 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F058368 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPH |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.78 % |
| % of genes near scaffold ends (potentially truncated) | 67.41 % |
| % of genes from short scaffolds (< 2000 bps) | 91.11 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.593 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (30.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.259 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 60.00% β-sheet: 0.00% Coil/Unstructured: 40.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 2.96 |
| PF00999 | Na_H_Exchanger | 2.96 |
| PF02771 | Acyl-CoA_dh_N | 1.48 |
| PF00239 | Resolvase | 1.48 |
| PF08548 | Peptidase_M10_C | 0.74 |
| PF00490 | ALAD | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 2.96 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 2.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.96 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 2.96 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 2.96 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 2.96 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.48 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.48 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.48 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.74 |
| COG2931 | Ca2+-binding protein, RTX toxin-related | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.59 % |
| All Organisms | root | All Organisms | 27.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 30.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.44% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.22% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.22% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.48% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.48% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_02919200 | 2170459005 | Grass Soil | MRKLEVIGLAVVAATAFGVWSADTVANSRAGKAEVAV |
| JGI24743J22301_100645861 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISRM* |
| JGI24742J22300_100666732 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPIYRM* |
| C688J35102_1206433103 | 3300002568 | Soil | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH* |
| Ga0066823_100072862 | 3300005163 | Soil | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVIMWH* |
| Ga0066811_10028571 | 3300005185 | Soil | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMWQ* |
| Ga0070658_108607141 | 3300005327 | Corn Rhizosphere | TGWRDNPMRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH* |
| Ga0070670_1000128806 | 3300005331 | Switchgrass Rhizosphere | MRIVGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH* |
| Ga0068869_1003403571 | 3300005334 | Miscanthus Rhizosphere | RGNPMRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH* |
| Ga0068869_1007467823 | 3300005334 | Miscanthus Rhizosphere | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIM |
| Ga0070666_100524925 | 3300005335 | Switchgrass Rhizosphere | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMWH* |
| Ga0070660_1001278452 | 3300005339 | Corn Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVVKADVFAASAPISPHVIMWH* |
| Ga0070689_1000634694 | 3300005340 | Switchgrass Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVIMWQ* |
| Ga0070668_1001575713 | 3300005347 | Switchgrass Rhizosphere | MGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVIMWH* |
| Ga0070671_1010951392 | 3300005355 | Switchgrass Rhizosphere | MRKLEIIGLAFVAATAFGVWAASTVAQSRVGKADVLAASAPISP |
| Ga0070659_1012501391 | 3300005366 | Corn Rhizosphere | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMW |
| Ga0070700_1002515495 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | GLAIVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ* |
| Ga0070662_1005517301 | 3300005457 | Corn Rhizosphere | MRKIEIIGLAVVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ* |
| Ga0070707_1011908822 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVVKADVLAASAPISPHVIMWH* |
| Ga0070696_1002582941 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKLEIIGLAFVAATAFGVWSASTVAQSRIGKADVLAASA |
