NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058343

Metagenome / Metatranscriptome Family F058343

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058343
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 58 residues
Representative Sequence VTWYTRENAAERAGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIPLE
Number of Associated Samples 119
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.11 %
% of genes near scaffold ends (potentially truncated) 94.81 %
% of genes from short scaffolds (< 2000 bps) 92.59 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.81

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.148 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.407 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.370 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.93%    β-sheet: 4.60%    Coil/Unstructured: 57.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.81
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.6.1.3: DNA-binding N-terminal domain of transcription activatorsd1q06a_1q060.83911
a.6.1.3: DNA-binding N-terminal domain of transcription activatorsd1r8da_1r8d0.83085
a.6.1.0: automated matchesd2zhga_2zhg0.82944
a.6.1.0: automated matchesd5gpea_5gpe0.82615
a.6.1.3: DNA-binding N-terminal domain of transcription activatorsd1r8ea11r8e0.8167


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF01243Putative_PNPOx 5.19
PF05639Pup 4.44
PF00561Abhydrolase_1 3.70
PF06224HTH_42 2.22
PF13474SnoaL_3 2.22
PF12680SnoaL_2 2.22
PF00583Acetyltransf_1 2.22
PF01402RHH_1 2.22
PF06305LapA_dom 1.48
PF12681Glyoxalase_2 1.48
PF01850PIN 1.48
PF00355Rieske 1.48
PF05899Cupin_3 1.48
PF08281Sigma70_r4_2 1.48
PF02567PhzC-PhzF 1.48
PF00196GerE 1.48
PF12441CopG_antitoxin 0.74
PF12867DinB_2 0.74
PF12697Abhydrolase_6 0.74
PF08240ADH_N 0.74
PF00881Nitroreductase 0.74
PF08241Methyltransf_11 0.74
PF00753Lactamase_B 0.74
PF01872RibD_C 0.74
PF13424TPR_12 0.74
PF13508Acetyltransf_7 0.74
PF13560HTH_31 0.74
PF04525LOR 0.74
PF00248Aldo_ket_red 0.74
PF00211Guanylate_cyc 0.74
PF00266Aminotran_5 0.74
PF02463SMC_N 0.74
PF06123CreD 0.74
PF04134DCC1-like 0.74
PF069833-dmu-9_3-mt 0.74
PF01041DegT_DnrJ_EryC1 0.74
PF00903Glyoxalase 0.74
PF05362Lon_C 0.74
PF07991IlvN 0.74
PF00293NUDIX 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 2.22
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 1.48
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 1.48
COG0059Ketol-acid reductoisomeraseAmino acid transport and metabolism [E] 1.48
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 0.74
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 0.74
COG4452Inner membrane protein CreD involved in colicin E2 resistanceDefense mechanisms [V] 0.74
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.74
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 0.74
COG3011Predicted thiol-disulfide oxidoreductase YuxK, DCC familyGeneral function prediction only [R] 0.74
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.74
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.74
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.74
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.74
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.74
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.74
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.74
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.74
COG0499S-adenosylhomocysteine hydrolaseCoenzyme transport and metabolism [H] 0.74
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 0.74
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.74
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.74
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.89 %
UnclassifiedrootN/A11.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_168190All Organisms → cellular organisms → Bacteria → Terrabacteria group562Open in IMG/M
