NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058398

Metagenome / Metatranscriptome Family F058398

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058398
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 45 residues
Representative Sequence ANGAALGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFSATWLRSN
Number of Associated Samples 121
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.58 %
% of genes near scaffold ends (potentially truncated) 83.70 %
% of genes from short scaffolds (< 2000 bps) 87.41 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.593 % of family members)
Environment Ontology (ENVO) Unclassified
(18.519 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.148 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.55%    Coil/Unstructured: 79.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF00561Abhydrolase_1 11.11
PF11941DUF3459 9.63
PF00069Pkinase 7.41
PF01555N6_N4_Mtase 6.67
PF12697Abhydrolase_6 5.93
PF04012PspA_IM30 3.70
PF00392GntR 2.96
PF01828Peptidase_A4 2.22
PF00355Rieske 1.48
PF01391Collagen 1.48
PF00753Lactamase_B 1.48
PF01370Epimerase 0.74
PF00441Acyl-CoA_dh_1 0.74
PF11271PorA 0.74
PF02911Formyl_trans_C 0.74
PF13460NAD_binding_10 0.74
PF13377Peripla_BP_3 0.74
PF01609DDE_Tnp_1 0.74
PF01243Putative_PNPOx 0.74
PF13845Septum_form 0.74
PF05016ParE_toxin 0.74
PF00293NUDIX 0.74
PF00501AMP-binding 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 29.63
COG1842Phage shock protein ATranscription [K] 7.41
COG0863DNA modification methylaseReplication, recombination and repair [L] 6.67
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 6.67
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 6.67
COG0223Methionyl-tRNA formyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.74
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.74
COG3293TransposaseMobilome: prophages, transposons [X] 0.74
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.74
COG5421TransposaseMobilome: prophages, transposons [X] 0.74
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.74
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.33 %
UnclassifiedrootN/A26.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_100645470Not Available766Open in IMG/M
3300004635|Ga0062388_102631127Not Available529Open in IMG/M
3300005177|Ga0066690_10203882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1317Open in IMG/M
3300005332|Ga0066388_100495675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1858Open in IMG/M
3300005355|Ga0070671_101632859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae572Open in IMG/M
3300005356|Ga0070674_100451753All Organisms → cellular organisms → Bacteria → Terrabacteria group1061Open in IMG/M
3300005367|Ga0070667_101297661All Organisms → cellular organisms → Bacteria → Terrabacteria group682Open in IMG/M
3300005434|Ga0070709_10568521All Organisms → cellular organisms → Bacteria → Terrabacteria group869Open in IMG/M
3300005436|Ga0070713_101215738All Organisms → cellular organisms → Bacteria → Terrabacteria group729Open in IMG/M
3300005437|Ga0070710_10512871All Organisms → cellular organisms → Bacteria → Terrabacteria group822Open in IMG/M
3300005445|Ga0070708_100168508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2044Open in IMG/M
3300005471|Ga0070698_100295494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1551Open in IMG/M
3300005591|Ga0070761_10959689Not Available542Open in IMG/M
3300005598|Ga0066706_11331366All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300005921|Ga0070766_10349017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia960Open in IMG/M
3300005921|Ga0070766_10773907Not Available653Open in IMG/M
3300006028|Ga0070717_10842304All Organisms → cellular organisms → Bacteria → Terrabacteria group834Open in IMG/M
3300006052|Ga0075029_101255835All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006173|Ga0070716_100489897All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300006174|Ga0075014_100687699All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300006176|Ga0070765_102250240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Thermasporomyces → Thermasporomyces composti508Open in IMG/M