| Ga0068854_1008324321 | 3300005578 | Corn Rhizosphere | TAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ* |
| Ga0068859_1002393534 | 3300005617 | Switchgrass Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPH |
| Ga0068851_100747924 | 3300005834 | Corn Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAAS |
| Ga0068858_1000633921 | 3300005842 | Switchgrass Rhizosphere | MRIVGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPIS |
| Ga0068860_1000690754 | 3300005843 | Switchgrass Rhizosphere | MGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVVMWH* |
| Ga0068860_1001325566 | 3300005843 | Switchgrass Rhizosphere | MRKLGIIGLAIVAATAFGVWSASTAAQSRVGKADVLAASAPISPHA |
| Ga0075365_106970041 | 3300006038 | Populus Endosphere | AIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMWH* |
| Ga0070716_1017502762 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPIHRM* |
| Ga0075367_111057522 | 3300006178 | Populus Endosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPIHRM* |
| Ga0074055_118426421 | 3300006573 | Soil | MRKLEIIGLAFVAATAFGVWAPSTVAQSRVGKADVLAASAP |
| Ga0074050_100212392 | 3300006577 | Soil | MRKLGIIGLAGIVAATAFGVWSADTVANSRAGKAEVAVASAPISPHVIMWH* |
| Ga0075424_1019815161 | 3300006904 | Populus Rhizosphere | MRKLEIIGLAFVAATAFGVWSASTVAQSRVGKADVLAAS |
| Ga0111539_115926951 | 3300009094 | Populus Rhizosphere | MRKIEIIGLAVVAATAFGVWSASPVVNSRAGKAEVAVATAAISPHVVMWH* |
| Ga0105245_100780442 | 3300009098 | Miscanthus Rhizosphere | MRKIEIIGLAVVAATAFGVWSADTVANSMVAKAEVAVASAPISPHVIMWQ* |
| Ga0105247_102264621 | 3300009101 | Switchgrass Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQPRVGKSDVIAASAP |
| Ga0105243_114542151 | 3300009148 | Miscanthus Rhizosphere | MRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAS |
| Ga0105237_115759121 | 3300009545 | Corn Rhizosphere | PMRIIGLAIVAATAFGVWSASPAAQSRVMKADVLAASAPISPHVIMWH* |
| Ga0151489_13562851 | 3300011106 | Soil | KLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ* |
| Ga0137382_112659041 | 3300012200 | Vadose Zone Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMWQ* |
| Ga0150985_1037150241 | 3300012212 | Avena Fatua Rhizosphere | EGTITMRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIRGF* |
| Ga0150985_1155462321 | 3300012212 | Avena Fatua Rhizosphere | GWRDNPMRKLGMIGLAIVAATAFGVWSASSAAQSRVGKADVLAASAPISPHVTMWQ* |
| Ga0150985_1185158482 | 3300012212 | Avena Fatua Rhizosphere | RDGGTITMRKLEIIGLAVVAATAFGVWSADTVANLRAGKAEVAVASAPISPHVIMWH* |
| Ga0150984_1092921131 | 3300012469 | Avena Fatua Rhizosphere | TGRRGNPMGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVIMWQ* |
| Ga0150984_1110734412 | 3300012469 | Avena Fatua Rhizosphere | GTITMRKLEIIGLAVVAATAFGVWSADTVANSRAGKAEVAVASAPISPHVIMWH* |
| Ga0157302_102924251 | 3300012915 | Soil | MRKLEIIGLAFVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVTMWH* |
| Ga0162650_1001037382 | 3300012939 | Soil | MRKLGIIGFAVVAATAFGVWSASPVVNSRAGKAEVAVASAPISPHVIMWQ* |
| Ga0164298_101127581 | 3300012955 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAA |
| Ga0164299_106957533 | 3300012958 | Soil | MRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIRGF* |
| Ga0164309_107962991 | 3300012984 | Soil | MRKLEIIGLAFVAATAFGVWSASTVAQSRVGKADVLAASAPISPH |
| Ga0157378_121502801 | 3300013297 | Miscanthus Rhizosphere | MRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ* |
| Ga0163162_106327522 | 3300013306 | Switchgrass Rhizosphere | MRKIEIIGLAVVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIRGF* |
| Ga0157372_130106152 | 3300013307 | Corn Rhizosphere | MRKLEIIGLAFVAATAFGVWAASTVAQSRVGKADVLAASAP |
| Ga0157377_102677142 | 3300014745 | Miscanthus Rhizosphere | FHTGWRDNPMRIIGLAIVAATAFGVWSASPAAQSRVVKADVLAASAPISPHVIMWH* |
| Ga0157379_104146683 | 3300014968 | Switchgrass Rhizosphere | HTGRRGNPMGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVVMWH* |
| Ga0157376_126053741 | 3300014969 | Miscanthus Rhizosphere | MRKLEIIGLAFVAATPLGVWSSSTVAQSRVGKADVLA |
| Ga0137412_100685127 | 3300015242 | Vadose Zone Soil | RDNPMRKLEIIGLAIVAATAFGVWSASTVAQSRVGKAAVLAASAPISPHVIMWH* |
