHRTEPGKAETATPGVPEPLFNPKFNGKTLTFEVSHRRAHPPGSLQDGPVNFALKIDGPDKAEFVNESEHDPKAPRYFLVKSAY
Ga0310686_11519962813300031708SoilMRSKAILMCVAMAMAATAGWAQTSSGASVASIEGVWRCEMHGLPAVTLTVTDEGGSLTGAVLFYLHRSEPGKAETATAGVPEPLFHPQFDGNMLTFQVSHRRAHPPGSLQDESVRFALKLDGADKAEFVDENEHDPNAPRYFLVKSAY
Ga0302315_1001852513300031837PalsaLICTMLATMAPTGWAQTNDTANSSVTPVEGVWRCDMNGLPAVTLTVTNEGGKLTGAVLFYLHRREPGKAETATAGVPEPLFHPKFDGNTLTFQVSHRRAHPPGSLQDEPVNFALKLDGAGKAEFVNENEHDPNAPRYFLVKSAY
Ga0326727_1003402093300033405Peat SoilMRSGLVLVCVAMTVLSCGCAAQASGQGDSNLAQVVGIWRAQMEGLPAITLTVTDEGGSLTGAVLFYLHRREQGQPVTSTPGVPEPLFHPQFDGKTLTFQVSHRRAHPPGSLQDGPVTFRLMLDGAGNAALVNASEPDPKAPAFVLVKSAY
Ga0334827_008702_2651_30853300034065SoilLCIVLATMATAGLSQASQTKTVAAASSIVGIWRCQMDGLPAVTLTVTDESGSLTGAVLFYLHRRDPGQPVTAMPGVPEPLFNPKFDGKTLAFQVSHRRAHPPGSLQDAPVSFELKLTGNDKGQLVNENEQDPNAPVYVFVRSAY
Ga0370483_0161258_1_4233300034124Untreated Peat SoilMATAGVFAQSGGTTEKTSAGATSLEGVWRAEMDGLPAITLTLTNEGGRLTGAVLFYLHRREAGQPVTATPGVPKPLFKPTFDGRTLTFQVSHRRAHPPQTLADGPITFDLKMTGADRGELVDENEREPGAPLFVLVRSAY
Ga0370515_0351738_1_3813300034163Untreated Peat SoilMLAATGLSQASQPADSTNSTDAAITGIWRCQMEGLPAVTLTVTNEGGSLTGAVLFYLHRREPGQPVTATPGVPEPLFHPSFDGKTFTFQVSHRRAHPPKTLNDAPVTFQLKLSGAEKAQLLMNESEN
Ga0370492_0110613_528_9833300034282Untreated Peat SoilMKTKSLLMYVTLALAAASGLSQPSRTKTVADHSSIIGIWRCQMDGLPAVTLTVTDESGSLTGAILFYLHRRDPGQPVTATPGVPEPLFNPKFDGKALTFQVSHRRAHPPGSLQDAAVPFELKLTSDDKGELVNEDEHDPNAPSFVFVRSAY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.