Basic Information | |
---|---|
Family ID | F058412 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 39 residues |
Representative Sequence | MFVVSEAEAAAIRAAFDQGGELAAAVELRRLFPGITD |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 26.85 % |
% of genes near scaffold ends (potentially truncated) | 72.59 % |
% of genes from short scaffolds (< 2000 bps) | 76.30 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (68.889 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.704 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF00589 | Phage_integrase | 2.96 |
PF08837 | DUF1810 | 1.48 |
PF01402 | RHH_1 | 1.48 |
PF02796 | HTH_7 | 1.48 |
PF07885 | Ion_trans_2 | 0.74 |
PF03061 | 4HBT | 0.74 |
PF07519 | Tannase | 0.74 |
PF12833 | HTH_18 | 0.74 |
PF00216 | Bac_DNA_binding | 0.74 |
PF07690 | MFS_1 | 0.74 |
PF09594 | GT87 | 0.74 |
PF13358 | DDE_3 | 0.74 |
PF02321 | OEP | 0.74 |
PF04352 | ProQ | 0.74 |
PF00239 | Resolvase | 0.74 |
PF08448 | PAS_4 | 0.74 |
PF01135 | PCMT | 0.74 |
PF04796 | RepA_C | 0.74 |
PF03992 | ABM | 0.74 |
PF00872 | Transposase_mut | 0.74 |
PF01740 | STAS | 0.74 |
PF02586 | SRAP | 0.74 |
PF07238 | PilZ | 0.74 |
PF00135 | COesterase | 0.74 |
PF00118 | Cpn60_TCP1 | 0.74 |
PF05443 | ROS_MUCR | 0.74 |
PF00400 | WD40 | 0.74 |
PF00581 | Rhodanese | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 1.48 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.74 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.74 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.74 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.74 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.74 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.74 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG3109 | sRNA-binding protein ProQ | Signal transduction mechanisms [T] | 0.74 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.74 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 68.89 % |
All Organisms | root | All Organisms | 31.11 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459006|GBPF9FW01A2HX4 | Not Available | 502 | Open in IMG/M |
2170459012|GOYVCMS01A7N5P | Not Available | 506 | Open in IMG/M |
2170459023|GZGNO2B02GZMWJ | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber | 507 | Open in IMG/M |
3300002568|C688J35102_120661035 | Not Available | 1311 | Open in IMG/M |
3300004479|Ga0062595_101857702 | Not Available | 575 | Open in IMG/M |
3300005434|Ga0070709_11808563 | Not Available | 500 | Open in IMG/M |
3300005435|Ga0070714_102483732 | Not Available | 503 | Open in IMG/M |
3300005459|Ga0068867_101125467 | Not Available | 718 | Open in IMG/M |
3300005535|Ga0070684_100190118 | Not Available | 1868 | Open in IMG/M |
3300005563|Ga0068855_101184365 | Not Available | 795 | Open in IMG/M |
3300005563|Ga0068855_102395103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300005842|Ga0068858_100197452 | Not Available | 1902 | Open in IMG/M |
3300006028|Ga0070717_11309401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
3300006050|Ga0075028_100983585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 524 | Open in IMG/M |
3300006172|Ga0075018_10730116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 538 | Open in IMG/M |
3300006174|Ga0075014_100592409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 633 | Open in IMG/M |
3300006175|Ga0070712_101629373 | Not Available | 565 | Open in IMG/M |
3300006237|Ga0097621_101375402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 668 | Open in IMG/M |
3300006237|Ga0097621_102206885 | Not Available | 527 | Open in IMG/M |
3300006358|Ga0068871_101122114 | Not Available | 736 | Open in IMG/M |
3300006755|Ga0079222_12677552 | Not Available | 502 | Open in IMG/M |
3300009094|Ga0111539_13506689 | Not Available | 503 | Open in IMG/M |
3300009098|Ga0105245_10282499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11 | 1623 | Open in IMG/M |
3300009101|Ga0105247_11620533 | Not Available | 532 | Open in IMG/M |
3300009176|Ga0105242_10197411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1785 | Open in IMG/M |
3300009176|Ga0105242_11662424 | Not Available | 674 | Open in IMG/M |
3300009500|Ga0116229_10861371 | Not Available | 733 | Open in IMG/M |
3300009787|Ga0116226_11712037 | Not Available | 577 | Open in IMG/M |
3300010043|Ga0126380_11515472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 594 | Open in IMG/M |
3300010341|Ga0074045_10059878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2722 | Open in IMG/M |
3300010375|Ga0105239_12336344 | Not Available | 622 | Open in IMG/M |
3300010376|Ga0126381_100458155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 1790 | Open in IMG/M |
3300010400|Ga0134122_12023958 | Not Available | 615 | Open in IMG/M |
3300012212|Ga0150985_106308744 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012212|Ga0150985_120175226 | Not Available | 500 | Open in IMG/M |
3300012212|Ga0150985_122077928 | Not Available | 582 | Open in IMG/M |
3300012469|Ga0150984_103501668 | Not Available | 1508 | Open in IMG/M |
3300012469|Ga0150984_111292111 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300012469|Ga0150984_112937252 | Not Available | 647 | Open in IMG/M |
3300012892|Ga0157294_10145865 | Not Available | 653 | Open in IMG/M |
3300012955|Ga0164298_11064851 | Not Available | 603 | Open in IMG/M |
3300012955|Ga0164298_11498199 | Not Available | 526 | Open in IMG/M |
3300012960|Ga0164301_11075911 | Not Available | 638 | Open in IMG/M |
3300012971|Ga0126369_12678458 | Not Available | 583 | Open in IMG/M |
3300012986|Ga0164304_11233936 | Not Available | 605 | Open in IMG/M |
3300013307|Ga0157372_11264277 | Not Available | 852 | Open in IMG/M |
3300014325|Ga0163163_11567759 | Not Available | 720 | Open in IMG/M |
3300014488|Ga0182001_10209322 | Not Available | 720 | Open in IMG/M |
3300014493|Ga0182016_10690211 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300014497|Ga0182008_10206795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum | 1000 | Open in IMG/M |
3300014497|Ga0182008_10567143 | Not Available | 633 | Open in IMG/M |
3300015265|Ga0182005_1254302 | Not Available | 544 | Open in IMG/M |