3300000881|JGI10215J12807_1168629All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300000890|JGI11643J12802_11788989All Organisms → cellular organisms → Bacteria → Terrabacteria group1067Open in IMG/M
3300000956|JGI10216J12902_101858853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300001431|F14TB_100991645All Organisms → cellular organisms → Bacteria → Terrabacteria group535Open in IMG/M
3300002243|C687J29039_10114261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter cavernae985Open in IMG/M
3300003541|JGI20214J51650_11001617All Organisms → cellular organisms → Bacteria → Terrabacteria group583Open in IMG/M
3300004009|Ga0055437_10245016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300004061|Ga0055487_10048732All Organisms → cellular organisms → Bacteria → Terrabacteria group681Open in IMG/M
3300004114|Ga0062593_101384431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300004156|Ga0062589_100099387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1846Open in IMG/M
3300004157|Ga0062590_100028459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2784Open in IMG/M
3300004480|Ga0062592_100060997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2117Open in IMG/M
3300004480|Ga0062592_100133902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1622Open in IMG/M
3300005093|Ga0062594_100839325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300005093|Ga0062594_102342727All Organisms → cellular organisms → Bacteria → Terrabacteria group582Open in IMG/M
3300005093|Ga0062594_103299118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriaceae → Corynebacterium → Corynebacterium glyciniphilum507Open in IMG/M
3300005168|Ga0066809_10092540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae730Open in IMG/M
3300005172|Ga0066683_10064042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2189Open in IMG/M
3300005180|Ga0066685_11033001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300005332|Ga0066388_108120877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Corynebacteriaceae → Corynebacterium → Corynebacterium otitidis524Open in IMG/M
3300005345|Ga0070692_10821969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia636Open in IMG/M
3300005441|Ga0070700_100805515All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005447|Ga0066689_10498116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus igniterrae768Open in IMG/M
3300005518|Ga0070699_100983167All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005518|Ga0070699_101936985All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005526|Ga0073909_10074120All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300005536|Ga0070697_100201940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1690Open in IMG/M
3300005536|Ga0070697_100270651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1456Open in IMG/M
3300005552|Ga0066701_10823903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005558|Ga0066698_10006308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6102Open in IMG/M
3300005764|Ga0066903_107699787All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300006175|Ga0070712_100662886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium887Open in IMG/M
3300006577|Ga0074050_11250048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300006578|Ga0074059_11989232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300006581|Ga0074048_10062406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2513Open in IMG/M
3300006796|Ga0066665_11271651All Organisms → cellular organisms → Bacteria → Terrabacteria group564Open in IMG/M
3300006953|Ga0074063_13549708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300007076|Ga0075435_101926071All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009012|Ga0066710_102634776All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300009012|Ga0066710_104888849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300009090|Ga0099827_11750929All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300009094|Ga0111539_11194769All Organisms → cellular organisms → Bacteria → Terrabacteria group883Open in IMG/M
