| Basic Information | |
|---|---|
| Family ID | F058480 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLRITTEKKRGKTVLSVEGRLAGPWVAALEQCWRELHAAS |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.34 % |
| % of genes near scaffold ends (potentially truncated) | 98.52 % |
| % of genes from short scaffolds (< 2000 bps) | 86.67 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.148 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (37.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.53% β-sheet: 20.59% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF01042 | Ribonuc_L-PSP | 35.56 |
| PF03601 | Cons_hypoth698 | 2.22 |
| PF13620 | CarboxypepD_reg | 1.48 |
| PF13185 | GAF_2 | 1.48 |
| PF16576 | HlyD_D23 | 1.48 |
| PF00248 | Aldo_ket_red | 0.74 |
| PF13305 | TetR_C_33 | 0.74 |
| PF13437 | HlyD_3 | 0.74 |
| PF13193 | AMP-binding_C | 0.74 |
| PF08281 | Sigma70_r4_2 | 0.74 |
| PF13006 | Nterm_IS4 | 0.74 |
| PF02629 | CoA_binding | 0.74 |
| PF12704 | MacB_PCD | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 35.56 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 2.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.15 % |
| Unclassified | root | N/A | 11.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02JFR5O | Not Available | 508 | Open in IMG/M |
| 2228664022|INPgaii200_c1156418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1312 | Open in IMG/M |
| 3300000955|JGI1027J12803_100211950 | Not Available | 514 | Open in IMG/M |
| 3300000955|JGI1027J12803_100233304 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300002908|JGI25382J43887_10471923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300003223|JGI26343J46809_1002388 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300004092|Ga0062389_100849826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300004092|Ga0062389_101817384 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005186|Ga0066676_10225629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1214 | Open in IMG/M |
| 3300005332|Ga0066388_100878445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1478 | Open in IMG/M |
| 3300005468|Ga0070707_100119943 | All Organisms → cellular organisms → Bacteria | 2553 | Open in IMG/M |
| 3300005468|Ga0070707_101228384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300005602|Ga0070762_10679425 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006086|Ga0075019_10051882 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
| 3300006102|Ga0075015_100611263 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006163|Ga0070715_10464768 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006172|Ga0075018_10460375 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006797|Ga0066659_10820551 | Not Available | 771 | Open in IMG/M |
| 3300006797|Ga0066659_11326304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300006903|Ga0075426_10289524 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300007255|Ga0099791_10667339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300007265|Ga0099794_10164013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300007265|Ga0099794_10542458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300009038|Ga0099829_11618708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300009088|Ga0099830_10460361 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300009089|Ga0099828_11733713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300009089|Ga0099828_11976511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300010043|Ga0126380_10427402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 993 | Open in IMG/M |