3300016319|Ga0182033_11966348 | Not Available | 532 | Open in IMG/M |
3300016387|Ga0182040_11610541 | Not Available | 553 | Open in IMG/M |
3300018432|Ga0190275_10535623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1210 | Open in IMG/M |
3300018432|Ga0190275_11614716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300020581|Ga0210399_10940616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 699 | Open in IMG/M |
3300020582|Ga0210395_10665656 | Not Available | 780 | Open in IMG/M |
3300021171|Ga0210405_10075292 | Not Available | 2660 | Open in IMG/M |
3300021171|Ga0210405_10878249 | Not Available | 683 | Open in IMG/M |
3300021171|Ga0210405_11382197 | Not Available | 514 | Open in IMG/M |
3300021181|Ga0210388_10456442 | Not Available | 1123 | Open in IMG/M |
3300021377|Ga0213874_10420218 | Not Available | 523 | Open in IMG/M |
3300021475|Ga0210392_11223220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 562 | Open in IMG/M |
3300021478|Ga0210402_10570561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1050 | Open in IMG/M |
3300024179|Ga0247695_1062104 | Not Available | 552 | Open in IMG/M |
3300025878|Ga0209584_10143762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 896 | Open in IMG/M |
3300025906|Ga0207699_10294816 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300025915|Ga0207693_10035067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 3957 | Open in IMG/M |
3300025916|Ga0207663_10062273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2371 | Open in IMG/M |
3300025925|Ga0207650_11029268 | Not Available | 701 | Open in IMG/M |
3300025925|Ga0207650_11370561 | Not Available | 602 | Open in IMG/M |
3300025928|Ga0207700_10945507 | Not Available | 771 | Open in IMG/M |
3300025928|Ga0207700_11306198 | Not Available | 646 | Open in IMG/M |
3300025929|Ga0207664_10659584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 940 | Open in IMG/M |
3300025939|Ga0207665_10372908 | Not Available | 1081 | Open in IMG/M |
3300025949|Ga0207667_12114029 | Not Available | 521 | Open in IMG/M |
3300026095|Ga0207676_11997591 | Not Available | 579 | Open in IMG/M |
3300026118|Ga0207675_102502587 | Not Available | 527 | Open in IMG/M |
3300026121|Ga0207683_12150390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter → Chthonobacter albigriseus | 506 | Open in IMG/M |
3300027895|Ga0209624_10704007 | Not Available | 666 | Open in IMG/M |
3300027905|Ga0209415_10932602 | Not Available | 586 | Open in IMG/M |
3300027908|Ga0209006_10696103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11 | 832 | Open in IMG/M |
3300028379|Ga0268266_12275645 | Not Available | 513 | Open in IMG/M |
3300028565|Ga0302145_10241310 | Not Available | 601 | Open in IMG/M |
3300028773|Ga0302234_10489322 | Not Available | 526 | Open in IMG/M |
3300029907|Ga0311329_10577649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 749 | Open in IMG/M |
3300029915|Ga0311358_11132546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 526 | Open in IMG/M |
3300030503|Ga0311370_10211668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2596 | Open in IMG/M |
3300031058|Ga0308189_10493886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 526 | Open in IMG/M |
3300031231|Ga0170824_120002352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 850 | Open in IMG/M |
3300031231|Ga0170824_121650594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300031470|Ga0272432_1153652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1001 | Open in IMG/M |
3300031890|Ga0306925_12163201 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031946|Ga0310910_10766707 | Not Available | 761 | Open in IMG/M |
3300031954|Ga0306926_12611092 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032008|Ga0318562_10390927 | Not Available | 809 | Open in IMG/M |
3300032009|Ga0318563_10351046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
3300032013|Ga0310906_10366395 | Not Available | 942 | Open in IMG/M |
3300032074|Ga0308173_12024476 | Not Available | 543 | Open in IMG/M |
3300032205|Ga0307472_101791592 | Not Available | 609 | Open in IMG/M |
3300032261|Ga0306920_103982764 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300032783|Ga0335079_12387276 | Not Available | 500 | Open in IMG/M |
3300032898|Ga0335072_10434693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1391 | Open in IMG/M |
3300034127|Ga0370489_0265770 | Not Available | 516 | Open in IMG/M |
3300034358|Ga0370485_0078809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 913 | Open in IMG/M |
3300034358|Ga0370485_0212619 | Not Available | 611 | Open in IMG/M |
3300034358|Ga0370485_0251234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Solidesulfovibrio → Solidesulfovibrio magneticus → Solidesulfovibrio magneticus RS-1 | 569 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.22% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.22% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.22% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 2.22% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.96% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.48% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.48% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.74% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.74% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L01_06100050 | 2170459006 | Grass Soil | MFTITEADAAAIRAAFDRGGELSAAIELRRLFPGVTAWQRQR |
N56_05821240 | 2170459012 | Grass Soil | MFVVTEADAAAIRAAFERRGEFAAAVELRRLFPGVDGHRA |
FA3_01779480 | 2170459023 | Grass Soil | MFVVSEAEAAAIRAAFDRGGELSAAVELRRLFPLITDM |
C688J35102_1206610352 | 3300002568 | Soil | MFVLTEAQAATIRATYKQRGELSAVVELRRLFPGVDNIALRLRR* |
Ga0062386_1007046642 | 3300004152 | Bog Forest Soil | MFVVTEADAAAIRAVYEQRGEFSAAVELRRRFPGVTNRSARNRREPTCPA* |
Ga0062595_1018577021 | 3300004479 | Soil | MFCVSEAQAAMIRTTFEQRGELSAVVELRRLFPGVGNVALAR |
Ga0070709_108553042 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVISEAEARSIRATLQQRGEFSAAVELRQLFPGIDNGQARLCVRTIAGW |
Ga0070709_118085631 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MFCVSEAQAAIIRTAFEQHGELSAVVELRRLFPGVGNVAWAREC |
Ga0070714_1024837322 | 3300005435 | Agricultural Soil | MFVVSEAEAAAIRAVFDQRGELSAAVELRRLFPGITDMAE |
Ga0068867_1011254671 | 3300005459 | Miscanthus Rhizosphere | MFTVSEAEASAIRAVYEQRGELSAAVELRRRFPGIFSTAQARE |
Ga0070684_1001901181 | 3300005535 | Corn Rhizosphere | MLSSMFSVSEEEAAAIRAVFQQDGEMSAAVELRRHFPGIT |
Ga0068855_1011843651 | 3300005563 | Corn Rhizosphere | MFAVTEAQAAVIRTAYEQRGEFSAAVELRRLFPGIDNAQAR |
Ga0068855_1023951033 | 3300005563 | Corn Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGVGNVA |
Ga0068858_1001974521 | 3300005842 | Switchgrass Rhizosphere | MLSSMFTVSEVEAAAIRAAYEQRGELSAAVELRRRFPGIF |
Ga0081455_108556862 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MFVITEADAAAIRAAFNRGGEFSAAVELRRRFPGITDNVHARE |
Ga0070717_104439881 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVSTDARATTIRNAYKQRGEFSAAVRQLFPRIDNAQARLCVRT |
Ga0070717_113094011 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTILPGMFCVTETEAAAIRAAYEQGGELSAAVELRRLF |
Ga0075028_1009835851 | 3300006050 | Watersheds | MFVVTEAEATAIRAAFDRGGELSAAVELRRLFPGITDNVQ |
Ga0075019_107365732 | 3300006086 | Watersheds | MFVVTEADAAAIRAVYQQRGEFSAAVELRRRFPGI |
Ga0075018_107301161 | 3300006172 | Watersheds | MFVVSEAEATAIRTAFDHGGEFAAAVELRRLFPGVA |
Ga0075014_1005924091 | 3300006174 | Watersheds | MFVVTEAEAAAIRAAFDRGGEFLAGVELRRLFPGVTDN |
Ga0070712_1016293733 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGLG |
Ga0097621_1013754021 | 3300006237 | Miscanthus Rhizosphere | MFSVSEAEAAAIRAAYEQRGELSAAVELRRRSPGI |
Ga0097621_1022068851 | 3300006237 | Miscanthus Rhizosphere | FVVSEVEAAAIRAAFDQGGEFSAAIELRRLFPGIGDIERHCAG* |
Ga0068871_1011221142 | 3300006358 | Miscanthus Rhizosphere | MLLAMFVVSEADAAAIRTAFEQRGELSAAVELRRR |
Ga0079222_126775521 | 3300006755 | Agricultural Soil | MFCVSKAQAAIIRTAFEQRGELSAVVELRRLFPGV |
Ga0075425_1019412831 | 3300006854 | Populus Rhizosphere | MTIFPGMFCVSETEAAAIRTAYEQDGELSAAIELRQLFRDITDNAKA |
Ga0111539_135066891 | 3300009094 | Populus Rhizosphere | MFAITEAEAAGIRVAFEQRGELSAVVELRRLFPGVTDN |
Ga0105245_102824992 | 3300009098 | Miscanthus Rhizosphere | MFEVEAIEIRAAFDSGGKFSAAVELRGLFPAVTDNAQAR* |
Ga0105245_124371212 | 3300009098 | Miscanthus Rhizosphere | MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPD |
Ga0105247_116205331 | 3300009101 | Switchgrass Rhizosphere | MFVVSEEQAAAIRAIFHQRGEFSAAVELRRLFDH* |
Ga0105242_101974111 | 3300009176 | Miscanthus Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGL |
Ga0105242_116624241 | 3300009176 | Miscanthus Rhizosphere | MFVVTEDEAAAIRAVFEQHGEFAAAVELRRLFPGVTDND |
Ga0105242_126303671 | 3300009176 | Miscanthus Rhizosphere | MFMVSKAEAAAIRRAYEEDGEFAAAIELRRYFPGIADNANAR |
Ga0116229_108613711 | 3300009500 | Host-Associated | MFAVDETEATAIRTAYEQHGELSAGIEVRRLFPGITDGLKA |
Ga0116226_105447161 | 3300009787 | Host-Associated | MFSVSEEDAAAIRAAFHQAGELSAAAELRRRFPGFTDNTQAREW |
Ga0116226_117120371 | 3300009787 | Host-Associated | MFAVSEAEAAAIRTLFEHEGEFAAAMELRRIFPLITDNGK |
Ga0126380_115154721 | 3300010043 | Tropical Forest Soil | MFVISEAEADVIRATFEQRGEFAAAVEVRRLFPAITDTARAR |
Ga0074045_100598781 | 3300010341 | Bog Forest Soil | MFTVNDEDAAAIRAAFERGGEFAAAVELRRRFPLIED |
Ga0105239_123363442 | 3300010375 | Corn Rhizosphere | MFAITEAEAAAIRAAFEQTGELSAVVELRRLFPGIT |
Ga0126381_1004581551 | 3300010376 | Tropical Forest Soil | MLFGMFSVSDTEAAAIRAAYERGGELAAAVELRRYFR |
Ga0126381_1039513211 | 3300010376 | Tropical Forest Soil | MFVVTEADAAIRARYEQHGEPSAAVELRRRFPGITD |
Ga0134122_120239581 | 3300010400 | Terrestrial Soil | MFSITEAEATAIRAVFDQSGELSAVVELRRLFPGVT |
Ga0150985_1063087441 | 3300012212 | Avena Fatua Rhizosphere | MEAAAIRAAFDRGGEFSAAIELPRLFPGLADNDQARE |
Ga0150985_1201752262 | 3300012212 | Avena Fatua Rhizosphere | MFVLSEAQAAMIRAPYKQCGELSAVVELRRLFPGVDNIALRLRR* |
Ga0150985_1220779282 | 3300012212 | Avena Fatua Rhizosphere | MFVVTEAEAAAIRAAFDRGGELSAAVELRRLFPAVTDTT* |
Ga0150984_1035016683 | 3300012469 | Avena Fatua Rhizosphere | MFCVSETEAAAIRTAYEQDGELSAAIELRRLFPGIT |
Ga0150984_1096868411 | 3300012469 | Avena Fatua Rhizosphere | MFMVSEAEAAAIRRAYEENGEFAAAIELRRYFPGIQDNVNARL |
Ga0150984_1112921112 | 3300012469 | Avena Fatua Rhizosphere | MFMVNEADAAAIREALEKGGELSAAVELRRRFPGITDNAKVQ |
Ga0150984_1129372521 | 3300012469 | Avena Fatua Rhizosphere | MFVVTEAQAAMIRATYEQRGEFSAAVELRRLFPGIADNAQAR* |
Ga0157294_101458651 | 3300012892 | Soil | MFAITEAEAAAIRAAFEQNGELSAVVELRRLFPGVTDNVQ |
Ga0164298_110648511 | 3300012955 | Soil | MFVVTEAATIRAVFERHGEFAATLELRRLFPGVADNA* |
Ga0164298_114981991 | 3300012955 | Soil | MLLAMFVVTEADAAAIRAAFEQRGELSAAVELTMPRQGS |
Ga0164301_110759113 | 3300012960 | Soil | MLVVTEAEAAAIRAAFEQRGELSAAVELRRLFPGVT |
Ga0126369_126784581 | 3300012971 | Tropical Forest Soil | MFAVTEAEAAAIRAAFDQGGEFAAAVELRRLFPGV |
Ga0164304_112339361 | 3300012986 | Soil | MFSVSEAEAAAIRAAYEQRGELSAAVELRRRFPGI |
Ga0157372_112642771 | 3300013307 | Corn Rhizosphere | MFTVSEEEAADIRAVYEQRGELSAAVELRCRFPGIFS |
Ga0157375_126539221 | 3300013308 | Miscanthus Rhizosphere | MFMVSKAEAAAIRRAYEENGEFAAAIELRKHFPGIADNANA |
Ga0163163_115677591 | 3300014325 | Switchgrass Rhizosphere | MIASTEAEAAAIRAVFERRGEFAAAIELRRLFPSITDNGQA* |
Ga0182001_102093222 | 3300014488 | Soil | MTIIPTMFVVTETEAAAIRAAYEQGGEFSAAVELRRLFPGPTWTPKFT |
Ga0182016_106902111 | 3300014493 | Bog | MFVVSETEAARHLLPPSCDQGGELSAAVELRRLFPGITDTAQ |
Ga0182008_102067951 | 3300014497 | Rhizosphere | MTICPGMFCVTETEAAAIRAAYEQGGELSAAIELR |
Ga0182008_105671431 | 3300014497 | Rhizosphere | VFVLTEAQAAEIRTAYEQHGEFSAVVELRRLFPGLGDIAWARECVR |
Ga0182005_12543023 | 3300015265 | Rhizosphere | MTIFPGMFCVSESEAAAIRAAYEQGDELSAAVELRRLFPGITDN |
Ga0182033_119663482 | 3300016319 | Soil | MFSVTEAEAAAIRTAFEQGGEFAAAVELRRLFPGITD |
Ga0182040_116105412 | 3300016387 | Soil | MFTVTEAEAAAIRTAFEQGGELSAALELRRLFPGVT |
Ga0190275_105356232 | 3300018432 | Soil | MFLVNEETITAIRTAYAEGGELAAAVELRRLFPGI |
Ga0190275_116147162 | 3300018432 | Soil | MFLINEPIINAIRAAYAQGGELAAVVELRRLFPGITPAEAP |
Ga0190273_107900142 | 3300018920 | Soil | MFMVNEAEAAAIRRAYEEDGEFAAIELRRHFPGIQDHANARLCA |
Ga0190273_119943691 | 3300018920 | Soil | MFMVNEAEAAAIRLAYEEDREFAAAIELRRHFPGI |
Ga0210399_109406161 | 3300020581 | Soil | MFVVSEAEATAIRTAFDQGGEFAAAVELRRLFPGVADN |