3300009553|Ga0105249_12753457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300009817|Ga0105062_1120855All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300010362|Ga0126377_11822473All Organisms → cellular organisms → Archaea684Open in IMG/M
3300010396|Ga0134126_11801531All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300010399|Ga0134127_10178026All Organisms → cellular organisms → Bacteria1958Open in IMG/M
3300010399|Ga0134127_11470646Not Available753Open in IMG/M
3300010403|Ga0134123_10977186Not Available860Open in IMG/M
3300012201|Ga0137365_10164286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1665Open in IMG/M
3300012201|Ga0137365_10848266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium667Open in IMG/M
3300012208|Ga0137376_11100890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora phatthalungensis679Open in IMG/M
3300012210|Ga0137378_11789850All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300012351|Ga0137386_10310854All Organisms → cellular organisms → Bacteria → Terrabacteria group1134Open in IMG/M
3300012353|Ga0137367_10248952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1278Open in IMG/M
3300012353|Ga0137367_11141611All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300012355|Ga0137369_10240912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1373Open in IMG/M
3300012355|Ga0137369_11085646All Organisms → cellular organisms → Bacteria → Terrabacteria group524Open in IMG/M
3300012358|Ga0137368_10167446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1601Open in IMG/M
3300012358|Ga0137368_10295058All Organisms → cellular organisms → Bacteria → Terrabacteria group1099Open in IMG/M
3300012532|Ga0137373_10155308All Organisms → cellular organisms → Bacteria1926Open in IMG/M
3300012904|Ga0157282_10190079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300012957|Ga0164303_11049710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300012964|Ga0153916_10866564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → Persicimonas → Persicimonas caeni984Open in IMG/M
3300014266|Ga0075359_1168398All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300014307|Ga0075304_1031210All Organisms → cellular organisms → Bacteria → Terrabacteria group1106Open in IMG/M
3300015371|Ga0132258_10714013All Organisms → cellular organisms → Bacteria2524Open in IMG/M
3300015372|Ga0132256_103642560All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300015374|Ga0132255_103525715All Organisms → cellular organisms → Bacteria → Terrabacteria group666Open in IMG/M
3300015374|Ga0132255_104985595Not Available562Open in IMG/M
3300017656|Ga0134112_10519013All Organisms → cellular organisms → Bacteria → Terrabacteria group507Open in IMG/M
3300017959|Ga0187779_11171820All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300017973|Ga0187780_10141336All Organisms → cellular organisms → Bacteria → Terrabacteria group1667Open in IMG/M
3300017974|Ga0187777_11068545All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300018058|Ga0187766_10423781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria884Open in IMG/M
3300018075|Ga0184632_10304929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi689Open in IMG/M
3300018468|Ga0066662_12065122All Organisms → cellular organisms → Bacteria → Terrabacteria group597Open in IMG/M
3300018481|Ga0190271_13128718All Organisms → cellular organisms → Bacteria → Terrabacteria group555Open in IMG/M
3300018481|Ga0190271_13801910All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300018482|Ga0066669_12265816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300019356|Ga0173481_10574524All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300019361|Ga0173482_10580040All Organisms → cellular organisms → Bacteria → Terrabacteria group560Open in IMG/M
3300019867|Ga0193704_1081331Not Available593Open in IMG/M
3300020016|Ga0193696_1095898All Organisms → cellular organisms → Bacteria → Terrabacteria group764Open in IMG/M
3300021080|Ga0210382_10502466All Organisms → cellular organisms → Bacteria → Terrabacteria group537Open in IMG/M
3300025289|Ga0209002_10023522All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4482Open in IMG/M
3300025319|Ga0209520_10225925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter cavernae1169Open in IMG/M
3300025322|Ga0209641_10049045All Organisms → cellular organisms → Bacteria3263Open in IMG/M
3300025325|Ga0209341_10772734All Organisms → cellular organisms → Bacteria → Terrabacteria group731Open in IMG/M
3300025922|Ga0207646_11175157All Organisms → cellular organisms → Bacteria → Terrabacteria group673Open in IMG/M
3300025936|Ga0207670_11065243All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300025945|Ga0207679_12083569All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300025980|Ga0210137_1066843All Organisms → cellular organisms → Bacteria → Terrabacteria group556Open in IMG/M
3300026088|Ga0207641_12399569All Organisms → cellular organisms → Bacteria → Terrabacteria group526Open in IMG/M
3300026116|Ga0207674_10132416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2456Open in IMG/M
3300026530|Ga0209807_1117262Not Available1103Open in IMG/M
3300026550|Ga0209474_10659203All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300027703|Ga0207862_1263223Not Available504Open in IMG/M
3300027915|Ga0209069_10893390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi538Open in IMG/M
(restricted) 3300027995|Ga0233418_10110279All Organisms → cellular organisms → Bacteria → Terrabacteria group840Open in IMG/M
3300028145|Ga0247663_1109982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300028597|Ga0247820_10433771Not Available885Open in IMG/M
3300028711|Ga0307293_10001133All Organisms → cellular organisms → Bacteria6561Open in IMG/M
3300028712|Ga0307285_10039095Not Available1158Open in IMG/M
3300028713|Ga0307303_10050554All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300028716|Ga0307311_10052407Not Available1086Open in IMG/M
3300028718|Ga0307307_10192289Not Available644Open in IMG/M
3300028771|Ga0307320_10108751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1057Open in IMG/M
3300028796|Ga0307287_10067978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1326Open in IMG/M
3300028803|Ga0307281_10324390Not Available578Open in IMG/M
3300028807|Ga0307305_10239328Not Available830Open in IMG/M
3300028814|Ga0307302_10079719All Organisms → cellular organisms → Bacteria → Terrabacteria group1549Open in IMG/M
3300028814|Ga0307302_10703320All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300028819|Ga0307296_10214090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1046Open in IMG/M
3300028819|Ga0307296_10635457All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300028828|Ga0307312_10677778All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300028872|Ga0307314_10134965Not Available702Open in IMG/M
3300028876|Ga0307286_10038485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1598Open in IMG/M
3300028878|Ga0307278_10445793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora → Saccharopolyspora phatthalungensis567Open in IMG/M
3300028884|Ga0307308_10168526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1049Open in IMG/M
3300030336|Ga0247826_10626706All Organisms → cellular organisms → Bacteria → Terrabacteria group828Open in IMG/M
3300031226|Ga0307497_10599027All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031562|Ga0310886_10877378Not Available569Open in IMG/M
3300031670|Ga0307374_10261419All Organisms → cellular organisms → Bacteria → Terrabacteria group1143Open in IMG/M
3300031740|Ga0307468_101397065All Organisms → cellular organisms → Bacteria → Terrabacteria group643Open in IMG/M
3300031740|Ga0307468_101581548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300031949|Ga0214473_12213638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300032074|Ga0308173_10517507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1071Open in IMG/M
3300033004|Ga0335084_11179999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300033407|Ga0214472_10962931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300033482|Ga0316627_100350952All Organisms → cellular organisms → Bacteria → Terrabacteria group1240Open in IMG/M
3300033550|Ga0247829_10241859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1449Open in IMG/M
3300033551|Ga0247830_10625341All Organisms → cellular organisms → Bacteria → Terrabacteria group853Open in IMG/M
3300034090|Ga0326723_0110388Not Available1193Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.44%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.22%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.22%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.22%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.48%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.48%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.74%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.74%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.74%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.74%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004061Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014266Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1EnvironmentalOpen in IMG/M
3300014307Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025980Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_028223302199352025SoilVTSYPHDDCAERAGVEPSYLVRLVDLGIITPEDDRFSPGDVRRVLMAKSLEGAGIPLEGVAA
JGI10215J12807_116862933300000881SoilVTSYAHDDAAERAGVEPPYLVRLVDLGILTPGEDDRFSPGDVRRVLMAKSLE
JGI11643J12802_1178898913300000890SoilVTWYTRENAAERAGVEPSYLVRLVDLGILAPADPDRFSPGDVRRALMANSLEGAGIPLEGVAAGIQSGALSLSFLDAASYERF
JGI10216J12902_10185885313300000956SoilVTGYSREDAAERVGVEPSYLVRLVDLGIIVPEESDRFSPGDVRRVLLARSLEDA
F14TB_10099164523300001431SoilVTWYSREVAAERFGVEPSYLARLVDLGILVPEGSDRFSPGDVRRVLLARSLEDAGISLEGLTIDSARSLSSFLS*
C687J29039_1011426123300002243SoilVTWYTRENAAERAGVEPSYLARLVDLAILAPEEPDRFSPGDVRRVLMAKSLEDAGIPLEGVADAIGRGA
JGI20214J51650_1100161713300003541WetlandVTTYSAQDAAARAGVEPGYLVRLVDLGIIAPDATGFSPGDVRRAMMANSLEEAGIPLQGVGAAIRSGAISL
Ga0055437_1024501623300004009Natural And Restored WetlandsVTRYGRDGAAERAGVDGSYLDGLVDLGIVTPDAEGRFSDGDVRRVAIAKSLEGAGIPLDAVTD
Ga0055487_1004873213300004061Natural And Restored WetlandsMSMALHTRAEAAERAGVEPGFLDRLVEIGIIQPERPDRFSAGDVRRLLMAQSLEEAGIRLDDVGAAV
Ga0062593_10138443113300004114SoilVSWYTRANAAEQPGVEPSYLVRLVDLGILAPADPDGFSPGDVRRALMANSLEGAGIPLEGVAAGKQNGALLRAHIA*
Ga0062589_10009938723300004156SoilVTWYTRANAAEQPGVEPSYLVRLVDLGILAPADPDGFSPGDVRRALMANSLEGAGIPLEGVAAGKQNGALLRAHIA*
Ga0062590_10002845933300004157SoilVTWYTRANAAEQPGVEPSYLVRLVDLGILAPADPDGFSPGDVRRALMANSLEGAGIPLEGVAAGMQNGALLRAHIA*
Ga0062592_10006099723300004480SoilVSWYTRANAAEQPGVEPSYLVRLVDLGILAPADPDGFSPGDVRRALMANSLEGAGIPLEGVAAGMQNGALLRAHIA*
Ga0062592_10013390263300004480SoilVTSYPHEGAAERAGVEPSYLVRLVDLGIIAPGEDDRFSPGDVR
Ga0062594_10083932513300005093SoilVTSYPHEGAAERAGVEPSYLVRLVDLGIIAPGEDDRFSPGDVRRVLMAKSLE
Ga0062594_10234272713300005093SoilMYSCEEAAERVGVEPSYLDRLVELGILASDEPDRFSGGDVRRVL
Ga0062594_10329911813300005093SoilVTWHTRKDAAERVGVEPSYLVRLVDLGILAPDDSDRFSPGDVRRVWMAKSLEDAGIPLEGLAAGIKSGALSFSFLDAA
Ga0066809_1009254013300005168SoilMTSFAREDAAALAGVEPDYVVRLMDLGILVPEDGDRFSPGDVRRVVMAKSFEDAGIGLEDVATAIRRGAVSLRFLD
Ga0066683_1006404213300005172SoilVTWYSRDNAAEQVGVEPSYLVRLVDLGILSREDPDRFSPGDVRRVMMAKSLEDAGIPLEGLAA
Ga0066685_1103300113300005180SoilVTWYSRENAAERAEVEPNYLVRLVDLGILTCEEPDRFSPGDVRRVLMAK
Ga0066388_10812087713300005332Tropical Forest SoilVTWYSRDEAAERAGVDPSYLAQLVELGILNPDEPDHFSPGDVRRVRMARSIEDAAIPLDGVGAAIRQGRISLGFLDTPA
Ga0070692_1082196913300005345Corn, Switchgrass And Miscanthus RhizosphereVTWYAGEDVAERTGVEPSYVIRLVELGILVPEQPERFSAGDVRRVLMARSLEDAGIPLDDVAAAV
Ga0070700_10080551533300005441Corn, Switchgrass And Miscanthus RhizosphereVTSYAHDDAAERAGVEPPYLVRLVDLGILTPGEDDRFSPGDVRRVLMAKSLED
Ga0066689_1049811633300005447SoilVTWYSRENAAERAGVEPNYLVRLVDLGILAPEERDRFSPGD
Ga0070699_10098316723300005518Corn, Switchgrass And Miscanthus RhizosphereVTSHPRDDAAERAGVEPSYLVRLVDLGIITPQEDDRFSPGDVRRVLMAKSLED
Ga0070699_10193698523300005518Corn, Switchgrass And Miscanthus RhizosphereVIRYSRVNAAERAGVEPDYLVRLVKLGILTPDESDRFSPGDVRRVLMARSIE
Ga0073909_1007412023300005526Surface SoilVTWYTRANAAERAGVERSYLVRLVDLGILSPADPDRFSPGDVGRAPMANSLEGAGIPLEGVAAGMQNGALLRAHIA*
Ga0070697_10020194013300005536Corn, Switchgrass And Miscanthus RhizosphereVTWYTRQDAAERVGVEPSYLVRLVDLGILAPEEPDRFSPGDVR
Ga0070697_10027065133300005536Corn, Switchgrass And Miscanthus RhizosphereVTWYSSEDAAELAGVEPSYLFRLVDLGILATVEPDRFSPGDVRRVLMAKSLEDAGIPLDGVAAALQTGALSLAFLDAPSY
Ga0066701_1082390313300005552SoilVTWYSRQNAAERAGVEPNYLARMVDLAILAPEEPDRFSPGDVRRV
Ga0066698_1000630813300005558SoilVIWYSREDAAERVGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIPL
Ga0066903_10769978713300005764Tropical Forest SoilMDPSRLPAVTSYSREEAAERAGVELAFLARLVDLSILVPKEADRFTPGDVRRVLLADSLGHAG
Ga0070712_10066288623300006175Corn, Switchgrass And Miscanthus RhizosphereVTWYSREAAAERVGVEPSYLGRLVDLGILSPEGPDRFSPGDVRRVLMTKSLEDAGIPLEGLAAGIQSGALSF
Ga0074050_1125004823300006577SoilMTWYAGEDAAERAGVEPSYLVRLVDLGILAPEQPDGFSPGDVRRVLMARSLEDAGIALEDVAAGIRQ
Ga0074059_1198923213300006578SoilMTWYSREDAAQRAGVEPGYLAQLVDIGVLTPEEPDRFSPGDVRRVLMARSLEGAGM
Ga0074048_1006240613300006581SoilVTWYPRDDAAERAGVEPSYLVRLVDLGILAPEERDRFSP
Ga0066665_1127165123300006796SoilVTWYSRENAAERAGVEPNYLVRLVDLGILTPEEPDCFSPGDVRRVLMAKSLEDAGIPLD
Ga0074063_1354970823300006953SoilVTWYAGEDVAERTGVEPSYVVRLVELGILVPKESDRFSAGDVRRVLMARSLE
Ga0075435_10192607123300007076Populus RhizosphereVTRYSGEEAAGRAGVQPSFLARLVDLGILVPEAGRFSAGDVRRVLMVKSLEDAGIPLEGVAAAIQQGTLSLDFFDAASY
Ga0066710_10263477623300009012Grasslands SoilVTWYSRENAAERAGVEPRYLVRLVDLGVLVPEEPDRFSPGDVRRVLMTKSLEDAGV
Ga0066710_10488884913300009012Grasslands SoilVRNRQRYPHDVAWYSGEDAAGRAGVEPSHLVRLVDLGILTPDTPDRYSDGDVRRVLMAKSLEGAGIPLDAVAAATQRGAL
Ga0099827_1175092923300009090Vadose Zone SoilVTWYTRENAAKRVGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIPLEGVADAIQRGALSLSFMDAP
Ga0111539_1119476913300009094Populus RhizosphereMYSCEEAAERVGVEPSYLDRLVELGILALHEPDRFSGGDVRRVLMCRSLEDAGIPLEAVGAAIQGGTLSLAF
Ga0105249_1275345723300009553Switchgrass RhizosphereMTSYGREQAAERAGVEPSYVDRLVELGILAPDKSERFSSGDVRRVL
Ga0105062_112085523300009817Groundwater SandLYSREDAAERAGVESPFLARLVDLGILAPHEPDGFSPADVRRVLLANSLEQA
Ga0126377_1182247313300010362Tropical Forest SoilVTRFSREAVAERAGVESRFVVRLEELGILAPENDGRFSSSDVRRVLLAKSLEDAGIPLNEVV
Ga0134126_1180153113300010396Terrestrial SoilMTSYSAADVAERAGVEPAFLDRIVELGIVTPAEPDRFSPGDVR
Ga0134127_1017802613300010399Terrestrial SoilVTSYAHDDAAERAGVEPPYLVRLVDLGILTPGEDDRFSPGDVRRVLMAKSLEDAGIPLE
Ga0134127_1147064623300010399Terrestrial SoilVTWHTRKDAAERVGVEPSYLVRLVDLGILAPDDSDRFSPGDVRRAWMAKSLEDAGIPLEGLAAG
Ga0134123_1097718623300010403Terrestrial SoilVTWHTRKDAAERVGVEPSYLVRLVDLGILAPDDSDRFSPGDVRRVWMAKSLEDAGIPLEGLAAGI
Ga0137365_1016428613300012201Vadose Zone SoilVAWYSGEDAAERAGVEPSYLVRLFDLGILTPETPDRYSDGDVRRVLMATSLEGAGI
Ga0137365_1084826613300012201Vadose Zone SoilMTHGPTAWYSREKAAERAGVEPDYLVRLVDLGVLAPEEPDRFSPGDVRRVLMAKSLE
Ga0137376_1110089023300012208Vadose Zone SoilVTWYSREDAAERAGVEPYYLVRLVDLAILAPEEPDRFSPGDVRRVL
Ga0137378_1178985013300012210Vadose Zone SoilVTWYSREEAAERVGVEPSYLFRLVGLGILAPEEPDRFSPGDVRRVLMAKSLDDAGIPLDGVAAAIQ
Ga0137386_1031085433300012351Vadose Zone SoilVAWYSREDAAGRVGVEPNYIVRLADLGILAPEERDRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQRGA
Ga0137367_1024895233300012353Vadose Zone SoilLPNVTWYSREDAAERVGVEPSYLARLVDLGILVPEESDRFSPGDVRRVLMAKSLEDAGIP
Ga0137367_1114161123300012353Vadose Zone SoilVTWYSRENAAERVGVEPSYLVRLVDLGILSREEPDRFSPGDVRRVLMARSLEDAGIPLESVG
Ga0137369_1024091233300012355Vadose Zone SoilVTWYSCENAAERVGVEPSYLVRLGELGILAPEEPDRFSSGDVRRVLMARSLEDAGIPLEGVGAAIQRGTLSLAFLDAASYER
Ga0137369_1108564623300012355Vadose Zone SoilMTWYPREDAAERAGVEPSYLVRLVDLGIITPEERDRFSPGDVRRVLMAK
Ga0137368_1016744613300012358Vadose Zone SoilVTWYSCENAAERVGVEPSYLVRLVDLGILAPEEPDRFSSGDVRRVLMARSLEDAGIPLEGVGAAIQRGTLSLAFLDAASYER
Ga0137368_1029505823300012358Vadose Zone SoilVTWYSRENAAERAGVEPSYLVQLVDLGILAPQEPDRFSPGDVRR
Ga0137373_1015530813300012532Vadose Zone SoilVTWYSRENAAERAGVEPSYLVQLVDLGILAPQEPDRFSPGDVRRVLMAKSLE
Ga0157282_1019007923300012904SoilMTWYGREQAAERAGVGPSYVDRLVELGVLAPDEQERFSPGDV
Ga0164303_1104971023300012957SoilVTWYSREAAAERVGVEPSYLGRLVDLGILSPEEPDRFSPGDVRRVLMTKSLEDAGIPLDGLA
Ga0153916_1086656413300012964Freshwater WetlandsMTWYSREDAAQRAGVAPTYLVRLLDLGILAGSDPDRFSAGD
Ga0075359_116839813300014266Natural And Restored WetlandsVTTYSAQDAAARAGVEPGYLVRLVDLGIIAPDATGFSPGDVRRAMMANSLE
Ga0075304_103121033300014307Natural And Restored WetlandsVTWCSRDEAADRAGVEPDYLLRLMDLGILAPEDADRFSPGD
Ga0132258_1071401313300015371Arabidopsis RhizosphereLTDYSQEDVADRAGVDPAYVDGLVDLGILTPEEPDRFSTGD
Ga0132256_10364256013300015372Arabidopsis RhizosphereVTTYTCEEAAERVGVEPSYLDRLVELGILAPDEPDRF
Ga0132255_10352571513300015374Arabidopsis RhizosphereVTAYPHDDAAERAGVEPSYLVRLVDLGIISPQEDDRYSPGDVRRVLMAKS
Ga0132255_10498559513300015374Arabidopsis RhizosphereMTWYPREEAAERAGVEPSYLDRLVDVGILRPEDPGHWSPADVRRALMSRSLDAAGIPLDEVAAGIRSGAL
Ga0134112_1051901313300017656Grasslands SoilVTSYSRENAAVRAGVEPSYLARLVDLGIIACEELDRFSPGDVRRALMAKSLEDAGIPLEGVA
Ga0187779_1117182023300017959Tropical PeatlandMSAYGPEAAAERAGVEPAYVDRLVDLGIVAPSASDGFSPGDVRRVLMVRSLDDAGIPLDG
Ga0187780_1014133633300017973Tropical PeatlandVTSYSRGEAAERAGVEPGYVVRLVDLGIVGPVEPNRFSPGDVRR
Ga0187777_1106854513300017974Tropical PeatlandMPAYASVEAAERAGVEPAYLVRLVDLGIVVPDEKGRFSRGDVRRTLMA
Ga0187766_1042378123300018058Tropical PeatlandVTSRSREGAAERAGVEPAYLDRLLDLGILSPAGAERFSDGDVRRVMMAKSLEDAGIPLDRVAAALQQGAITL
Ga0184632_1030492913300018075Groundwater SedimentVTWYSREDAAERVGVEPSYLARLVDLGILVPDEADRFSPGDVRRVLLARSLEDAGISLEE
Ga0066662_1206512213300018468Grasslands SoilVTWYTREDAAERVGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIQLEGVAAGIQSGALSLSFLDAAS
Ga0190271_1312871833300018481SoilVATYTCEEAAERIGVEPSYLDRLVELGILAPDEPDRFSGGDVRRVLICRSL
Ga0190271_1380191013300018481SoilVTLYSCEEAAERVGVEPSYLDRLVELGILTPEEPDRFSGGD
Ga0066669_1226581623300018482Grasslands SoilVRNRQRYPHDVAWYSGEDAAGRAGVEPSHLVRLVDLGILTPDTPDRYSDGDVRRVLMAKSLEGAGIPLDAVA
Ga0173481_1057452413300019356SoilMYSCEEAAERVGVEPSYLDRLVELGILALHDPDRYSGGDV
Ga0173482_1058004023300019361SoilVSWYTRANAAEQPGVEPSYLVRLVDLGILAPADPDGFSPGDVRRALMANSLEGAGIPLEGVAAGMQNGALLR
Ga0193704_108133113300019867SoilVTWYSRENAAERVGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKSLEDAGIPLEGVAAGI
Ga0193696_109589813300020016SoilVIEYSREDAAERGGVELHYLRRLVDLGIIAPQGPDRFSPGDVRRVLMARSLEDAGIPLE
Ga0210382_1050246623300021080Groundwater SedimentVTWYAGEDVAERTGVEPSYLVRLVDLGILAPQEPDRFSPGDVRRVLMAKSLEGAGMPLEGVAAGIQSGALSLSFLDAA
Ga0209002_1002352243300025289SoilVNRYSREDAAERAGVEPSYLVRLMDLAILAPGEPDRFSPGDVRRVLMAKSLEDAGIPLEGVADAIRRGALSL
Ga0209520_1022592533300025319SoilVTWYTRENAAERAGVEPSYLVRLMDLGILAPEEPDRFSPGDVRRVLMAKSLE
Ga0209641_1004904583300025322SoilVTWYTRENAAERAGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIPLE
Ga0209341_1077273413300025325SoilVTRYSREDAAERAGVEPSYLVRLMDLGILAPEEPDRFSPGDVRRVLMAKS
Ga0207646_1117515713300025922Corn, Switchgrass And Miscanthus RhizosphereMTWYSREEAAERAAVEPSYLDRLVGLGIFAPEEPDRFSPGDVRRVVMAKSLEDAGIPLDGVAAAIQRRVLSLSFLDATSF
Ga0207670_1106524313300025936Switchgrass RhizosphereMTSYGREQAAERAGVQPSYIDRLVELGILAPDEPERFSAGDVRRVLMAKSFADAGIPLESVAD
Ga0207679_1208356913300025945Corn RhizosphereMYSCEEAAERVGVEPSYLDRLVELGILALHEPDRFS
Ga0210137_106684323300025980Natural And Restored WetlandsVTTYSAQDAAARAGVEPGYLVRLVDLGIIAPDATGFSPGDVRRAMMANSLEEAGI
Ga0207641_1239956913300026088Switchgrass RhizosphereVTSYPHEGAAERAGVEPSYLVRLVDLGIIAPGEDDRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQRGALSL
Ga0207674_1013241613300026116Corn RhizosphereVTSYPHEGAAERAGVEPSYLVRLVDLGIIAPGEDDRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQRG
Ga0209807_111726213300026530SoilVTWYSRENAAERAGVEPNYLVRLVDLGILTPEEPDCFSPGDVRR
Ga0209474_1065920313300026550SoilVTWYSRENAAERAGVEPNYLVRLVDLGILTPEEPDCFSPGDVRRVLMAKSLEDAGIPLDGVAAAIQRGALSLTF
Ga0207862_126322313300027703Tropical Forest SoilMTYSRDEAAERAGVEPGYVERLVDLGVLSPNEPGRFSPG
Ga0209069_1089339013300027915WatershedsVARYGRGDAAERAGVDPSYLVRLMDLGILAPEEPDRFSPGDLRRVLLAKSLEDAGIR
(restricted) Ga0233418_1011027913300027995SedimentVTRYSSADAAERAGVEASYLDQLVDLGILAPQEPDRFSP
Ga0247663_110998223300028145SoilVTWYAGDDVARQTGVDADYLVRLVDLGILAPQQPDRFVPGDVRRVQLARSLEDA
Ga0247820_1043377123300028597SoilVTAYPHDDAAERAGVEPSYLVRLVDLGIISPQEDDRYSPGDVRRVLMAKSLEDAGIPLD
Ga0307293_1000113383300028711SoilVTRYSREIAAERVGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKSLEDVGIPLEGVAAGISSGALSLSFFDAASYERFA
Ga0307285_1003909533300028712SoilVTRYSREIAAERVGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKSLEDAGIPLEGVAAGIKSGALS
Ga0307303_1005055413300028713SoilMTWYGREQAAERAGVEPSYVDRLVELGVLAPDEPERFSPG
Ga0307311_1005240733300028716SoilVTRYSREIAAERAGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKSLEDVGIPLEG
Ga0307307_1019228913300028718SoilVTRYSREIAAERVGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKSLEDVG
Ga0307320_1010875113300028771SoilVTSYPHDDAAERAGIEPSYLVRLVDLAIITPEEDDRFSPGDVRRVLMA
Ga0307287_1006797813300028796SoilVTSYPHDDAAERAGIEPSYLVRLVDLAIITPEEDDRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQRGA
Ga0307281_1032439023300028803SoilMAWYPRDDAAERAGVEPSYLVRLVDLGILSPEEDDHFSPGDVRRVLMAKS
Ga0307305_1023932813300028807SoilVTWYSRENAAERVGVEPSYLVRLVDLGILAPVDPDRFSPGDVRRVLMAKS
Ga0307302_1007971913300028814SoilVTWYPRDDAAERAGVEPSYLVRLVDLGILDPEEDDRFSPGDVRRVLMAKS
Ga0307302_1070332013300028814SoilVVRYSGEDAAERAGVEPSYLVRLVDLGILTPGTPDRYSDGDVRRVLM
Ga0307296_1021409023300028819SoilVTWYPRDDAAERAGVEPSYLVRLVDLGILDPEEDDRFSPGDVRRVLMAKSLEGAGIPLEGVAAAIQR
Ga0307296_1063545723300028819SoilVTRYAGEDVAERAGVEPSYLVRLVDLGILAPQEPDRFSPGDV
Ga0307312_1067777813300028828SoilVTRYAGEDVAERAGVEPSYLVRLVDLGILAPQEPDRFSPGDVRRVLMARSLEDAGIPLDAVADAI
Ga0307314_1013496513300028872SoilVTWYTRENAAKRAGVEPSYLVRLMDLGILAPADPDRFSPGDVRRALMANSL
Ga0307286_1003848543300028876SoilVTSYPHDDAAERAGIEPSYLVRLVDLAIITPEEDDRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQRGALSDR
Ga0307278_1044579313300028878SoilVTWYSREDAAERAGVEPYYLVRLVDLAILAPEEPDRFSPGDVRRVLMSKS
Ga0307308_1016852633300028884SoilVTWYSREEAAERVGVEPSYLFRLVGLGILTPEEPDRFSPGDVRRVLMAKSLDDAGIPLDGVA
Ga0247826_1062670613300030336SoilVTSYARDDAAERAGVEPSYLVRLVELGILTLEEGDRFSGGDVRRVLMAKSLEDAGIPLEGVASAIEHGALSL
Ga0307497_1059902713300031226SoilVTSYPHDDAATRAGVEPPYLVRLVDLGIISPGEDDLYSPGDVRRVLMAKSLEDAGIPLE
Ga0310886_1087737813300031562SoilVTSYARDDAAERAGVEPPYLGRLVDLGILTPGGDDRFSPG
Ga0307374_1026141923300031670SoilMTWYPGDEAADRAGVEPAYLARLVDLGILGSEQPDHFSPGDVR
Ga0307468_10139706513300031740Hardwood Forest SoilVTWYSREDAAERAGVESPFLARLEDLGILAPHEPDRFSPADVRRVLLANSLEQAGAARP
Ga0307468_10158154813300031740Hardwood Forest SoilMTGFASKDVAGRTGVEPSYVVRLVELGILAPEEPDRFSSGDVRRVLMARS
Ga0214473_1221363813300031949SoilVNWYSREDAAERAGVEPSYLVRLVDLGILAPEEPDRFSPGDVRRVLMAKSLEDAGIPLEGVADAIGR
Ga0308173_1051750723300032074SoilVTWYSREEAAARAGIAPSQLDRFVDLGIVDCAEPGRFSPGDVRRALMARSLEEAEIPLDHVAAAL
Ga0335084_1117999913300033004SoilVTGYAAEDVAELAGVEPRYVVRLTELGILAAAEPGGFSPGDVRRTLMARSLEDA
Ga0214472_1096293113300033407SoilVTWYSRDEAAERVGVEPPYLARLVDLGILVPEEPDRFSPGDVRRVLLARS
Ga0316627_10035095213300033482SoilMSGYTRDEAAERAGVEPAYVVRLVDLGILAPEEPGRFSPG
Ga0247829_1024185913300033550SoilVTVYPHGDAAERAGVEPSYLVRLVDLGIISPQEDDRYS
Ga0247830_1062534133300033551SoilVISYPHDDAAERAGVEQSYLVRLVDLGILTPEEEGRFSPGDVRRVLMAKSLEDAGIPLEGVAAAIQR
Ga0326723_0110388_1059_11933300034090Peat SoilMTSYAREDAAERVGVDPSYLIRLMDLGILAPEEPDRLSGGDVRRA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.