| Basic Information | |
|---|---|
| Family ID | F058304 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VSLLDLDAAAGYVAALAVIGRCEAVRARDGSALLAEL |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.52 % |
| % of genes from short scaffolds (< 2000 bps) | 95.56 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.926 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.852 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF02754 | CCG | 46.67 |
| PF02190 | LON_substr_bdg | 41.48 |
| PF02589 | LUD_dom | 3.70 |
| PF05362 | Lon_C | 2.22 |
| PF01202 | SKI | 0.74 |
| PF01648 | ACPS | 0.74 |
| PF00296 | Bac_luciferase | 0.74 |
| PF02878 | PGM_PMM_I | 0.74 |
| PF13560 | HTH_31 | 0.74 |
| PF13313 | DUF4082 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 46.67 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 46.67 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 2.22 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 2.22 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 2.22 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 2.22 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.74 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.74 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.93 % |
| Unclassified | root | N/A | 14.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908006|FWIROz_GJ87FRN02F7S1P | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 547 | Open in IMG/M |
| 2166559006|FI_contig08022 | Not Available | 1131 | Open in IMG/M |
| 3300005093|Ga0062594_100386669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1122 | Open in IMG/M |
| 3300005332|Ga0066388_103811289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 769 | Open in IMG/M |
| 3300005337|Ga0070682_101237745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 631 | Open in IMG/M |
| 3300005468|Ga0070707_101062128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 775 | Open in IMG/M |
| 3300005542|Ga0070732_10730805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
| 3300005610|Ga0070763_10213057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1034 | Open in IMG/M |
| 3300005764|Ga0066903_106747343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300005921|Ga0070766_10436693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
| 3300006028|Ga0070717_10051282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3395 | Open in IMG/M |
| 3300006052|Ga0075029_100917953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300006176|Ga0070765_101000027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
| 3300006953|Ga0074063_10006999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 593 | Open in IMG/M |
| 3300007258|Ga0099793_10293948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 788 | Open in IMG/M |
| 3300009011|Ga0105251_10446567 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009012|Ga0066710_101704176 | Not Available | 959 | Open in IMG/M |
| 3300009088|Ga0099830_11429353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 576 | Open in IMG/M |
| 3300009143|Ga0099792_10735566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 641 | Open in IMG/M |
| 3300009520|Ga0116214_1161685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 836 | Open in IMG/M |
| 3300009522|Ga0116218_1494898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 545 | Open in IMG/M |
| 3300010335|Ga0134063_10717044 | Not Available | 518 | Open in IMG/M |
| 3300010337|Ga0134062_10361461 | Not Available | 702 | Open in IMG/M |
| 3300010339|Ga0074046_10774716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 561 | Open in IMG/M |
| 3300010341|Ga0074045_10839213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 580 | Open in IMG/M |
| 3300010373|Ga0134128_11160706 | Not Available | 852 | Open in IMG/M |
| 3300010373|Ga0134128_11682034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 698 | Open in IMG/M |
| 3300010396|Ga0134126_10563075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1307 | Open in IMG/M |
| 3300010866|Ga0126344_1138199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1638 | Open in IMG/M |
| 3300010867|Ga0126347_1517911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1352 | Open in IMG/M |
| 3300010876|Ga0126361_10684904 | Not Available | 1044 | Open in IMG/M |
| 3300012096|Ga0137389_11083191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 686 | Open in IMG/M |
| 3300012211|Ga0137377_10707299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 942 | Open in IMG/M |
| 3300012948|Ga0126375_10604868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 838 | Open in IMG/M |
| 3300012955|Ga0164298_10474997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 829 | Open in IMG/M |
| 3300016294|Ga0182041_10870071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 809 | Open in IMG/M |
| 3300016294|Ga0182041_11195864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 693 | Open in IMG/M |
| 3300016404|Ga0182037_10682473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300016404|Ga0182037_12043992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300016445|Ga0182038_10670687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 901 | Open in IMG/M |
| 3300016445|Ga0182038_11036595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 727 | Open in IMG/M |
| 3300017822|Ga0187802_10177059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
| 3300017926|Ga0187807_1093332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 944 | Open in IMG/M |
| 3300017943|Ga0187819_10202246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1172 | Open in IMG/M |
| 3300017946|Ga0187879_10204864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Sciscionella → unclassified Sciscionella → Sciscionella sp. SE31 | 1105 | Open in IMG/M |
| 3300017946|Ga0187879_10853521 | Not Available | 509 | Open in IMG/M |
| 3300017948|Ga0187847_10874610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 511 | Open in IMG/M |
| 3300017972|Ga0187781_11307916 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300017974|Ga0187777_10410788 | Not Available | 937 | Open in IMG/M |
| 3300017975|Ga0187782_11515178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300017993|Ga0187823_10141957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 752 | Open in IMG/M |
| 3300018006|Ga0187804_10396118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 611 | Open in IMG/M |
| 3300018060|Ga0187765_11320828 | Not Available | 511 | Open in IMG/M |
| 3300019888|Ga0193751_1275289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 500 | Open in IMG/M |
| 3300020002|Ga0193730_1067151 | Not Available | 1024 | Open in IMG/M |
| 3300021088|Ga0210404_10478067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 702 | Open in IMG/M |
| 3300021088|Ga0210404_10531476 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300021171|Ga0210405_10224781 | Not Available | 1487 | Open in IMG/M |
| 3300021377|Ga0213874_10104706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
| 3300021401|Ga0210393_10407992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1107 | Open in IMG/M |
| 3300021401|Ga0210393_11094417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300021403|Ga0210397_11482174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 527 | Open in IMG/M |
| 3300021407|Ga0210383_11672931 | Not Available | 522 | Open in IMG/M |
| 3300021477|Ga0210398_10244077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
| 3300021479|Ga0210410_10922916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300021861|Ga0213853_10537589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 587 | Open in IMG/M |
| 3300022733|Ga0224562_1022537 | Not Available | 522 | Open in IMG/M |
| 3300025910|Ga0207684_10142613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 2060 | Open in IMG/M |
| 3300025945|Ga0207679_11716621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 574 | Open in IMG/M |
| 3300025981|Ga0207640_10631394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 910 | Open in IMG/M |
| 3300026551|Ga0209648_10773259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 524 | Open in IMG/M |
| 3300027158|Ga0208725_1008342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Friedmanniella → environmental samples → uncultured Friedmanniella sp. | 1735 | Open in IMG/M |
| 3300027497|Ga0208199_1000775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12160 | Open in IMG/M |
| 3300027787|Ga0209074_10136300 | Not Available | 869 | Open in IMG/M |
| 3300027824|Ga0209040_10085851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1809 | Open in IMG/M |
| 3300027824|Ga0209040_10112713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
| 3300028742|Ga0302220_10121162 | Not Available | 1013 | Open in IMG/M |
| 3300028808|Ga0302228_10245708 | Not Available | 808 | Open in IMG/M |
| 3300028824|Ga0307310_10326099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 751 | Open in IMG/M |
| 3300029997|Ga0302302_1330161 | Not Available | 544 | Open in IMG/M |
| 3300030007|Ga0311338_10406663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1459 | Open in IMG/M |
| 3300030007|Ga0311338_11768157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300030399|Ga0311353_10820552 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300031198|Ga0307500_10252710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 545 | Open in IMG/M |
| 3300031226|Ga0307497_10041106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1571 | Open in IMG/M |
| 3300031233|Ga0302307_10268292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 875 | Open in IMG/M |
| 3300031236|Ga0302324_103455279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300031525|Ga0302326_12503449 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300031544|Ga0318534_10085616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1795 | Open in IMG/M |
| 3300031545|Ga0318541_10710571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300031547|Ga0310887_10806177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 590 | Open in IMG/M |
| 3300031564|Ga0318573_10261190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 924 | Open in IMG/M |
| 3300031640|Ga0318555_10384553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300031680|Ga0318574_10363094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → Massilia niastensis | 845 | Open in IMG/M |
| 3300031680|Ga0318574_10858475 | Not Available | 532 | Open in IMG/M |
| 3300031723|Ga0318493_10070032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1708 | Open in IMG/M |
| 3300031747|Ga0318502_10314869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
| 3300031748|Ga0318492_10051463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1924 | Open in IMG/M |
| 3300031748|Ga0318492_10151809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1169 | Open in IMG/M |
| 3300031764|Ga0318535_10502966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300031770|Ga0318521_10137335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1379 | Open in IMG/M |
| 3300031770|Ga0318521_10966551 | Not Available | 521 | Open in IMG/M |
| 3300031778|Ga0318498_10027265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2458 | Open in IMG/M |
| 3300031782|Ga0318552_10409284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 691 | Open in IMG/M |
| 3300031793|Ga0318548_10480851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 607 | Open in IMG/M |
| 3300031797|Ga0318550_10213312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 935 | Open in IMG/M |
| 3300031805|Ga0318497_10123731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300031805|Ga0318497_10724670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
| 3300031819|Ga0318568_10045729 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
| 3300031821|Ga0318567_10047405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2209 | Open in IMG/M |
| 3300031831|Ga0318564_10062610 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300031831|Ga0318564_10077832 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300031846|Ga0318512_10449849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 650 | Open in IMG/M |
| 3300031859|Ga0318527_10094200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1223 | Open in IMG/M |
| 3300031860|Ga0318495_10046816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1911 | Open in IMG/M |
| 3300031879|Ga0306919_10646466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300031896|Ga0318551_10076849 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300031897|Ga0318520_10297883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 971 | Open in IMG/M |
| 3300031938|Ga0308175_101242456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300031939|Ga0308174_10737638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 824 | Open in IMG/M |
| 3300031946|Ga0310910_11167933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300031947|Ga0310909_11099931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 646 | Open in IMG/M |
| 3300032059|Ga0318533_11342215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 522 | Open in IMG/M |
| 3300032065|Ga0318513_10680242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 504 | Open in IMG/M |