| Ga0132256_1037606431 | 3300015372 | Arabidopsis Rhizosphere | MRKLGIIGLAGIVAATVFGIWSADTVANSKVAKAEVAVAFLAPPIRGF* |
| Ga0132257_1029711881 | 3300015373 | Arabidopsis Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQPRVGKADVLAASA |
| Ga0132255_1008837175 | 3300015374 | Arabidopsis Rhizosphere | GLAIVAATAFGVWSASPAAQPRVGKADVLAASAPISPHVTMWH* |
| Ga0190266_101823862 | 3300017965 | Soil | MHKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIRGF |
| Ga0184608_101268293 | 3300018028 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMVKLG |
| Ga0184608_104511612 | 3300018028 | Groundwater Sediment | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLAASAPISP |
| Ga0184620_100727941 | 3300018051 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPH |
| Ga0184619_100547214 | 3300018061 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASMVAQSRVGKADVLAASAPISP |
| Ga0184617_11445871 | 3300018066 | Groundwater Sediment | MHKLGIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMVKLG |
| Ga0184611_10150373 | 3300018067 | Groundwater Sediment | MGIIGLAIIAATAFGVWSASTVVQSRVGKADVLAASAPISPHVIMWH |
| Ga0184611_13388531 | 3300018067 | Groundwater Sediment | AFTRDEGTITMRKLEIIGLAVVAATAFGVWSADTVANSRAGKAEVAVASAPISPHVIMWH |
| Ga0184635_103892572 | 3300018072 | Groundwater Sediment | FAVVAATAFGVWSASPVVNSRAGKAEVAVASAPISPHVIMWQ |
| Ga0184624_103504541 | 3300018073 | Groundwater Sediment | MGIIGLAIIAATAFGVWSASTVAQSRVGKADVYAASAPISPHV |
| Ga0184633_103247612 | 3300018077 | Groundwater Sediment | IGLAVVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWH |
| Ga0190270_120013921 | 3300018469 | Soil | MRKLGIIGLAIVAATAFGVWSASTAAQSRVGKADV |
| Ga0190270_128725352 | 3300018469 | Soil | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVIMWH |
| Ga0193703_10571831 | 3300019876 | Soil | MRKFEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIM |
| Ga0193707_11240651 | 3300019881 | Soil | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLAASAPISPHAIMVK |
| Ga0193731_10665831 | 3300020001 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHAIM |
| Ga0210382_101087321 | 3300021080 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAAS |
| Ga0210380_105987531 | 3300021082 | Groundwater Sediment | MRKIEIIGLAVVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVI |
| Ga0193699_103848421 | 3300021363 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKAHVLAASAPISPHAIMV |
| Ga0222621_10996132 | 3300021510 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAP |
| Ga0222623_101090824 | 3300022694 | Groundwater Sediment | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHAIMVKL |
| Ga0222622_108436712 | 3300022756 | Groundwater Sediment | MRKFEIIGLAIVAATAFGLWSASTVAQSRVGKADVLAASAPISP |
| Ga0207682_105380941 | 3300025893 | Miscanthus Rhizosphere | MRKLEIIGLAFVAATAFGVWAASTVAQSRVGKADVLAASAPISPHA |
| Ga0207642_106097181 | 3300025899 | Miscanthus Rhizosphere | MRIVGLAIVAATAFGVWSASPAAQSRVGKADVLAASA |
| Ga0207710_107175461 | 3300025900 | Switchgrass Rhizosphere | RDNPMRIVGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207705_103783142 | 3300025909 | Corn Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPI |
| Ga0207693_101690734 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207662_104744411 | 3300025918 | Switchgrass Rhizosphere | RDNPMRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207659_113205761 | 3300025926 | Miscanthus Rhizosphere | TGWRDNPMRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207687_101725931 | 3300025927 | Miscanthus Rhizosphere | RRVHTGRRGNPMGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVVMWH |
| Ga0207709_107528771 | 3300025935 | Miscanthus Rhizosphere | MRKLGIIGLAIVAATAFGVWSASTAAQSRVGKADVLAASAPI |
| Ga0207670_106504211 | 3300025936 | Switchgrass Rhizosphere | MGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHV |
| Ga0207661_101390911 | 3300025944 | Corn Rhizosphere | MGIIGLAIIAATAFGVWSASTVVQSRVGKADVHAASAPISPHVVMWH |
| Ga0207640_102028451 | 3300025981 | Corn Rhizosphere | PMRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207677_108842521 | 3300026023 | Miscanthus Rhizosphere | RRGNPMGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMWH |
| Ga0207676_106556011 | 3300026095 | Switchgrass Rhizosphere | MRIVGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHVTMWH |
| Ga0207675_1000665461 | 3300026118 | Switchgrass Rhizosphere | MRIIGLAIVAATAFGVWSASPAAQSRVGKADVLAASAPISPHV |
| Ga0207683_104772992 | 3300026121 | Miscanthus Rhizosphere | MRIIGLAIVAATAFGVWSTSPAAQSRVGKADVLAASAPISPHVIMWQ |
| Ga0207981_10819531 | 3300027560 | Soil | MGIIGLTIVAATAFGVWSASTVTQSRLGKADVHAASAPISPHVIMWH |
| Ga0268265_117590882 | 3300028380 | Switchgrass Rhizosphere | EGTITMRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ |
| Ga0307295_100221861 | 3300028708 | Soil | MRKLEIIGLAVVAATAFGVWSADTVANSRAGKAEVAVASAPISPHVIMWH |
| Ga0307295_100489222 | 3300028708 | Soil | MHKLGIIGLAIVAATAFGVWSADTVANPKVAKAEVAAAFSAPPIRGF |
| Ga0307322_102338811 | 3300028710 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASA |
| Ga0307293_100630391 | 3300028711 | Soil | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLAASAPISSHAIVVK |
| Ga0307313_100872442 | 3300028715 | Soil | MRKIEIIGLAVVAATAFGVWSADTVANPKVAKAEVAAAFSAPPIRGL |
| Ga0307311_102494291 | 3300028716 | Soil | MRKLEIIGFAIVAATAFGVWSASTVAQSRVGKAHVLAASAPI |
| Ga0307301_101376663 | 3300028719 | Soil | MRKFEIIGLAIVAATAFGLWSASTVAQSRVGKADVLAASAPISPHAIMVKL |
| Ga0307315_100689271 | 3300028721 | Soil | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLA |
| Ga0307316_102760141 | 3300028755 | Soil | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLAASAP |
| Ga0307280_100481341 | 3300028768 | Soil | MHKLGIIGLAIVAATAFGVRSADTVANSKVAKAEVAAAFSAPPIRGF |
| Ga0307320_101445413 | 3300028771 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMWH |
| Ga0307282_101232241 | 3300028784 | Soil | MRKLEIIGLAIVAATAIGVWSASTVAQSRVGKADVLAASAPI |
| Ga0307281_103916331 | 3300028803 | Soil | MRKIEIIGLAVVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWH |
| Ga0307294_103786012 | 3300028810 | Soil | MHKLGIIGLAIVAATAFGVWSADTVANPKVAKAEV |
| Ga0307292_101289961 | 3300028811 | Soil | MRKIKIIGLAVVAATAFGVWSASTVVNSRAGKAEVALASAPISPHVIMWQ |
| Ga0307302_102015291 | 3300028814 | Soil | MRIIGLAIVAATAFGVWSASTVAQSRVGKAYVLAASAP |
| Ga0307310_102377321 | 3300028824 | Soil | MRKLGIIGLAGIVVATAFGVWSADTVANSKVAKAEAAAAFSAPPIRGF |
| Ga0307310_106652841 | 3300028824 | Soil | MRKLGIIGLAGIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIR |
| Ga0307312_104109201 | 3300028828 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKAHVLAASAPISPHAI |
| Ga0307312_104398984 | 3300028828 | Soil | MRKFEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPIS |
| Ga0307314_101467262 | 3300028872 | Soil | MGIIGLAIIAATAFGVWSASTAVQSRVGKADVHAASA |
| Ga0307289_102229121 | 3300028875 | Soil | MRKFEIIGLAIVAATAFGVWSASTVAQSRVGKADVL |
| Ga0307278_102744341 | 3300028878 | Soil | MRKLEIIGLAVVAATAFGVWSADTVANSRAGKAEVAVASAPISPH |
| Ga0307300_102344752 | 3300028880 | Soil | MRKIEIIGLAVVAATAFGVWSADTVANSRAGKAEVAVASAPISPHVIMWH |
| Ga0307308_103375801 | 3300028884 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMVKL |
| Ga0307308_105091321 | 3300028884 | Soil | AATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMWH |
| Ga0307304_102015761 | 3300028885 | Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKADVLAASAPIS |
| Ga0308201_101924551 | 3300031091 | Soil | MRKLEIIGFAIVAATAFGVWSASTVAQSRVGKADVLAASAPISPHVIMWH |
| Ga0307498_100985082 | 3300031170 | Soil | MRIIGLAIVAATAFGVWSASTVAQSRVGKAAVLAASAPISPHVLMWH |
| Ga0307498_104810951 | 3300031170 | Soil | MRKLGIIGLAIVAATAFGVWSAHTVANSKVAKAEVAAAFSAPPIRGF |
| Ga0170824_1156507361 | 3300031231 | Forest Soil | MRKLEIIGLAIVAATAFGVWSASTVAQSRVGKTDVLAASAP |
| Ga0170824_1255187262 | 3300031231 | Forest Soil | MRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIR |
| Ga0170820_163278891 | 3300031446 | Forest Soil | IIGLAIVAATAFGVWSASTVAQSRVGKAAVLAASAPISPHVLMWH |
| Ga0170818_1025042292 | 3300031474 | Forest Soil | MRKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAAAFSAPPIRGF |
| Ga0170818_1141708871 | 3300031474 | Forest Soil | MRKLEIIGLAIVAATAFVVWSASTVAQSRVGKADVLAASAPISPHAIMVKQK |
| Ga0310896_107567911 | 3300032211 | Soil | MHKLGIIGLAIVAATAFGVWSADTVANSKVAKAEVAVASAPISPHVIMWQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |