| Basic Information | |
|---|---|
| Family ID | F058344 |
| Family Type | Metagenome |
| Number of Sequences | 135 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.89 % |
| % of genes near scaffold ends (potentially truncated) | 69.63 % |
| % of genes from short scaffolds (< 2000 bps) | 91.11 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (16.296 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 1.96% β-sheet: 1.96% Coil/Unstructured: 96.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 5.19 |
| PF12680 | SnoaL_2 | 4.44 |
| PF03544 | TonB_C | 2.96 |
| PF00583 | Acetyltransf_1 | 2.22 |
| PF06441 | EHN | 1.48 |
| PF13643 | DUF4145 | 1.48 |
| PF12146 | Hydrolase_4 | 1.48 |
| PF13840 | ACT_7 | 1.48 |
| PF01513 | NAD_kinase | 0.74 |
| PF10502 | Peptidase_S26 | 0.74 |
| PF00291 | PALP | 0.74 |
| PF02518 | HATPase_c | 0.74 |
| PF00753 | Lactamase_B | 0.74 |
| PF08592 | Anthrone_oxy | 0.74 |
| PF13884 | Peptidase_S74 | 0.74 |
| PF13673 | Acetyltransf_10 | 0.74 |
| PF12773 | DZR | 0.74 |
| PF00067 | p450 | 0.74 |
| PF01471 | PG_binding_1 | 0.74 |
| PF13430 | DUF4112 | 0.74 |
| PF00535 | Glycos_transf_2 | 0.74 |
| PF00850 | Hist_deacetyl | 0.74 |
| PF00582 | Usp | 0.74 |
| PF07617 | DUF1579 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.96 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.48 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.48 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.22 % |
| Unclassified | root | N/A | 37.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02HFK7F | Not Available | 507 | Open in IMG/M |
| 2189573002|GZIGXIF01BXJ7J | Not Available | 514 | Open in IMG/M |
| 3300000881|JGI10215J12807_1035651 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 670 | Open in IMG/M |
| 3300000955|JGI1027J12803_104619176 | Not Available | 1408 | Open in IMG/M |
| 3300002126|JGI24035J26624_1034815 | Not Available | 555 | Open in IMG/M |
| 3300004633|Ga0066395_10806368 | Not Available | 564 | Open in IMG/M |
| 3300005179|Ga0066684_10275358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1112 | Open in IMG/M |
| 3300005187|Ga0066675_10636321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 801 | Open in IMG/M |
| 3300005332|Ga0066388_100314297 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2212 | Open in IMG/M |
| 3300005332|Ga0066388_100499685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1852 | Open in IMG/M |
| 3300005332|Ga0066388_100875111 | Not Available | 1480 | Open in IMG/M |
| 3300005332|Ga0066388_101156640 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300005332|Ga0066388_103555678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 795 | Open in IMG/M |
| 3300005332|Ga0066388_106833980 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005332|Ga0066388_108480811 | Not Available | 512 | Open in IMG/M |
| 3300005340|Ga0070689_101175645 | Not Available | 688 | Open in IMG/M |
| 3300005356|Ga0070674_101490678 | Not Available | 608 | Open in IMG/M |
| 3300005434|Ga0070709_11533825 | Not Available | 541 | Open in IMG/M |
| 3300005436|Ga0070713_100305507 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300005439|Ga0070711_100618016 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005457|Ga0070662_100732914 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 837 | Open in IMG/M |
| 3300005526|Ga0073909_10662085 | Not Available | 521 | Open in IMG/M |
| 3300005554|Ga0066661_10681456 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005560|Ga0066670_10833398 | Not Available | 560 | Open in IMG/M |
| 3300005598|Ga0066706_10863149 | Not Available | 708 | Open in IMG/M |
| 3300005713|Ga0066905_101767760 | Not Available | 569 | Open in IMG/M |
| 3300005764|Ga0066903_101910707 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1137 | Open in IMG/M |
| 3300005764|Ga0066903_103540393 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 841 | Open in IMG/M |
| 3300005764|Ga0066903_104341084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
| 3300005764|Ga0066903_107439604 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006046|Ga0066652_101810162 | Not Available | 551 | Open in IMG/M |
| 3300006175|Ga0070712_100605731 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 927 | Open in IMG/M |
| 3300006175|Ga0070712_101276787 | Not Available | 639 | Open in IMG/M |
| 3300006852|Ga0075433_11914843 | Not Available | 509 | Open in IMG/M |
| 3300006854|Ga0075425_100644681 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1217 | Open in IMG/M |
| 3300006871|Ga0075434_102310956 | Not Available | 540 | Open in IMG/M |
| 3300006893|Ga0073928_10000026 | All Organisms → cellular organisms → Bacteria | 357278 | Open in IMG/M |
| 3300007076|Ga0075435_101644193 | Not Available | 563 | Open in IMG/M |
| 3300007788|Ga0099795_10652027 | Not Available | 504 | Open in IMG/M |
| 3300009012|Ga0066710_100183951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2955 | Open in IMG/M |
| 3300009012|Ga0066710_101429944 | Not Available | 1071 | Open in IMG/M |
| 3300009147|Ga0114129_11836596 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 736 | Open in IMG/M |
| 3300009174|Ga0105241_10972693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300009177|Ga0105248_10718443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1127 | Open in IMG/M |
| 3300010042|Ga0126314_10714752 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 735 | Open in IMG/M |
| 3300010043|Ga0126380_10493898 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 937 | Open in IMG/M |
| 3300010047|Ga0126382_10005064 | All Organisms → cellular organisms → Bacteria | 5905 | Open in IMG/M |
| 3300010048|Ga0126373_10592728 | Not Available | 1160 | Open in IMG/M |
| 3300010323|Ga0134086_10130054 | Not Available | 908 | Open in IMG/M |
| 3300010358|Ga0126370_11056239 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 745 | Open in IMG/M |
| 3300010358|Ga0126370_11595047 | Not Available | 624 | Open in IMG/M |
| 3300010359|Ga0126376_12920912 | Not Available | 527 | Open in IMG/M |
| 3300010360|Ga0126372_10111789 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300010360|Ga0126372_10606883 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1051 | Open in IMG/M |
| 3300010361|Ga0126378_10730696 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1101 | Open in IMG/M |
| 3300010361|Ga0126378_10938758 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 971 | Open in IMG/M |
| 3300010361|Ga0126378_12932704 | Not Available | 544 | Open in IMG/M |
| 3300010362|Ga0126377_10365110 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300010366|Ga0126379_10497368 | Not Available | 1290 | Open in IMG/M |
| 3300010366|Ga0126379_12312127 | Not Available | 638 | Open in IMG/M |
| 3300010366|Ga0126379_12486336 | Not Available | 617 | Open in IMG/M |
| 3300010366|Ga0126379_13245063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 545 | Open in IMG/M |
| 3300010398|Ga0126383_10107436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2510 | Open in IMG/M |
| 3300012200|Ga0137382_10488926 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 873 | Open in IMG/M |
| 3300012202|Ga0137363_10350931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 1221 | Open in IMG/M |
| 3300012208|Ga0137376_10695168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 877 | Open in IMG/M |
| 3300012209|Ga0137379_10201261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria | 1904 | Open in IMG/M |
| 3300012350|Ga0137372_10651402 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300012362|Ga0137361_11170404 | Not Available | 691 | Open in IMG/M |
| 3300012923|Ga0137359_10806817 | Not Available | 813 | Open in IMG/M |
| 3300012925|Ga0137419_11367434 | Not Available | 597 | Open in IMG/M |
| 3300012948|Ga0126375_11442247 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 585 | Open in IMG/M |
| 3300012948|Ga0126375_11619987 | Not Available | 558 | Open in IMG/M |
| 3300012957|Ga0164303_10863123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
| 3300012971|Ga0126369_10345761 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300012971|Ga0126369_11895473 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 684 | Open in IMG/M |
| 3300012971|Ga0126369_12286798 | Not Available | 627 | Open in IMG/M |
| 3300012984|Ga0164309_11467732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 583 | Open in IMG/M |
| 3300012985|Ga0164308_11121574 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012985|Ga0164308_12182212 | Not Available | 516 | Open in IMG/M |
| 3300013296|Ga0157374_10069612 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3313 | Open in IMG/M |
| 3300013296|Ga0157374_10504967 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300013764|Ga0120111_1130589 | Not Available | 581 | Open in IMG/M |
| 3300014745|Ga0157377_10191173 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300014969|Ga0157376_10440310 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300015356|Ga0134073_10322844 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 558 | Open in IMG/M |
| 3300015371|Ga0132258_10541229 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
| 3300015372|Ga0132256_101777937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 725 | Open in IMG/M |
| 3300015373|Ga0132257_100903313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1107 | Open in IMG/M |
| 3300015374|Ga0132255_101003385 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300015374|Ga0132255_101056153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1220 | Open in IMG/M |
| 3300016270|Ga0182036_10488750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 973 | Open in IMG/M |
| 3300016294|Ga0182041_10706252 | Not Available | 894 | Open in IMG/M |
| 3300016371|Ga0182034_10095863 | Not Available | 2111 | Open in IMG/M |
| 3300016387|Ga0182040_10135893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1730 | Open in IMG/M |
| 3300018431|Ga0066655_10431992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 869 | Open in IMG/M |
| 3300018433|Ga0066667_11017708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 715 | Open in IMG/M |
| 3300018433|Ga0066667_11854915 | Not Available | 548 | Open in IMG/M |
| 3300019877|Ga0193722_1001392 | All Organisms → cellular organisms → Bacteria | 5647 | Open in IMG/M |
| 3300019886|Ga0193727_1047512 | Not Available | 1397 | Open in IMG/M |
| 3300021344|Ga0193719_10226140 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300022557|Ga0212123_10000630 | All Organisms → cellular organisms → Bacteria | 110852 | Open in IMG/M |
| 3300022898|Ga0247745_1023537 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300024222|Ga0247691_1077149 | Not Available | 504 | Open in IMG/M |
| 3300024288|Ga0179589_10085286 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300025905|Ga0207685_10119399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1155 | Open in IMG/M |
| 3300025917|Ga0207660_10314048 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1250 | Open in IMG/M |
| 3300025930|Ga0207701_10224597 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300025930|Ga0207701_10254806 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300025931|Ga0207644_10168782 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300025936|Ga0207670_10186529 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300025938|Ga0207704_11375532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300025944|Ga0207661_10610663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1001 | Open in IMG/M |
| 3300025945|Ga0207679_11208502 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 694 | Open in IMG/M |
| 3300026088|Ga0207641_10445354 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300026334|Ga0209377_1041989 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2098 | Open in IMG/M |
| 3300031057|Ga0170834_105168071 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1118 | Open in IMG/M |
| 3300031231|Ga0170824_121968999 | Not Available | 533 | Open in IMG/M |
| 3300031469|Ga0170819_13550168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
| 3300031469|Ga0170819_17655107 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 684 | Open in IMG/M |
| 3300031474|Ga0170818_102903568 | Not Available | 532 | Open in IMG/M |
| 3300031720|Ga0307469_10407161 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1163 | Open in IMG/M |
| 3300031720|Ga0307469_11238244 | Not Available | 707 | Open in IMG/M |
| 3300031740|Ga0307468_100645147 | Not Available | 874 | Open in IMG/M |
| 3300031740|Ga0307468_101127107 | Not Available | 701 | Open in IMG/M |
| 3300031854|Ga0310904_10484530 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 827 | Open in IMG/M |
| 3300031890|Ga0306925_12110520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300031946|Ga0310910_10914550 | Not Available | 688 | Open in IMG/M |
| 3300032059|Ga0318533_10556340 | Not Available | 841 | Open in IMG/M |
| 3300032174|Ga0307470_10598177 | Not Available | 824 | Open in IMG/M |
| 3300032180|Ga0307471_101580159 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 812 | Open in IMG/M |
| 3300032205|Ga0307472_100591353 | Not Available | 977 | Open in IMG/M |
| 3300032261|Ga0306920_100429835 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300032421|Ga0310812_10310723 | Not Available | 702 | Open in IMG/M |
| 3300033433|Ga0326726_10230166 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.22% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.48% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.74% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_03656740 | 2170459013 | Grass Soil | MVAGFYGSRRSAIELPGGINDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| FE1_02866440 | 2189573002 | Grass Soil | ELPGGVNDSSCHEKVDYSYFSALYSGNGAGFLRERFRR |
| JGI10215J12807_10356511 | 3300000881 | Soil | MVAGFYGSRRSAIELPGDVNDSFRHEKVDYSCFSALCSGDGAGFLRE |
| JGI1027J12803_1046191764 | 3300000955 | Soil | MVAGFYGSRLSAIELPGGVNDSSCHEKVDYSCFSALCGGDDAGFLRERFQR* |
| JGI24035J26624_10348152 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | AIELPGGVNDSSCHEKVDYSCFSVLCSGDGAGFLRERFRR* |
| Ga0066395_108063681 | 3300004633 | Tropical Forest Soil | MWHVVFYEILCAHFTHQKMVAGCYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR* |
| Ga0066684_102753581 | 3300005179 | Soil | AHFTHQKMVAGFYGSRRSAIELPGAVNDSSCHEKVDYSCFSALCSGDGAGFVRERFRR* |
| Ga0066675_106363211 | 3300005187 | Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFQR* |
| Ga0066388_1003142974 | 3300005332 | Tropical Forest Soil | MTYIFYGILCAHFTHQKKVAGFYASRRAAIELPGGVNDSSCHEKVDYFCFSALCSGDGPGFLREQFGR* |
| Ga0066388_1004996853 | 3300005332 | Tropical Forest Soil | MVAGFYGSRRSAIELPDGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0066388_1008751111 | 3300005332 | Tropical Forest Soil | RSAIELPGGVNDSSCHEKVDYSCFSALSSGDGAGFLRERFRR* |
| Ga0066388_1011566401 | 3300005332 | Tropical Forest Soil | RSAIELPGGVNDSSCHEKVDYACFSALCIGDGVGFLRERFRR* |
| Ga0066388_1035556782 | 3300005332 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSRHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0066388_1068339801 | 3300005332 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAG |
| Ga0066388_1084808111 | 3300005332 | Tropical Forest Soil | HQKMVAGFYGSRRSAIELRGGVNDSSGHEKVDHSCFSALCSGDGAGFLREPLRRSFPS* |
| Ga0070689_1011756451 | 3300005340 | Switchgrass Rhizosphere | QKMVAGFYGSRRSAIELPGGVNDSSCHEKVHYSCFGALCSGDGAGFLRERFRR* |
| Ga0070674_1014906781 | 3300005356 | Miscanthus Rhizosphere | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLR |
| Ga0070709_115338251 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HIVFYGILCAHFTHQKMVAGFYGSRRSAIELPGDVNDSSCHEKVDYSCFGALCSGDGAGFLRERFRR* |
| Ga0070713_1003055073 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | QKMVAGFYGSRRSAIELPGDVNDSSCHEKVDYSCFGALCSGNGACFVRERFRR* |
| Ga0070711_1006180162 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VAHFTHQKMVAGFYDSRRSAIELPGGVNDSSCHEKVDYSCFGALCSGDGAGFLREPFRR* |
| Ga0070662_1007329142 | 3300005457 | Corn Rhizosphere | MVAGFYGSRRSAIESPGGVNDSSCHEKVDYSCFSALCIDDGAGFLRERFRR* |
| Ga0073909_106620851 | 3300005526 | Surface Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR* |
| Ga0066661_106814562 | 3300005554 | Soil | FYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFVRERFRR* |
| Ga0066670_108333981 | 3300005560 | Soil | ILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0066706_108631491 | 3300005598 | Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFQR* |
| Ga0066905_1017677602 | 3300005713 | Tropical Forest Soil | GFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCIGDGAGFLRERFQR* |
| Ga0066903_1019107071 | 3300005764 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGF |
| Ga0066903_1035403932 | 3300005764 | Tropical Forest Soil | MVAGYCGSRRSAIELPVGVNDSSSHEKVDYSCFSALCSGDGAGFLREQFQR* |
| Ga0066903_1043410841 | 3300005764 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVVYSCFSAVCSADGDGFLRERFRR* |
| Ga0066903_1074396042 | 3300005764 | Tropical Forest Soil | QKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCNGDGAGFLRERFQC* |
| Ga0066652_1018101622 | 3300006046 | Soil | QKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0070712_1006057312 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFVRERFRR* |
| Ga0070712_1012767871 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREPFRR* |
| Ga0075433_119148431 | 3300006852 | Populus Rhizosphere | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCGGDVADILSERFQC* |
| Ga0075425_1006446813 | 3300006854 | Populus Rhizosphere | SAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR* |
| Ga0075434_1023109561 | 3300006871 | Populus Rhizosphere | GGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0073928_1000002662 | 3300006893 | Iron-Sulfur Acid Spring | MVAGFYGSRRSAIELPGGVDDSSSHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0075435_1016441931 | 3300007076 | Populus Rhizosphere | SRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0099795_106520272 | 3300007788 | Vadose Zone Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0066710_1001839515 | 3300009012 | Grasslands Soil | HQKMVAGFYGSRRSAIELPGGVNDSSRHEKVHYSCFSALCSGDGAGFLRERFRR |
| Ga0066710_1014299441 | 3300009012 | Grasslands Soil | MHQKMVAGFYGSRRSAIELPGGVNDSSRHEKVHYSCFSALC |
| Ga0114129_118365961 | 3300009147 | Populus Rhizosphere | MVAGFYGSRRSAIELLGGVNDSSCHEKVDYSSFSALCSGDGAGF |
| Ga0105241_109726932 | 3300009174 | Corn Rhizosphere | IELPGGVNDSSCHEKVDYSCFSALRSGDGAGFLREQFLRGSFPS* |
| Ga0105248_107184433 | 3300009177 | Switchgrass Rhizosphere | MLCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0126314_107147522 | 3300010042 | Serpentine Soil | YGSRRSAIELPGGVNDSSCHEKVDYFCFRTFCSDDVAGFLREQFRR* |
| Ga0126380_104938981 | 3300010043 | Tropical Forest Soil | MVAGFYGSRRSAIESPGGVNDSSCDEKVDYSCFSAL |
| Ga0126382_100050649 | 3300010047 | Tropical Forest Soil | MVRARLYGARRCVIELPGGVNDSSCHEKVDYSCFSALCSGDG |
| Ga0126373_105927281 | 3300010048 | Tropical Forest Soil | MVAGFYGSRRSAIELRGGVNDSSGHEKVDHSCFSALCSGDGAGFLREPL* |
| Ga0134086_101300542 | 3300010323 | Grasslands Soil | MHQKMVAGFYGSRRSAIELPGGVNDSSRHEKVHYSCFSALCSGDGAGFLRERFQR* |
| Ga0126370_110562392 | 3300010358 | Tropical Forest Soil | VFTLHIVFYGILCAHFTHQKMVAGYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLQ* |
| Ga0126370_115950471 | 3300010358 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSRHEKVDYSCFSALCSGDGAGFLREQFRR* |
| Ga0126376_129209122 | 3300010359 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALRSGDGAGFLREQFRR* |
| Ga0126372_101117892 | 3300010360 | Tropical Forest Soil | MVAGFYGSPRSAIELPGGVNDSSCHEKVDYSCFSALRSGDGAGFLREQFRR* |
| Ga0126372_106068832 | 3300010360 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYFCFSALCSGDGAGFLRERFRR* |
| Ga0126378_107306961 | 3300010361 | Tropical Forest Soil | MVARFYGSRRSAIELPGGVNDSSCHEKVDYSCFSAL |
| Ga0126378_109387582 | 3300010361 | Tropical Forest Soil | YGSRRSAIELPGGVNDSSCHEKVDYSCFSALCNGDGAGFLREQFRR* |
| Ga0126378_129327041 | 3300010361 | Tropical Forest Soil | MIAGFYGSRRSAIELPGGVNDSPCHEKVDYSRFSALCSGDGAGFLRERFL* |
| Ga0126377_103651101 | 3300010362 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSG |
| Ga0126379_104973681 | 3300010366 | Tropical Forest Soil | LYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0126379_123121271 | 3300010366 | Tropical Forest Soil | ELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0126379_124863361 | 3300010366 | Tropical Forest Soil | RRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGASFLRERFRR* |
| Ga0126379_132450632 | 3300010366 | Tropical Forest Soil | MPLTYGARRSAIELPGGVNDSFCHEKVDYSCFSALCSGDGAGFLRERFR* |
| Ga0126383_101074361 | 3300010398 | Tropical Forest Soil | RSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLQ* |
| Ga0137382_104889262 | 3300012200 | Vadose Zone Soil | MTYSFYGILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0137363_103509311 | 3300012202 | Vadose Zone Soil | AHFTHQKMVAGFYGSRRSAIELPGGVNDSSRHEKVHYSCFSALCSGDGAGFLRERFRR* |
| Ga0137376_106951681 | 3300012208 | Vadose Zone Soil | HIVFYGILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0137379_102012613 | 3300012209 | Vadose Zone Soil | MVAGFYGSRRSAIELPGGVNDSSRHEKVHYSCFSALCSGDGAGFVRERFQR* |
| Ga0137372_106514022 | 3300012350 | Vadose Zone Soil | MCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFVRERFRR |
| Ga0137361_111704043 | 3300012362 | Vadose Zone Soil | GFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0137359_108068171 | 3300012923 | Vadose Zone Soil | GSRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR* |
| Ga0137419_113674341 | 3300012925 | Vadose Zone Soil | MHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVHYSCFSALCIGNGAGFLRERFRR* |
| Ga0126375_114422471 | 3300012948 | Tropical Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCIGDGAG |
| Ga0126375_116199871 | 3300012948 | Tropical Forest Soil | YGSRRSAIELPGGVNDSSCHEKVDYSCFNALCSGDGAGFLREQFRR* |
| Ga0164303_108631231 | 3300012957 | Soil | LPGGVNDSSCHEKIDYSCFSALCSGDGAGFLRERFRR* |
| Ga0126369_103457613 | 3300012971 | Tropical Forest Soil | ELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR* |
| Ga0126369_118954731 | 3300012971 | Tropical Forest Soil | MPLTYGARRSAIELPGGVNDSFCHEKVDYSCFSALCSGDGAGFLRE |
| Ga0126369_122867982 | 3300012971 | Tropical Forest Soil | IELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFQR* |
| Ga0164309_114677321 | 3300012984 | Soil | PIVFYGILCAHFTHHKMVAGFYGSRRSAIELPGGINDSSCHEKVDYSCFSALFSSDGAGFVRERFRR* |
| Ga0164308_111215742 | 3300012985 | Soil | MVFHGILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREPFRR* |
| Ga0164308_121822121 | 3300012985 | Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFL |
| Ga0157374_100696121 | 3300013296 | Miscanthus Rhizosphere | GVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR* |
| Ga0157374_105049671 | 3300013296 | Miscanthus Rhizosphere | MVARFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALC |
| Ga0120111_11305891 | 3300013764 | Permafrost | MCAHFTHQEMVAGFYGSRRSAVELRGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0157377_101911732 | 3300014745 | Miscanthus Rhizosphere | MVAGFYGSRRSAIELPGGVNDSSCHEKVHYSCFGALCNGDGAGFVRERFRR* |
| Ga0157376_104403101 | 3300014969 | Miscanthus Rhizosphere | QKMFASFYDSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRQQFRR* |
| Ga0134073_103228441 | 3300015356 | Grasslands Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDSFCFSALCSGDGAGFLRERFQR* |
| Ga0132258_105412291 | 3300015371 | Arabidopsis Rhizosphere | HQKMVAGFYDSRRSAIELPGGVNDSSCHEKVDYSCFGALCSGDGAGFLREPFRR* |
| Ga0132256_1017779372 | 3300015372 | Arabidopsis Rhizosphere | AIELPGGVNDSSCHEKVDYSCFSALCSGDGTGFLREPFRR* |
| Ga0132257_1009033131 | 3300015373 | Arabidopsis Rhizosphere | RRSAIELPGGVNDSSCHEKVDYSCFSALCSGDSAGFVRERFRR* |
| Ga0132255_1010033853 | 3300015374 | Arabidopsis Rhizosphere | GFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALRSGDGAGFLREQFLRGSFPS* |
| Ga0132255_1010561531 | 3300015374 | Arabidopsis Rhizosphere | MVAGFYGSRRSAIESPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQF |
| Ga0182036_104887501 | 3300016270 | Soil | MVAGFYGSRRFPIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQ |
| Ga0182041_107062522 | 3300016294 | Soil | SAIELPGGVNDSSCHEKVDYSCFSALCIGDGAGFLRERFRR |
| Ga0182034_100958631 | 3300016371 | Soil | MVVGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQLRRSFPS |
| Ga0182040_101358933 | 3300016387 | Soil | VAHFTHQKMVAGFYGSRRFPIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQVRRSFPS |
| Ga0066655_104319921 | 3300018431 | Grasslands Soil | GSRRSAIELPGGVNDSSCHEKVDYSCFSALCNGDGAGFLRERFRR |
| Ga0066667_110177081 | 3300018433 | Grasslands Soil | ILCAHFTHQKMVAGFYGSRRSAIELSGGVNDSSRHEKVDYSCFSALCSGDGAGFLRKQFL |
| Ga0066667_118549152 | 3300018433 | Grasslands Soil | MIAGFYGSPRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0193722_10013923 | 3300019877 | Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLR |
| Ga0193727_10475122 | 3300019886 | Soil | HEKVVAGFYGSRRSAIELPGGVNDSSCHEKVDYTCFSARCSGDGAGFLRERFRR |
| Ga0193719_102261401 | 3300021344 | Soil | VVAGFYGSRRSAIELPGGVNDSSSHEKVDYSCFSALCSG |
| Ga0212123_1000063046 | 3300022557 | Iron-Sulfur Acid Spring | MVAGFYGSRRSAIELPGGVDDSSSHEKVDYSCFSALCSGDGAGFLREQFLR |
| Ga0247745_10235371 | 3300022898 | Soil | LYTTYRFYGILCAHFTHQEMVAGFYGSRRSAVELPGGVNDSSSHEKVDYSCFSALCSGDGAGFLRQQFRR |
| Ga0247691_10771491 | 3300024222 | Soil | MVAGFYGSRRSAIELPGDVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR |
| Ga0179589_100852861 | 3300024288 | Vadose Zone Soil | THQKVVAGFYGSRRSAIELPGDVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR |
| Ga0207685_101193991 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | SDFIRHIVFYGILCAHFTHQKMVAGFYGSRRSAIEFPGGVNDSSCHEKVDYPCFSALCSGDGAGFVRERFRR |
| Ga0207660_103140482 | 3300025917 | Corn Rhizosphere | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFGALCSGDGAGFLRERFRR |
| Ga0207701_102245971 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | IELPGGVNDSSCHEKVDYSCFSALWSGDGAGFLRERFRR |
| Ga0207701_102548061 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MVARFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFR |
| Ga0207644_101687821 | 3300025931 | Switchgrass Rhizosphere | IELPGDVNDSSRHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0207670_101865293 | 3300025936 | Switchgrass Rhizosphere | IELPGDVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0207704_113755322 | 3300025938 | Miscanthus Rhizosphere | LISDALRSTISARFYGSRRSAIELPGGVNDSSCHEKVDYSCFGALCSGDGAGFLREPFRR |
| Ga0207661_106106631 | 3300025944 | Corn Rhizosphere | AIELPGGVNDSSCHEKVHYSCFGALCSGDGVGFLRERFRC |
| Ga0207679_112085021 | 3300025945 | Corn Rhizosphere | MVAGFYGSRRSAIELPGDVNDSSCHEKVDYSCFSALCSRDGAGFL |
| Ga0207641_104453542 | 3300026088 | Switchgrass Rhizosphere | AGFYGSRRSAIELPGEVNDSSCHEKVDYSCFSALWSGDGAGFLRERFRR |
| Ga0209377_10419895 | 3300026334 | Soil | MCAHFTHQKMVAGFYGSRRSAIELPGGVNDTSRHEKVHYSCFSALC |
| Ga0170834_1051680712 | 3300031057 | Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFGALCSGDGAGFLREQFRR |
| Ga0170824_1219689991 | 3300031231 | Forest Soil | VHFTHQKMVAGFYGSPRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFRR |
| Ga0170819_135501682 | 3300031469 | Forest Soil | AGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREPFRR |
| Ga0170819_176551071 | 3300031469 | Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGA |
| Ga0170818_1029035681 | 3300031474 | Forest Soil | GILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREPFRR |
| Ga0307469_104071613 | 3300031720 | Hardwood Forest Soil | VVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0307469_112382441 | 3300031720 | Hardwood Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFL |
| Ga0307468_1006451472 | 3300031740 | Hardwood Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREPFRR |
| Ga0307468_1011271072 | 3300031740 | Hardwood Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYPCFSALCSGDGAGFVRERFRR |
| Ga0310904_104845301 | 3300031854 | Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALRSGDGAGFLREQFLRGS |
| Ga0306925_121105201 | 3300031890 | Soil | MVVGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRE |
| Ga0310910_109145501 | 3300031946 | Soil | SAIELPDGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFQR |
| Ga0318533_105563402 | 3300032059 | Soil | FTHQKMVVGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQLRRSFPS |
| Ga0307470_105981771 | 3300032174 | Hardwood Forest Soil | EGILCAHFTHQKMVTGFYGSRRSVIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLREQFLRRPSSSSH |
| Ga0307471_1015801591 | 3300032180 | Hardwood Forest Soil | MVAGFYGSRRSAIEFPGGVNDSSCHEKVDYPCFSALCSGDGAGFVRERFRR |
| Ga0307472_1005913532 | 3300032205 | Hardwood Forest Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0306920_1004298353 | 3300032261 | Soil | AHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSADGAGFLREQLRRSFPS |
| Ga0310812_103107231 | 3300032421 | Soil | ALGGVFISHIVFYGILCAHFTHQKMVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSALCSGDGAGFLRERFRR |
| Ga0326726_102301661 | 3300033433 | Peat Soil | MVAGFYGSRRSAIELPGGVNDSSCHEKVDYSCFSV |
| ⦗Top⦘ |