| 3300010048|Ga0126373_10120242 | All Organisms → cellular organisms → Bacteria | 2455 | Open in IMG/M |
| 3300010048|Ga0126373_13051482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010343|Ga0074044_10574121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300010360|Ga0126372_12359917 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010362|Ga0126377_12816681 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300010362|Ga0126377_13194749 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010366|Ga0126379_13680852 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010398|Ga0126383_12592817 | Not Available | 590 | Open in IMG/M |
| 3300011270|Ga0137391_10563918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
| 3300011270|Ga0137391_11045888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300012096|Ga0137389_10022817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4430 | Open in IMG/M |
| 3300012189|Ga0137388_10286378 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300012202|Ga0137363_10974505 | Not Available | 720 | Open in IMG/M |
| 3300012202|Ga0137363_11168568 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012203|Ga0137399_10077136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2518 | Open in IMG/M |
| 3300012203|Ga0137399_10868047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012203|Ga0137399_11023111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300012205|Ga0137362_10995277 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300012210|Ga0137378_11487487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012349|Ga0137387_11179812 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012351|Ga0137386_11314973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300012357|Ga0137384_11336961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300012361|Ga0137360_10857512 | Not Available | 782 | Open in IMG/M |
| 3300012361|Ga0137360_11014895 | Not Available | 716 | Open in IMG/M |
| 3300012361|Ga0137360_11089195 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012362|Ga0137361_10500479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300012362|Ga0137361_11745928 | Not Available | 541 | Open in IMG/M |
| 3300012582|Ga0137358_10918201 | Not Available | 573 | Open in IMG/M |
| 3300012582|Ga0137358_11036637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300012683|Ga0137398_10054528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2381 | Open in IMG/M |