3300006237|Ga0097621_100308310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1400Open in IMG/M
3300006755|Ga0079222_10075009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1681Open in IMG/M
3300006755|Ga0079222_10371649All Organisms → cellular organisms → Bacteria → Terrabacteria group978Open in IMG/M
3300006914|Ga0075436_100192910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1442Open in IMG/M
3300009520|Ga0116214_1270811All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300009525|Ga0116220_10312493All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300009551|Ga0105238_12742162Not Available529Open in IMG/M
3300009553|Ga0105249_13490189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Streptomonospora → Streptomonospora salina506Open in IMG/M
3300009672|Ga0116215_1479531Not Available538Open in IMG/M
3300009698|Ga0116216_10623938All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009698|Ga0116216_10699188Not Available609Open in IMG/M
3300009700|Ga0116217_10184784All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300009700|Ga0116217_10191725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1347Open in IMG/M
3300010154|Ga0127503_10137874All Organisms → cellular organisms → Bacteria → Terrabacteria group544Open in IMG/M
3300010333|Ga0134080_10512079All Organisms → cellular organisms → Bacteria → Terrabacteria group572Open in IMG/M
3300010360|Ga0126372_10564053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300010361|Ga0126378_10107159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2771Open in IMG/M
3300010371|Ga0134125_11369148All Organisms → cellular organisms → Bacteria → Terrabacteria group771Open in IMG/M
3300010379|Ga0136449_102374036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia766Open in IMG/M
3300010379|Ga0136449_103455129All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300010396|Ga0134126_11495306All Organisms → cellular organisms → Bacteria → Terrabacteria group744Open in IMG/M
3300010876|Ga0126361_10444256All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300010937|Ga0137776_1308138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300012205|Ga0137362_11410633All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300012351|Ga0137386_10663324Not Available750Open in IMG/M
3300012359|Ga0137385_10491202All Organisms → cellular organisms → Bacteria → Terrabacteria group1039Open in IMG/M
3300012361|Ga0137360_11809768Not Available516Open in IMG/M
3300012481|Ga0157320_1010819Not Available710Open in IMG/M
3300012498|Ga0157345_1055972Not Available514Open in IMG/M
3300013102|Ga0157371_10067153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2538Open in IMG/M
3300013307|Ga0157372_11785291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae707Open in IMG/M
3300014201|Ga0181537_10785527Not Available646Open in IMG/M
3300014326|Ga0157380_10154727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1986Open in IMG/M
3300015373|Ga0132257_100792877All Organisms → cellular organisms → Bacteria → Terrabacteria group1182Open in IMG/M
3300017821|Ga0187812_1247937Not Available567Open in IMG/M
3300017926|Ga0187807_1030182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1679Open in IMG/M
3300017926|Ga0187807_1302481Not Available531Open in IMG/M
3300017928|Ga0187806_1067363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1109Open in IMG/M
3300017932|Ga0187814_10161878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia835Open in IMG/M
3300017932|Ga0187814_10203932Not Available743Open in IMG/M
3300017948|Ga0187847_10570382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300017955|Ga0187817_10211429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1236Open in IMG/M
3300017974|Ga0187777_11033358Not Available596Open in IMG/M
3300018001|Ga0187815_10051812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1727Open in IMG/M
3300018042|Ga0187871_10553056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia638Open in IMG/M
3300018043|Ga0187887_10151325Not Available1389Open in IMG/M
3300018044|Ga0187890_10263421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii970Open in IMG/M
3300018058|Ga0187766_10180042All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300018085|Ga0187772_10014902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4339Open in IMG/M
3300018086|Ga0187769_10875396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales679Open in IMG/M
3300020002|Ga0193730_1022050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1839Open in IMG/M
3300020081|Ga0206354_10392717All Organisms → cellular organisms → Bacteria → Terrabacteria group1504Open in IMG/M
3300020582|Ga0210395_10504339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300021088|Ga0210404_10328023All Organisms → cellular organisms → Bacteria → Terrabacteria group846Open in IMG/M
3300021171|Ga0210405_10940080All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300021374|Ga0213881_10037584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis sulphurea2039Open in IMG/M
3300021403|Ga0210397_10366949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1070Open in IMG/M
3300021420|Ga0210394_10587713All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300021433|Ga0210391_10296868All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300021433|Ga0210391_10709255Not Available788Open in IMG/M
3300021560|Ga0126371_10091272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii3014Open in IMG/M
3300021560|Ga0126371_12079295Not Available684Open in IMG/M
3300022467|Ga0224712_10126936All Organisms → cellular organisms → Bacteria → Terrabacteria group1110Open in IMG/M
3300022840|Ga0224549_1017096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1016Open in IMG/M
3300025901|Ga0207688_10065380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2055Open in IMG/M
3300025910|Ga0207684_11485169All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300025915|Ga0207693_10641515All Organisms → cellular organisms → Bacteria → Terrabacteria group825Open in IMG/M
3300025916|Ga0207663_11176231All Organisms → cellular organisms → Bacteria → Terrabacteria group617Open in IMG/M
3300025916|Ga0207663_11589731Not Available526Open in IMG/M
3300025928|Ga0207700_11302774All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300026490|Ga0257153_1032600Not Available1075Open in IMG/M
3300026551|Ga0209648_10033431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila4483Open in IMG/M
3300027031|Ga0208986_1021908All Organisms → cellular organisms → Bacteria → Terrabacteria group665Open in IMG/M
3300027765|Ga0209073_10067100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1212Open in IMG/M
3300027787|Ga0209074_10507887All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300027855|Ga0209693_10406357All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300027879|Ga0209169_10000557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria22706Open in IMG/M
3300027884|Ga0209275_10006477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4902Open in IMG/M
3300027884|Ga0209275_10323950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria859Open in IMG/M
3300027889|Ga0209380_10141911All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300027895|Ga0209624_10654646Not Available695Open in IMG/M
3300027905|Ga0209415_10911669Not Available596Open in IMG/M
3300028715|Ga0307313_10088312All Organisms → cellular organisms → Bacteria → Terrabacteria group936Open in IMG/M
3300028828|Ga0307312_10088238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1907Open in IMG/M
3300028906|Ga0308309_10507942Not Available1042Open in IMG/M
3300028906|Ga0308309_11209564Not Available651Open in IMG/M
3300029910|Ga0311369_10708299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii826Open in IMG/M
3300029944|Ga0311352_10065917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila3252Open in IMG/M
3300030520|Ga0311372_11532491Not Available819Open in IMG/M
3300030730|Ga0307482_1172507Not Available643Open in IMG/M
3300030740|Ga0265460_10303014Not Available1070Open in IMG/M
3300030741|Ga0265459_13921094Not Available522Open in IMG/M
3300031128|Ga0170823_14845240Not Available644Open in IMG/M
3300031234|Ga0302325_10730188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ADI95-171417Open in IMG/M
3300031234|Ga0302325_11426048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii898Open in IMG/M
3300031708|Ga0310686_104605674Not Available728Open in IMG/M
3300031723|Ga0318493_10047356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH602022Open in IMG/M
3300031833|Ga0310917_10225222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH601259Open in IMG/M
3300031890|Ga0306925_10129727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH602704Open in IMG/M
3300032025|Ga0318507_10032359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1960Open in IMG/M
3300032025|Ga0318507_10396147Not Available601Open in IMG/M
3300032067|Ga0318524_10653965All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300032068|Ga0318553_10102098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1463Open in IMG/M
3300032160|Ga0311301_11546896All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300032261|Ga0306920_101885862All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300032805|Ga0335078_10142181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3406Open in IMG/M
3300032828|Ga0335080_12249500All Organisms → cellular organisms → Bacteria → Terrabacteria group523Open in IMG/M
3300032895|Ga0335074_11412888Not Available562Open in IMG/M
3300032896|Ga0335075_10627673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1054Open in IMG/M
3300032898|Ga0335072_11596750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Streptomonospora → Streptomonospora salina551Open in IMG/M
3300032955|Ga0335076_10761757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.63%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.15%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.44%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.70%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.48%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.48%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.74%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.74%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.74%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.74%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.74%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.74%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027031Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10064547013300004091Bog Forest SoilALGSAGGVTSITMIDNEGRDKDTVSSLSGGENFSATWVRSN*
Ga0062388_10263112733300004635Bog Forest SoilLANGAAIGNAGGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN*
Ga0066690_1020388233300005177SoilGSTANGSAIGSAGGVTQIIMIDGAGRDKDTVSGLTSGENFSATWLRSN*
Ga0066388_10049567533300005332Tropical Forest SoilMANGAALGNAGGMTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN*
Ga0070671_10163285923300005355Switchgrass RhizosphereGAALGNAGGVTKITMINNSGQAKDRISSLSSGTSFSATWLRAN*
Ga0070674_10045175323300005356Miscanthus RhizosphereLANFGTVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0070667_10129766123300005367Switchgrass RhizosphereTVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0070709_1056852123300005434Corn, Switchgrass And Miscanthus RhizosphereGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0070713_10121573823300005436Corn, Switchgrass And Miscanthus RhizosphereIGSAGGVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN*
Ga0070710_1051287123300005437Corn, Switchgrass And Miscanthus RhizosphereGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0070708_10016850823300005445Corn, Switchgrass And Miscanthus RhizosphereMANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSN*
Ga0070698_10029549433300005471Corn, Switchgrass And Miscanthus RhizosphereVNITGSTANGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLGSS*
Ga0070761_1095968923300005591SoilATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS*
Ga0066706_1133136623300005598SoilAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN*
Ga0070766_1034901723300005921SoilISLTSSEANGSAIGNAGGLTEIVMADSKGRNEDTVSSLTGGESFSATWLRSN*
Ga0070766_1077390713300005921SoilVNFTGATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS*
Ga0070717_1084230413300006028Corn, Switchgrass And Miscanthus RhizosphereALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0075029_10125583523300006052WatershedsGNAGGVTQIIMIDNAGCDEDSVSSLSSGENFSATWLRSS*
Ga0070716_10048989723300006173Corn, Switchgrass And Miscanthus RhizosphereLGNAGGVTEITMVNNSGQAKDSVSSLSGGENFSARWLRAN*
Ga0075014_10068769913300006174WatershedsANGAALGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFSATWLRSN*
Ga0070765_10225024013300006176SoilILPLADFGTVSMAGSQANRAALGNAGGLTQIVMIDGAGLGKDTVSALATGENFTATWLGSN*
Ga0097621_10030831013300006237Miscanthus RhizosphereNFGTVNITGSLANGAALGNAGGVTKITMINNSGQAKDRISSLSSGTSFSATWLRAN*
Ga0079222_1007500913300006755Agricultural SoilIGSAGGVTQIIMIDSAGRDKDTVSGLTRGENFTATWLRSN*
Ga0079222_1037164923300006755Agricultural SoilPLANFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTISSLTSGENFTATWLRST*
Ga0075436_10019291033300006914Populus RhizosphereLGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0116214_127081123300009520Peatlands SoilGSAGGVTQIVMIDNARSDKDRVSSLSGEGTFSATWLGSS*
Ga0116220_1031249313300009525Peatlands SoilTANGAALGNAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN*
Ga0105238_1274216213300009551Corn RhizosphereSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN*
Ga0105249_1349018913300009553Switchgrass RhizosphereGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN*
Ga0116215_147953113300009672Peatlands SoilGGLTQIIMIDNAGRDKDSVPSLTCGENFSATWLRSN*
Ga0116216_1062393823300009698Peatlands SoilANGSAIGNAGGLTQIIMIDNAGRDKDSVSALTGGENFSATWLRSN*
Ga0116216_1069918823300009698Peatlands SoilANGSAIGNAGGLTQIIMIDNAGRDKDSVPSLTSGENFSATWLRSN*
Ga0116217_1018478413300009700Peatlands SoilGAALGSADGVTPIIMIDKAGSDKDSVSPLSGGENFSATWLRSS*
Ga0116217_1019172523300009700Peatlands SoilLGAALGNAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN*
Ga0127503_1013787413300010154SoilGTVHVTGSTANGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSS*
Ga0134080_1051207913300010333Grasslands SoilSTANGSAIGSAGGVTQIIMIDGAGRDKDTVSGLTSGENFSATWLRSN*
Ga0126372_1056405313300010360Tropical Forest SoilLANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSAENFSATWLRSN*
Ga0126378_1010715913300010361Tropical Forest SoilMANGAALGNAGGVTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN*
Ga0134125_1136914823300010371Terrestrial SoilMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN*
Ga0136449_10237403623300010379Peatlands SoilMSNYGPTQIIMIDSAGRDKDSVSSLSGNAFTATWLRSN*
Ga0136449_10345512913300010379Peatlands SoilNAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN*
Ga0134126_1149530613300010396Terrestrial SoilMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0126361_1044425613300010876Boreal Forest SoilGGVTGITMVDNSGRDKDTISSLSGGENFSATWVRSN*
Ga0137776_130813823300010937SedimentVHITGSLANGAALGNAGGVTQIIMVDSAGRDKDSVSSLTSGENFSATWLRSS*
Ga0137362_1141063323300012205Vadose Zone SoilGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN*
Ga0137386_1066332413300012351Vadose Zone SoilNAGGVTQIIMVDSAGQDKDSVSSLTSGENFSATWLRSN*
Ga0137385_1049120213300012359Vadose Zone SoilITGSLANGSALGNAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN*
Ga0137360_1180976813300012361Vadose Zone SoilNTVSITGSTANGAALGNAGGVTQIIMVDSAGRHKDTVSSLSGGENFSATWLRSN*
Ga0157320_101081913300012481Arabidopsis RhizospherePLANFGTVHITGSLANGSALGNAGGVTQIIMIDSAGQDKDTVSSLTSKENFTATWLRSN*
Ga0157345_105597213300012498Arabidopsis RhizosphereLANFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0157371_1006715333300013102Corn RhizosphereANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0157372_1178529113300013307Corn RhizosphereNAGGVTEITMVNNSGQAKDSVSALSGGENFSARWLRAN*
Ga0181537_1078552713300014201BogIGNAGGLTEIIMIDNSGRDKDTISALSGGEAFSATWLRSN*
Ga0157380_1015472733300014326Switchgrass RhizosphereVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN*
Ga0182024_1280043513300014501PermafrostFSPTEIIMINNSGTPKDSISSLSGGTSFTATWLRSN*
Ga0132257_10079287713300015373Arabidopsis RhizosphereNGAALGNAGGVTQIIMIDSVGRDKDTVSSLTSGENFTATWLRSN*
Ga0187812_124793713300017821Freshwater SedimentDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFSATWLRSN
Ga0187807_103018213300017926Freshwater SedimentTGSDANGSALGNAGGVTEIIMVDNAGRDKDSISALSGGTSFSATWLRSN
Ga0187807_130248113300017926Freshwater SedimentMSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGENFSATWLRSN
Ga0187806_106736323300017928Freshwater SedimentMSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFS
Ga0187814_1016187813300017932Freshwater SedimentMSFTGSDANGGAIGNAGGVTQIIMVDNRGLDKDTVSSLSGGTSFSATWLRSN
Ga0187814_1020393213300017932Freshwater SedimentGTAGGVTQLIMVDNRGLDKDTISSLSGGTSFSATWLRSN
Ga0187847_1057038223300017948PeatlandGNAGGVTEIIMIDNEGRDKDTVTSLSGGENFSATWVRSN
Ga0187817_1021142923300017955Freshwater SedimentMSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFSATWLRSN
Ga0187777_1103335823300017974Tropical PeatlandSTANGSAIGNAGGVTEILMIDNAGRDKDTISALSGGESFSATWERSN
Ga0187815_1005181243300018001Freshwater SedimentPLTDFGTMSFTGSTDNGSAIGNAGGVTEIVMVDNAGRDKDSISALSGGESFSATWLRSN
Ga0187871_1055305623300018042PeatlandGVTEIIMIDNEGRDKDTVTSLSGGENFSATWVRSN
Ga0187887_1015132513300018043PeatlandNLTNSLANGAALGSAGGVTGITMVDNSGRDKDTISSLSGGENFSATWVRSN
Ga0187890_1026342113300018044PeatlandANGSAIGNAGGLTEIIMQDSEGRDEDTVSNLSGGENFSATWVRSN
Ga0187766_1018004223300018058Tropical PeatlandAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGEAFSATWLRST
Ga0187772_1001490273300018085Tropical PeatlandFSAPDANGSDIGNAGGVTQITMVDNRGLDKDSISSLSGGTGFSATWLRSS
Ga0187769_1087539623300018086Tropical PeatlandADLGAAGGLTQIIMVDNSRRDKDSVSALTPSGVTGQDFSATWVASS
Ga0193730_102205033300020002SoilGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN
Ga0206354_1039271733300020081Corn, Switchgrass And Miscanthus RhizosphereMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0210395_1050433913300020582SoilGGLTEIIMIDNAGRDKDTVSSLSGGENFSATWLRSN
Ga0210404_1032802313300021088SoilWGRAGNGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSS
Ga0210405_1094008023300021171SoilAGNGSAIGSAGGVTQIIVIDSAGRDKDTVSGLTSGENFSATWLRST
Ga0213881_1003758433300021374Exposed RockAGGVTQIIMIDNAGRDKDTVSSLSGGENFSATWLRSN
Ga0210397_1036694923300021403SoilVNITGSTANGAALSNAGGVTQIIMVDSAGRDKDTVSSLSGGANFSARWLRSN
Ga0210383_1131562123300021407SoilGNADPTQIIMVDSAGRDKDSISSLSGGNSFTGTWLRAN
Ga0210394_1058771323300021420SoilGSTANGAALGSVGGMTQIRMIDNAGRDKDIVSSLSSEGNFSATWLGSS
Ga0210391_1029686813300021433SoilGGMTQIVMIDNAGRDKDIVSSLNSEGNFSATWLGSN
Ga0210391_1070925533300021433SoilTVSLTGTTANGSAIGNAGGLTEIIMIDSAGRDKDTVSSLSSGENFSATWLRSN
Ga0126371_1009127223300021560Tropical Forest SoilMANGAALGNAGGVTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN
Ga0126371_1207929533300021560Tropical Forest SoilVNITGSLANGAAIGNAGGVTQIIMIDSQGRTRDSVSSLSGGENFSATWIRSN
Ga0224712_1012693613300022467Corn, Switchgrass And Miscanthus RhizosphereHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0224549_101709613300022840SoilDFGTISLKSSEANGSAIGNAGGLTEIVMVDSEGRNEDTVSSLTGGESFSATWVRSN
Ga0207692_1041287423300025898Corn, Switchgrass And Miscanthus RhizosphereGNFSPTQIIMVDGAGRAKDSISSLSGGNSFTATWLRAN
Ga0207688_1006538033300025901Corn, Switchgrass And Miscanthus RhizosphereMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN
Ga0207684_1148516923300025910Corn, Switchgrass And Miscanthus RhizosphereGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0207693_1064151523300025915Corn, Switchgrass And Miscanthus RhizosphereNGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0207663_1117623123300025916Corn, Switchgrass And Miscanthus RhizosphereSAGGVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN
Ga0207663_1158973113300025916Corn, Switchgrass And Miscanthus RhizosphereGVTQIVMVDNAGRQKDSVSSLSGKENFSATWLRSN
Ga0207700_1130277413300025928Corn, Switchgrass And Miscanthus RhizosphereGSAIGSAGSVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN
Ga0257153_103260013300026490SoilNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSN
Ga0209648_1003343163300026551Grasslands SoilDFGTMNFTGSTANGSAIGSAGGLTEIIMVDNAGRDKDSISSLSSGENFSATWLRSN
Ga0208986_102190823300027031Forest SoilANFGTVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0209073_1006710013300027765Agricultural SoilANGAALGNAGGVTKITMINNSGQAKDSVSSLSGGENFSATWLRAN
Ga0209074_1050788723300027787Agricultural SoilHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0209693_1040635713300027855SoilNIAGSTANGAALGNAGGVTQIVMIDNAGRDKDTVSSLSGKENFSATWLRSN
Ga0209169_10000557233300027879SoilVNITSSMANGAAIGNAGGLTEIIMIDNEGRDKDTVSALSGGENFSATWVRSN
Ga0209275_1000647763300027884SoilAIGNAGGLTSITMIDNEGRDKDTVSALSGGENFSATWVRSN
Ga0209275_1032395033300027884SoilFTGATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS
Ga0209380_1014191133300027889SoilTANGAALGSVGGMTQIVMIDNAGRDKDIVSSLNSEGNFSATWLGSN
Ga0209624_1065464633300027895Forest SoilFTGSMANGAAIGNAGGLTEIIMIDNSGRDKDTISSLSGGENFSATWLRSN
Ga0209415_1091166913300027905Peatlands SoilGNFSPTEIIMIDNAGRDKDSVSSLSGGNSFKATWLRSN
Ga0307313_1008831223300028715SoilLTGSMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN
Ga0307312_1008823833300028828SoilFGTVHLTGSMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN
Ga0308309_1050794213300028906SoilGNAGGLTEIIMIDNAGRDKDSISSLSGGESFSATWLRSN
Ga0308309_1120956413300028906SoilSAIGNAGGLTEIIMIDNAGRDKDSISSLSGGENFSATWLRSN
Ga0311369_1070829923300029910PalsaDFGTVNITSSEANGAAIGNAGGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN
Ga0311352_1006591733300029944PalsaNGSAIGNAGGLTEIIMIDNSGRDKDTISALSGGEAFSATWLRSN
Ga0311372_1153249113300030520PalsaGLTEIIMIDSEGRDRDSVSSLSGGENFSATWIRDN
Ga0307482_117250713300030730Hardwood Forest SoilGGAIGNAGGVTEIVMVDNSGRDKDSISALSGGTSFSATWLRST
Ga0265460_1030301423300030740SoilVSLTGTTANGSAIGNAGGLTEIIMIDNAGRDKDSVSSLSGGENFSATWLRSS
Ga0265459_1392109413300030741SoilGNAGGLTEIIMIDNEGRDKDTVSALSVGENFSATWVRSN
Ga0170823_1484524013300031128Forest SoilMNFTGTTANGSAIGNAGGLTEIIMVDNAGRDKDSISTLSGGENFSATWLRSN
Ga0302325_1073018823300031234PalsaSAPGCGSAIGNAGGLTEIIMVDSRGRDEDTVSSPSDGENFSATWVRSN
Ga0302325_1142604823300031234PalsaGGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN
Ga0310686_10460567423300031708SoilIGNAGGLTEIIMIDNAGRDKDTVSSLSGGENFSATWLRSS
Ga0318493_1004735623300031723SoilNAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN
Ga0310917_1022522223300031833SoilTGSLANGAALGNAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN
Ga0306925_1012972713300031890SoilGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN
Ga0318507_1003235943300032025SoilGSTANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSS
Ga0318507_1039614713300032025SoilGSLANGAALGNAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN
Ga0318524_1065396513300032067SoilVSITGSTANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSS
Ga0318553_1010209813300032068SoilMSFTGSDANGSAIGNAGGVTEIIMVDNAGRDKDSISSLSGGTSFSATWLRSN
Ga0311301_1154689623300032160Peatlands SoilGSAGGVTQIVMIDNARSDKDRVSSLSGEGTFSATWLGSS
Ga0306920_10188586213300032261SoilNGSALGNAGGVTQIIMVDNAGLDKDTVSSLSGGENFSATWVRSN
Ga0335078_1014218113300032805SoilLGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFTATWLRSN
Ga0335080_1224950023300032828SoilALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSAHWLRSN
Ga0335074_1141288813300032895SoilTMSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLRSN
Ga0335075_1062767313300032896SoilMSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLRSN
Ga0335072_1159675013300032898SoilNFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN
Ga0335076_1076175713300032955SoilMSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLPSN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.