Ga0210395_106656563 | 3300020582 | Soil | MLGAMFAVSEQDAAAIRAAFEQGGEFADAVELRRLF |
Ga0210405_100752921 | 3300021171 | Soil | MFVVTEVDAAAIRAAFERGGELSAAVELRRLFPGV |
Ga0210405_108782492 | 3300021171 | Soil | MFSVTEADAAVIRAAFERGGELSAAVELRRLFPGIADNAV |
Ga0210405_113821971 | 3300021171 | Soil | MRQRADDPAMFMVSEADAAAIRAAFEQGGELSASVELRRLFPGLA |
Ga0210388_104564422 | 3300021181 | Soil | MFVVTEAEAVAIRAVFQQFGEFAAAVELRRRFPGI |
Ga0213874_104202182 | 3300021377 | Plant Roots | VTIFPGMFCVSETEAAAIRTAYEQGGELSAAVELRRLFP |
Ga0210397_103617011 | 3300021403 | Soil | MFVVTEADAAAIRAVYEQQGEFAAADELRRLFPGGTDNAQA |
Ga0210389_105331311 | 3300021404 | Soil | MSVVTEADAAAIGAVYQQQGEFAAAIELRQRFSGITDNAQ |
Ga0210392_112232201 | 3300021475 | Soil | MFVVTEAEAAAIRTAFEQSGELAAAVELRRLFPLI |
Ga0210402_105705613 | 3300021478 | Soil | MFVVSEAEAAAIRSAFDRGGELSAAVELRRLFPGITDTAQAR |
Ga0247695_10621041 | 3300024179 | Soil | MFVVTEADAAAIRAVYEQRGEFAAAIELRRLFPGIT |
Ga0209584_101437622 | 3300025878 | Arctic Peat Soil | MFVVFETDAAAIRAAFDQGGELSAAVELRRLFPGVTD |
Ga0207699_102948161 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVAELRRLFPGVAM |
Ga0207693_100350675 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVVTEADAAAIRAAFDQGGEFSAAVELRQRFPGIP |
Ga0207663_100622731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVVTEAEAAAIRAAFEQRGELSAAVELRRLFPAV |
Ga0207694_100356791 | 3300025924 | Corn Rhizosphere | MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNARAREFA |
Ga0207650_110292681 | 3300025925 | Switchgrass Rhizosphere | MLSSMFSVSEEEAAAIRAVYEQRGELSAAVELRRRFP |
Ga0207650_113705612 | 3300025925 | Switchgrass Rhizosphere | MFTVSEEEAADIRAVYEQRGELSAAVELRCRFPGIFSAA |
Ga0207700_107673372 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVVTEAQAAMIRATYEQRGEFSAAVELRQLFPGIMDNAQARLCVRTI |
Ga0207700_109455071 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFCVSEAQAAVIRTAFEQQGELSAVVELRRLFPGVDNIAL |
Ga0207700_113061982 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAVTAAQAAIIRAAYEQRGEFSAAVELRQLFPGIVDNA |
Ga0207664_106595842 | 3300025929 | Agricultural Soil | MFVVTEAQAAMIRATYEQRGEFSAAVELRQLFPGITNNA |
Ga0207664_106812212 | 3300025929 | Agricultural Soil | MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAQARE |
Ga0207686_117967781 | 3300025934 | Miscanthus Rhizosphere | MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAQ |
Ga0207704_107657552 | 3300025938 | Miscanthus Rhizosphere | MFVVTEAQAAAIRAAYEQRGEFSAAVELRQLFPGIDNVRAREC |
Ga0207704_119807053 | 3300025938 | Miscanthus Rhizosphere | MFVVTDADAAAIRTAFDQGGEFSAAAELRQRFPGIP |
Ga0207665_103729083 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVVTEVDAAAIRAAFDRGGELSAAVELRRLFPSITST |
Ga0207667_121140293 | 3300025949 | Corn Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGV |
Ga0207658_111815381 | 3300025986 | Switchgrass Rhizosphere | MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAR |
Ga0207702_115862652 | 3300026078 | Corn Rhizosphere | MFLVTEAQAAVIRTAYEQRGEFSAAVELRQLFPGIDNAQAREC |
Ga0207676_119975911 | 3300026095 | Switchgrass Rhizosphere | MPHALAVFVLTKAQAATIRATYEQRGEFSAAVELRQLFPGIVDNAQ |
Ga0207675_1025025872 | 3300026118 | Switchgrass Rhizosphere | MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGVGNVAWARE |
Ga0207683_121503902 | 3300026121 | Miscanthus Rhizosphere | MFSVSEEEAAAIRAVFEQRGELSAAVELRRCFPGIVDNV |
Ga0209624_107040072 | 3300027895 | Forest Soil | MFVVSEAEAAAIRAAFDQGGELAAAVELRRLFPGITD |
Ga0209415_109326021 | 3300027905 | Peatlands Soil | MLSCMFVVTDAEAAAIRAAFDQGGEFAAAVELRRLFPGITDLPP |
Ga0209006_106961032 | 3300027908 | Forest Soil | MVVVSEVEAEAIRTDFDREGELSAAVELRRLFPLITNMA |
Ga0268266_122756451 | 3300028379 | Switchgrass Rhizosphere | MFSVSEEEAAAIRAVFEQRGELSAAVELRRCFPGIVDNVQ |
Ga0302145_102413101 | 3300028565 | Bog | MFCVSEADAAAIRVAFEQGGELSAAVELRRLFPGLA |
Ga0302234_104893221 | 3300028773 | Palsa | MFVVSDAQADMIRTAFDQGGEFTAAVELRRLFPGVRDNDQARAF |
Ga0311329_105776491 | 3300029907 | Bog | LSEADAAAIRDAFEHGGELAAAVELRRLFPGLANNENTRLCA |
Ga0311362_110251841 | 3300029913 | Bog | MFAIDEATADAIRAIYVQEGELSAAVELRRRFPLITD |
Ga0311358_111325461 | 3300029915 | Bog | MFAVSEADAAAIRDAFEHGGELAAAVELRRLFPGLAN |
Ga0311370_102116681 | 3300030503 | Palsa | MFIVHEAEAAAIRTILENKGELSAAIEVRRLFPGITD |
Ga0308189_104938862 | 3300031058 | Soil | MVDEATITAIREAFAEGGEFAAAVELRRRFPGIVDNAEA |
Ga0170824_1200023522 | 3300031231 | Forest Soil | MFVVTDAEAAAIRAVFEQRGEFAAAVELRRRFPGITD |
Ga0170824_1216505941 | 3300031231 | Forest Soil | MFVVTEADATAIRAAFDRGGELSAAIELRRLFPGVTDMA |
Ga0272432_11536521 | 3300031470 | Rock | VFCVSESEAELIRTAFDQGGELSAAVELRRLFPGITD |
Ga0318534_107743531 | 3300031544 | Soil | MFVITEAQAAAIRIVYEQRGEFSAAVEVRQLFRGIDNAQARLCVRTIAGW |
Ga0306925_119151861 | 3300031890 | Soil | MMFVVTEAQAAMIRATYEQRGEFSAAVELRCLFPGIADIAQARLCVRTIAS |
Ga0306925_121632011 | 3300031890 | Soil | MFVVSEAEAAAIRAIFHRQGEFAAAVELRRLFPGRYGR |
Ga0310910_107667073 | 3300031946 | Soil | MFVVSEAEAAAIRAVYEQRGESAAAVELRRRFPGIADDAQ |
Ga0306926_126110921 | 3300031954 | Soil | MMFVVTEAQAAMIRATYEQRGEFSAAVELRCLFPGIADI |
Ga0318562_103909273 | 3300032008 | Soil | MFVVSEAEAAAIRGVFHQQGEFAAAMELRRLFPGIPDAYRRESAHG |
Ga0318563_103510462 | 3300032009 | Soil | MFVVSEAEAAAIRAIFREKGEFSAAVELRRLFPGITDTEQARE |
Ga0310906_103663951 | 3300032013 | Soil | MFCVSEAQAAMIRTTFEQRGELSAVVELQRLFPGPG |
Ga0308173_120244761 | 3300032074 | Soil | MFVVTDSDVAAIRAAFEAGGELSAAVELRRRFAGIPNNE |
Ga0307472_1017915922 | 3300032205 | Hardwood Forest Soil | MGRRSHASGMFVVTEADATAIRDAFDHGGELSAAVELRRLFP |
Ga0306920_1039827641 | 3300032261 | Soil | MFTATEAEAAAIRASCDQGGEFAAAVELRRLFPGVTDSAEGGECARTIA |
Ga0335079_123872761 | 3300032783 | Soil | MFCISEAQAAEIRAIFHERGEFSAAIELRRLFPGI |
Ga0335072_104346932 | 3300032898 | Soil | MMFVVSEEEAAAIRTAFDRGGELEAAIELRRRFPGISDT |
Ga0370489_0265770_246_374 | 3300034127 | Untreated Peat Soil | MFAVTEAAAIREAYFSGGELSAAVELRRRFPGIADMDVPAEQ |
Ga0370485_0078809_3_119 | 3300034358 | Untreated Peat Soil | MFCVSEAEATLIRTAFHEGGELSAAVELRRLFPGIDDMA |
Ga0370485_0212619_485_610 | 3300034358 | Untreated Peat Soil | MFMVSEAEATAIREAWITGGELSAAVELRRFFPGITDMAKAR |
Ga0370485_0251234_2_124 | 3300034358 | Untreated Peat Soil | MFAVTAAEADAIRTAWIEGGELSAAVELRRLFPGITDMARA |
⦗Top⦘ |