| 3300012683|Ga0137398_10478276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300012918|Ga0137396_10699773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300012918|Ga0137396_10717500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300012918|Ga0137396_10896657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300012923|Ga0137359_11289832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300012925|Ga0137419_10199816 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300012925|Ga0137419_10947905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300012927|Ga0137416_10470670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300012927|Ga0137416_11143075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300012927|Ga0137416_12038333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012929|Ga0137404_10273179 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300012929|Ga0137404_11123665 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300014154|Ga0134075_10084293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
| 3300014325|Ga0163163_10732304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300016341|Ga0182035_12137134 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300017942|Ga0187808_10047122 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300018006|Ga0187804_10131955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300020579|Ga0210407_10349102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300020579|Ga0210407_10759687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300020580|Ga0210403_10096910 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300020580|Ga0210403_11135986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300021086|Ga0179596_10273837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300021088|Ga0210404_10279372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300021168|Ga0210406_10370010 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300021168|Ga0210406_10589606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300021178|Ga0210408_10098250 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300021181|Ga0210388_10450293 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300021401|Ga0210393_10091758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2413 | Open in IMG/M |
| 3300021402|Ga0210385_11402731 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300021403|Ga0210397_10981699 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021432|Ga0210384_10127487 | All Organisms → cellular organisms → Bacteria | 2283 | Open in IMG/M |
| 3300021433|Ga0210391_10202309 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
| 3300021475|Ga0210392_10345966 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300021478|Ga0210402_11797412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300021559|Ga0210409_11137436 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300025441|Ga0208456_1009375 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300025441|Ga0208456_1073264 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025905|Ga0207685_10133705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1104 | Open in IMG/M |
| 3300025906|Ga0207699_10506911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300025910|Ga0207684_10659142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| 3300026088|Ga0207641_11130691 | Not Available | 782 | Open in IMG/M |
| 3300026320|Ga0209131_1264967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300026499|Ga0257181_1018184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1022 | Open in IMG/M |
| 3300026523|Ga0209808_1011522 | All Organisms → cellular organisms → Bacteria | 4474 | Open in IMG/M |
| 3300026548|Ga0209161_10164499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300026551|Ga0209648_10017001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6344 | Open in IMG/M |
| 3300026551|Ga0209648_10673996 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300026557|Ga0179587_10462800 | Not Available | 830 | Open in IMG/M |
| 3300026557|Ga0179587_10654102 | Not Available | 692 | Open in IMG/M |
| 3300027655|Ga0209388_1053472 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300027862|Ga0209701_10224780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300027862|Ga0209701_10291590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300027875|Ga0209283_10115665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300027875|Ga0209283_10946324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027908|Ga0209006_11282615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300028536|Ga0137415_10699741 | Not Available | 826 | Open in IMG/M |
| 3300028536|Ga0137415_11280211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300028884|Ga0307308_10006120 | All Organisms → cellular organisms → Bacteria | 5211 | Open in IMG/M |
| 3300029636|Ga0222749_10491478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300029636|Ga0222749_10624061 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300029817|Ga0247275_1053485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1138 | Open in IMG/M |
| 3300030524|Ga0311357_10031221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5531 | Open in IMG/M |
| 3300030746|Ga0302312_10192615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300030969|Ga0075394_10713557 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031446|Ga0170820_10725202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300031474|Ga0170818_106193189 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031668|Ga0318542_10206695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300031708|Ga0310686_115897846 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300031753|Ga0307477_10840613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300031754|Ga0307475_10256181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
| 3300032008|Ga0318562_10522929 | Not Available | 687 | Open in IMG/M |
| 3300032044|Ga0318558_10475494 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300032180|Ga0307471_100372468 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300032782|Ga0335082_10969217 | Not Available | 714 | Open in IMG/M |
| 3300032805|Ga0335078_10622298 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300033158|Ga0335077_10183482 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 37.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.48% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003223 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025441 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_03898980 | 2189573000 | Grass Soil | MLRITTEKNASKTVLSVEGRLAGALVATLEQCWKELKAAAPHEKST |
| INPgaii200_11564181 | 2228664022 | Soil | MLRVTTDKKKSKTVLSVEGRLAGQNVATLEQCWRDLRSASPQEKFYVNLCG |
| JGI1027J12803_1002119502 | 3300000955 | Soil | MLRVTTEKKKSKTVLSVEGRLAGQNVATLEQCWRELR |
| JGI1027J12803_1002333041 | 3300000955 | Soil | MLRVTTDKKKSKTVLSVEGRLAGENVATLEQCWRELRSASPQEKFYVNLCGVSFI |
| JGI25382J43887_104719232 | 3300002908 | Grasslands Soil | MLRITTEKKRGKIFLSVEGRLAGPWVAALEQCWRELHAASPREKFHVNL |
| JGI26343J46809_10023881 | 3300003223 | Bog Forest Soil | MLRITTERKRGRTVLSVEGRLAGAWVGTLEQCWRERAPEEK |
| Ga0062389_1008498263 | 3300004092 | Bog Forest Soil | MLRITTEQKRGKLILSVEGRLAGQWVGALEQCWRELRASSP |
| Ga0062389_1018173841 | 3300004092 | Bog Forest Soil | VLRITTEQKRGKLMLRVEGRLAGQWVAALEQCWRELRGSAPAGKFS |
| Ga0066676_102256291 | 3300005186 | Soil | MLRITTEKKRGKTVLSVEGRLAGPWVAALEQCWRELHAAS |
| Ga0066388_1008784453 | 3300005332 | Tropical Forest Soil | MLRVTTDKKKSKTVLSVEGRLAGQNVATLEQCWRELHSASPQEKFYVNLCGV |
| Ga0070707_1001199433 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITTNRKRGKVTLSVEGRLAGPSLGTLEQCWRELRTSSPSEKFSVDLCGV |
| Ga0070707_1012283841 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHLMRPALEKPMLRITTEKKRVKTVLSVEGRLAGPLVSTLEQCWRELKAASPQEKFYVNLCG |
| Ga0070762_106794251 | 3300005602 | Soil | MLRITIDKKRGKTVLSVEGRLAGPWVGALEQCWRERTPGEKFNVDLC |
| Ga0075019_100518821 | 3300006086 | Watersheds | MLRISTDRKRGKVTLNVEGRLAGPSVSTLEQCWRELRA |
| Ga0075015_1006112632 | 3300006102 | Watersheds | VLRITTEQKRGKLVLSIEGRLAGQSVATLEQCWRELRTSTPSGKFSVNLCGVSY |
| Ga0070715_104647681 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITIEQKSDKTSLTVEGKLAGPWVSALEQSWKDLRSSSSGESL |
| Ga0075018_104603751 | 3300006172 | Watersheds | MLRITSEKKKGKVVLTVEGRLTGPWVGTLEQCWRELRAA |
| Ga0066659_108205512 | 3300006797 | Soil | MLRITTEKKKAKTVLSVEGRLAGPFVPTLEQCWRELKMAFPQE |
| Ga0066659_113263042 | 3300006797 | Soil | MFRITTEKKRGKVVLTVEGRLAGQGVSTFEQCWRELR |
| Ga0075426_102895243 | 3300006903 | Populus Rhizosphere | MLRVTTKKKRGKTVLSIEGRLAGPLVGTLEQCWREIRGASPDEKLHLDLCGVS |
| Ga0099791_106673391 | 3300007255 | Vadose Zone Soil | MLRITTEKRRGKVFLSVEGKLTGPWVAALEQCWREL |
| Ga0099794_101640131 | 3300007265 | Vadose Zone Soil | MLQHTAGGTESMLRITTEKKRGKTILSVEGRLAGPSVATLEQCWRELRSSSPQEK |
| Ga0099794_105424582 | 3300007265 | Vadose Zone Soil | MLRITTEKKRGKTVLSVEGRLAGPSVATLEQCWRELRSSSPQE |
| Ga0099829_116187082 | 3300009038 | Vadose Zone Soil | MFRISTEKKRGKVVLTVEGRLAGQTVPTLEQFWRELRAASPEE |
| Ga0099830_104603611 | 3300009088 | Vadose Zone Soil | MLRITNEKKRGKIYLNVEGRLAGPWVATLEQCWRE |
| Ga0099828_117337131 | 3300009089 | Vadose Zone Soil | MFRISTEKKRGKVVLTVEGRLAGQTVPTLEQFWRELRAASP |
| Ga0099828_119765111 | 3300009089 | Vadose Zone Soil | MLRITTEKKRGKVLLSVEGRLAGPWVGALEQCWREL |
| Ga0126380_104274021 | 3300010043 | Tropical Forest Soil | MLRVTTDKKKTKTVLSVEGRLAGQNVATLEQCWRELR |
| Ga0126373_101202421 | 3300010048 | Tropical Forest Soil | MLRITTDKKKSKTVLSVEGRLVGPNVHTLEQCWRELRNAAPQEKFY |
| Ga0126373_130514822 | 3300010048 | Tropical Forest Soil | MLRITTENRRGKLFLTVEGSLAGPRVATLEQCWRELYAA |
| Ga0074044_105741211 | 3300010343 | Bog Forest Soil | MLRITTEQKRGKLVLSVEGRLAGQWVAALEQCWRELRASSP |
| Ga0126372_123599171 | 3300010360 | Tropical Forest Soil | MLRITTEQKKGKLVLNVEGRLAGPHVGTLEQTWRDARANNEKVS |
| Ga0126377_128166811 | 3300010362 | Tropical Forest Soil | MLRVTTDKKKSKTVLGVEGRLAGQNVATLEQCWRELRSASPQEKFYVNLCGVSFIDGA |
| Ga0126377_131947491 | 3300010362 | Tropical Forest Soil | MLRITTEQKKGKLVLNVEGRLAGPHVGTLEQTWRDARAN |
| Ga0126379_136808521 | 3300010366 | Tropical Forest Soil | MLRVTTDKKKSKTVVSVEGRLVGQNVATLEQCWRELRSASPQEKFYVNLCGVSFI |
| Ga0126383_125928171 | 3300010398 | Tropical Forest Soil | MLRVTTDKKKSKTVVSVEGRLVGQNVATLEQCWRELRSASPQEK |
| Ga0137391_105639181 | 3300011270 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVATLEQCWKELKAAAPHEKFYVNLCGV |
| Ga0137391_110458882 | 3300011270 | Vadose Zone Soil | MLRVTTLKKRSKVVLTVEGRLAGDSVSTLEQCWRE |
| Ga0137389_100228177 | 3300012096 | Vadose Zone Soil | MLRITTEKKRGKIFLSVEGRLAGPWVAALEQCWRELHAASPREKFHV |
| Ga0137388_102863783 | 3300012189 | Vadose Zone Soil | MLRITTEKKRGKVTLNVEGRIAGPWVPALEQCWRE |
| Ga0137363_109745052 | 3300012202 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGAWLATLEQCWKELKAAA |
| Ga0137363_111685681 | 3300012202 | Vadose Zone Soil | MLRVTTLKKRSKVVLTVEGRLAGDSVSTLEQCWRELRAASPTEKFNVDLC |
| Ga0137399_100771364 | 3300012203 | Vadose Zone Soil | MLRITTETKRGKIFLSVEGRLAGPWVATLEQCWRELHTASPR |
| Ga0137399_108680471 | 3300012203 | Vadose Zone Soil | MLRITTEKKRGKIFLGVEGRLAGPWVAALEQCWRELHAAAPREKFHVN |
| Ga0137399_110231111 | 3300012203 | Vadose Zone Soil | MLRITTEKKRGKTILSVEGRLAVPSVATLEQCWRELHSSSPNEKF |
| Ga0137362_109952771 | 3300012205 | Vadose Zone Soil | MLRITTEKKKAKTVLSVEGRLAGPFVATLEQCWRELRAAAPQEKF |
| Ga0137378_114874871 | 3300012210 | Vadose Zone Soil | MLRITTQKKRGKTVLSIEGRLAGPLVGTLEQCWRELHGGSPGER |
| Ga0137387_111798121 | 3300012349 | Vadose Zone Soil | MLRISTETKRSKRILSVEGRLAGPWVSALEQCWRELRTTSPAEKV |
| Ga0137386_113149731 | 3300012351 | Vadose Zone Soil | MLRITTEKKRGKIFLSVEGKLSGPWVAALEQCWREL |
| Ga0137384_113369611 | 3300012357 | Vadose Zone Soil | MLRITTQKKRGKTVLSIEGRLAGPLVGTLEQCWRELRAASPNEKVHLDL |
| Ga0137360_108575122 | 3300012361 | Vadose Zone Soil | MLRITTEKKRSKTILSVEGRLAGALVATLEQCWKELKAAAPQEKFYVNLC |
| Ga0137360_110148952 | 3300012361 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGTLVSTLEQCWKELK |
| Ga0137360_110891952 | 3300012361 | Vadose Zone Soil | MLRVTTLKKRSKVVLTVEGRLAGDSVSTLEQCWRELRAASPTEKFN |
| Ga0137361_105004791 | 3300012362 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVSTLEQCWKELKAAAPHEKFY |
| Ga0137361_117459281 | 3300012362 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVSTLEQCWKELKAAAPHEKF |
| Ga0137358_109182011 | 3300012582 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGTLVSTLEQCWKELKAAAPHEKFYV |
| Ga0137358_110366372 | 3300012582 | Vadose Zone Soil | MLRITTEKKRGKIILSVEGRLAVPSVATLEQCWRELHTSSPNEK |
| Ga0137398_100545285 | 3300012683 | Vadose Zone Soil | VTTQKKRFKVLLTIEGRLAGESVSTLEHCWKELRAASPSEKFNVDLCGVS |
| Ga0137398_104782762 | 3300012683 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVSTLEQCWKELKAA |
| Ga0137396_106997732 | 3300012918 | Vadose Zone Soil | MLRITTEKKRGKIVLGVEGRLAGPWVAALEQCWRELHAA |
| Ga0137396_107175002 | 3300012918 | Vadose Zone Soil | MLRVTTLKKRRKVTLSVEGRLAGPSVGTLEQCWRELRAASTNEKFSVNLCG |
| Ga0137396_108966571 | 3300012918 | Vadose Zone Soil | MLRVTTEKRRGKTALSVEGRLAGPWVGALEQCWRELHAA |
| Ga0137359_112898321 | 3300012923 | Vadose Zone Soil | MFRVTTQKKRFKVLLTIEGRLAGESVSTLEHCWKELRAASPTEKFNVDLC |
| Ga0137419_101998163 | 3300012925 | Vadose Zone Soil | MLRITTEKKRGKIFLGVEGRLAGPWVAALEQCWRELHAASPREKFH |
| Ga0137419_109479051 | 3300012925 | Vadose Zone Soil | MLRITTEKKRGKTVLSVEGRLSGPRVQMLEQCWRELRAGAPEERFHVN |
| Ga0137416_104706701 | 3300012927 | Vadose Zone Soil | MLRITTEKRRGKVFLSVEGKLAGASVATLGQCWRELHAASREKFHVNLCGVSFID |
| Ga0137416_111430752 | 3300012927 | Vadose Zone Soil | MVRITTEKKRGKIFLGVEGRLAGPWVAALEQCWRELHAAS |
| Ga0137416_120383332 | 3300012927 | Vadose Zone Soil | MLRITTEKKRGKTVLSVEGRLAVPSVATLEQCWRELR |
| Ga0137404_102731791 | 3300012929 | Vadose Zone Soil | MLRITTENKRGKLFLSVEGSLSGPRVATLEQCWRELSAATP |
| Ga0137404_111236652 | 3300012929 | Vadose Zone Soil | MLRITTEKKKAKIVLSVEGRLVGPFVPTLEQCWRELKAASPQEKFYVNLCG |
| Ga0134075_100842933 | 3300014154 | Grasslands Soil | MLRITTEKKRGKTVLSVEGRLAGPWVAALKQCWRELHAA |
| Ga0163163_107323042 | 3300014325 | Switchgrass Rhizosphere | MLRVTTDKKKSKTVLSVEGRLAGQNVATLEQCWRELRSA |
| Ga0182035_121371341 | 3300016341 | Soil | MLRITAENKKGKTLLRLEGKISGPHVGALEQCWRELLAASPKQKFSVDLC |
| Ga0187808_100471223 | 3300017942 | Freshwater Sediment | MLRITTEKKRGKTTLNVEGRLAGPWVAALEQCWRELH |
| Ga0187804_101319551 | 3300018006 | Freshwater Sediment | MLRITTETKRGKAIVTVEGRVAGPQVATLEQCWRELYAAAPKLKYVVN |
| Ga0210407_103491021 | 3300020579 | Soil | MLRITTEKKRFKTVLSVEGRLAGTLVATLEQCWKELRAASPQEKFFVDL |
| Ga0210407_107596871 | 3300020579 | Soil | MLRVTTQKKRTKVLLTVEGRLAGDSVSTLGQCWRELRAASPNE |
| Ga0210403_100969103 | 3300020580 | Soil | MLRITTENRRGKLFLSVEGSLSGPRVATLEQCWRE |
| Ga0210403_111359861 | 3300020580 | Soil | MFRITTEKKRAKTLLNVEGRLAGPWVATLEECWRELHAAS |
| Ga0179596_102738372 | 3300021086 | Vadose Zone Soil | MLRVTTLKKRSKVVLTVEGRLAGDSVSTLQQCWRELRAASPTEKFNVELC |
| Ga0210404_102793721 | 3300021088 | Soil | MLRVTTQKKRSKVLLTVEGRLAGDSVSTLGQCWRELR |
| Ga0210406_103700103 | 3300021168 | Soil | MLRITTENKRGKLFLSVEGSLSGPRVATLEQCWRELSAANPRPKF |
| Ga0210406_105896062 | 3300021168 | Soil | MLRVTTQKKRSKVLLTVEGRLAGESVSTLELCWRELRA |
| Ga0210408_100982504 | 3300021178 | Soil | MLRITSDKKKGKVVLTVEGRIAGPWVGTLEQCWRELRAASPDEKFSINLCGVS |
| Ga0210388_104502931 | 3300021181 | Soil | MLRITTENKRGRLFLSVEGSLSGPRVATLEQCWRELSATSPRPKFCINLCGVS |
| Ga0210393_100917581 | 3300021401 | Soil | MLRITTEKKRGKTVLSVEGRLAGPWVEALGQCWRTRSTEEKFS |
| Ga0210385_114027311 | 3300021402 | Soil | MLRITTEQKKGKVVLTVEGRLAGPHVGTLEQSWRDARASNE |
| Ga0210397_109816993 | 3300021403 | Soil | MLRITTEKKRGRTVLSVEGRLAGAWVGTLEQCWRERAPEEKF |
| Ga0210384_101274873 | 3300021432 | Soil | MLRITTENKRGKLFLSVEGSLSGPRVATLEQCWREL |
| Ga0210391_102023091 | 3300021433 | Soil | MLRITTEKKRGRTVMSVEGRLAGAWVGTLEQCWRERVQEEKFS |
| Ga0210392_103459661 | 3300021475 | Soil | MLRITTEKKRGRTVLSVEGRLAGAWVGTLEQCWRERAP |
| Ga0210402_117974121 | 3300021478 | Soil | MLRITTEQKRGKLILSVEGRLAGQWVSALEQCWRDLRTSNP |
| Ga0210409_111374361 | 3300021559 | Soil | MLRITTENKRGKLFLSVEGSLSGPRVATLEQCWRELSAA |
| Ga0208456_10093751 | 3300025441 | Peatland | MLRITTEQKRGRTTLTVEGRLAGAWVQALDDCWRRLSASAPADKFQVNLCG |
| Ga0208456_10732641 | 3300025441 | Peatland | MLRITTETKRGHLTLSIEGRLAGPWVAALEQCWRELL |
| Ga0207685_101337051 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITTEKKRTKTVLSVEGRLADPLVATLEQCWRELRAASPQEKFYVN |
| Ga0207699_105069112 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITTEKKRSKTVLSVEGRLAGTLVATLEQCWKELRAASPQE |
| Ga0207684_106591422 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRITTEKKRVKTVLSVEGRLAGPLVSTLEQCWRELRA |
| Ga0207641_111306912 | 3300026088 | Switchgrass Rhizosphere | MLRVTTDKKKSKTVLSVEGRLAGQNVATLEQCWRELRSASPQEK |
| Ga0209131_12649671 | 3300026320 | Grasslands Soil | MFRVTTQKKRLKVLLTVEGRLAGESVSTLEHCWRELRAASPTEKFNVDLCG |
| Ga0257181_10181843 | 3300026499 | Soil | MLRITTEKKRGKTILSVEGRLAGPSVATLEQCWRELRSSSPQE |
| Ga0209808_10115222 | 3300026523 | Soil | MLRITTEKRRGKVFLSVEGKLAGPWVAALEQCWRELH |
| Ga0209161_101644992 | 3300026548 | Soil | MLRITTEKRRGKVFLSVEGKLAGPSVATLEQCWRELHAASPRE |
| Ga0209648_100170011 | 3300026551 | Grasslands Soil | MLRITTEKKRGKIFLSVEGRLAGPWVAALEQCWRGL |
| Ga0209648_106739962 | 3300026551 | Grasslands Soil | MLRISTENKRGKVVLTVEGRLAGQTVPTLEQFWRELRAASPEEKFSVNLCG |
| Ga0179587_104628001 | 3300026557 | Vadose Zone Soil | LQLTQSILGDEMLRITTEKKRSKTVLSVEGRLAGALVATLEQCWKELKAAAPHEKFY |
| Ga0179587_106541021 | 3300026557 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVATLEQCWKELKA |
| Ga0209388_10534721 | 3300027655 | Vadose Zone Soil | MLRVTTDKRRGKTVLSVEGRLAGPWVGALEQCWREL |
| Ga0209248_101036772 | 3300027729 | Bog Forest Soil | MHMLHQTGDVSLLRITTEQKRGKLVLSVEGRLAGQWVAALEQCWRDLRASSPGGKFSIN |
| Ga0209701_102247801 | 3300027862 | Vadose Zone Soil | MLRITTEKKRGKMVLSVEGRLAGPWVAALEQCWRELHAASPREKF |
| Ga0209701_102915901 | 3300027862 | Vadose Zone Soil | MLRITTEKRRGKIFLSVEGKLTGPWVATLEQCWRELSA |
| Ga0209283_101156654 | 3300027875 | Vadose Zone Soil | MLRITTNRKRGKVTLSVEGRLAGPALGTLEQCWREL |
| Ga0209283_109463242 | 3300027875 | Vadose Zone Soil | MLRITTEKKRGKIFLSVEGRLAGPWVAALEQCWRELHAASPREKFHVNLCG |
| Ga0209006_112826151 | 3300027908 | Forest Soil | MLRITTEQKRGKLILSVEGRLAGQWVSALEQCWRDLRTS |
| Ga0137415_106997412 | 3300028536 | Vadose Zone Soil | MLRITTEKKRSKTVLSVEGRLAGALVATLEQCWKELKGAAPHEKFYVNL |
| Ga0137415_112802111 | 3300028536 | Vadose Zone Soil | MLRITTEKKRGKTILSVEGRLAVPSVATLEQCWRELHTSSPNEKFHVKLCGVS |
| Ga0307308_100061207 | 3300028884 | Soil | MLRITTEKKRGKIFLGVEGRLAGPWVAALEQCWREL |
| Ga0222749_104914781 | 3300029636 | Soil | MLSYAAIGAESMLRVTTEKKRRKVVLSVEGRLAGPWVGALEQCWRELKAVSPREKFHVDL |
| Ga0222749_106240612 | 3300029636 | Soil | MLRITTENKRGKLFLSVEGSLSGPRVATLEQCWRELSATSPR |
| Ga0247275_10534851 | 3300029817 | Soil | MLRITTETKRGRLTLSVEGRLAGPWVAALEQCWRE |
| Ga0311357_100312211 | 3300030524 | Palsa | MLRITTDKKRGKVVLSIEGRIAGQWVATLEQCWRDL |
| Ga0302312_101926151 | 3300030746 | Palsa | MLRITTDKKRGKVVLSIEGRIAGQWVATLEQCWRDLRAS |
| Ga0075394_107135571 | 3300030969 | Soil | MLRITTEKKRAKTVLSVEGRLAGPLVATLEQCWRELKAASPQEKFH |
| Ga0170820_107252021 | 3300031446 | Forest Soil | MLRITIEKKGGKTSLTVEGKLAGPWVSALEQSWRDLRDSSSG |
| Ga0170818_1061931891 | 3300031474 | Forest Soil | MLRITTEKKRAKTVLSVEGRLAGPLVATLEQCWRELRAAS |
| Ga0318542_102066951 | 3300031668 | Soil | MLRVTTDKKKSKTVVSVEGRLVGENVATLEQCWRE |
| Ga0310686_1158978461 | 3300031708 | Soil | MLRITTEKKRGRTVLSVEGRLAGAWVGTLEQCWRERAPEEKFSVDL |
| Ga0307477_108406131 | 3300031753 | Hardwood Forest Soil | MLRITTEKRRGKVFLSVEGKLTGPWVAALEQCWRELHAASPRE |
| Ga0307475_102561813 | 3300031754 | Hardwood Forest Soil | MLRVTTQKKRSKVLLTVEGRLAGDSVSTLGQCWRELRAASPTEKF |
| Ga0318562_105229292 | 3300032008 | Soil | MLRVTTDKKKSKTVVSVEGRLVGENVATLEQCWRELRSAS |
| Ga0318558_104754941 | 3300032044 | Soil | MQSNQWSKTMLRITTEKKKTKTVLSVEGRLAGQYVAALEQCWREMQRASPQERFY |
| Ga0307471_1003724681 | 3300032180 | Hardwood Forest Soil | MLRVTTVKKRSKVLLTVEGRLAGDSVSTLEQCWREL |
| Ga0335082_109692171 | 3300032782 | Soil | MTPERWSTMLRITTEKKRGKVVLSVEGKLSGGSVNTLEHCWR |
| Ga0335078_106222981 | 3300032805 | Soil | MLRITTETKRGKSTITVEGRVAGPQVATLEQCWREL |
| Ga0335077_101834824 | 3300033158 | Soil | MLRISTELRRGKTVLNVEGKLSGAAVSTLEQCWRELRS |
| ⦗Top⦘ |