| 3300032066|Ga0318514_10160868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1167 | Open in IMG/M |
| 3300032068|Ga0318553_10056970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1935 | Open in IMG/M |
| 3300032090|Ga0318518_10284444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 849 | Open in IMG/M |
| 3300032160|Ga0311301_11602372 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300032515|Ga0348332_13955498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 512 | Open in IMG/M |
| 3300032783|Ga0335079_11869920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus rugosus | 582 | Open in IMG/M |
| 3300032828|Ga0335080_10521392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1259 | Open in IMG/M |
| 3300033134|Ga0335073_10932959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 909 | Open in IMG/M |
| 3300033134|Ga0335073_11017556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia flava | 855 | Open in IMG/M |
| 3300033290|Ga0318519_10141483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea dietziae | 1337 | Open in IMG/M |
| 3300034817|Ga0373948_0031616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 1070 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.33% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.22% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.48% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908006 | Soil microbial communities from sample at FACE Site Metagenome WIR_Oz2 | Environmental | Open in IMG/M |
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300029997 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIROz_00678150 | 2124908006 | Soil | HDLATDAGYVAALAVIGRCEAVRARDGSALLAELGGS |
| FI_00121900 | 2166559006 | Grass Soil | VSLLDLDAAAGYVAALAVIGRCEAVRARDGSALLAEL |
| Ga0062594_1003866693 | 3300005093 | Soil | SLLDLDAADGYVAALAVIGRCEAVRARDGSALLAEMSRGRVV* |
| Ga0066388_1038112892 | 3300005332 | Tropical Forest Soil | YPRSPRDVSLLDLDAAAGYVAALAVIGRCETVRARDGSALLAGLSPT* |
| Ga0070682_1012377451 | 3300005337 | Corn Rhizosphere | PRDVSLHDLATDAGYVAALAVIGRCEAVRARDGSALLAELGRS* |
| Ga0070707_1010621282 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RSPRDVSLLDLDAADGYVAALAVIGRCNAVRTRDGSALLAELGRG* |
| Ga0070732_107308051 | 3300005542 | Surface Soil | SLHDLDAGRGYVGALAVIGRCDEVLVKDGSALLAGVH* |
| Ga0070763_102130571 | 3300005610 | Soil | VSLLDLDPGPGYVAALAVLGRCHAAPARDGSALLASAPLA* |
| Ga0066903_1067473431 | 3300005764 | Tropical Forest Soil | PGEVTLLDLDAAPGYVAALAVLGRCAAVTPRDGSALLAELP* |
| Ga0070766_104366932 | 3300005921 | Soil | DLDPGPGYVAALAVIGHCHAAPARDGSALLEQAVPA* |
| Ga0070717_100512821 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDLDAADGYVAALAVIGRCETVRARNGSALLAELGLT* |
| Ga0075029_1009179531 | 3300006052 | Watersheds | VSLFDLDTAPGYVAALAVLGRCRAAVARDGSALLAGLETGVRS* |
| Ga0070765_1010000271 | 3300006176 | Soil | LDLDPGPGYVAALAVLGRCHAVPTGDGTALLGEASFA* |
| Ga0074063_100069991 | 3300006953 | Soil | YPRSPRDVSLHDLATDAGYVAALAVIGRCEAVRARDGSALLAERGGS* |
| Ga0099793_102939482 | 3300007258 | Vadose Zone Soil | VSLLDLDAADGYVAALAVIGRCDAVRARDGSALLAELSRT* |
| Ga0105251_104465671 | 3300009011 | Switchgrass Rhizosphere | GEVTLLDLDAAPGYVAALAVLGPCAAVTPRDGSALLAQLP* |
| Ga0066710_1017041761 | 3300009012 | Grasslands Soil | SPQDVSLLDLDAADGYVAALAVIGRCETVRARDGSALLAELGRC |
| Ga0099830_114293532 | 3300009088 | Vadose Zone Soil | LDVPDTGYVAALAVIGRCEAVRSRDGSALLAGPE* |
| Ga0099792_107355662 | 3300009143 | Vadose Zone Soil | PPQGVSLLDLDVPDTGYVAALAVIGRCEAVRSRDGSALLAGPE* |
| Ga0116214_11616852 | 3300009520 | Peatlands Soil | SVHSVSLLDLDAAPGYVAALAVIGRCEAVRARDGSALLADPA* |
| Ga0116218_14948982 | 3300009522 | Peatlands Soil | DLDAAPGYVAALAVIGRCEAVRARDGSALLADRA* |
| Ga0134063_107170441 | 3300010335 | Grasslands Soil | LLDLDAAAGYVAALAVLGPCTAVTRRDGSALLAGLA* |
| Ga0134062_103614612 | 3300010337 | Grasslands Soil | RSPREVSLLDLDAADGYVAALAVIGRCDAARARDGSALLAELGPS* |
| Ga0074046_107747161 | 3300010339 | Bog Forest Soil | RSVHSVSLLDLDADPGYVAALAVIGRCEAVRARDGSALLADRA* |
| Ga0074045_108392132 | 3300010341 | Bog Forest Soil | SVHSVSLLDLDADPGYVAALAVIGRCEAVRARDGSALLADRA* |
| Ga0134128_111607062 | 3300010373 | Terrestrial Soil | DVSLRDLDAAYGYVAALAVIGRCEAVRARDGSALLAEMSRGRVV* |
| Ga0134128_116820342 | 3300010373 | Terrestrial Soil | SPRDVSLHDLATDAGYVAALAVIGRCEAVRARDGSALLAELGRS* |
| Ga0134126_105630753 | 3300010396 | Terrestrial Soil | SLLDLDVDAGYVAALAVIGRCEAVRARDGSALLAELSHGRVV* |
| Ga0126344_11381991 | 3300010866 | Boreal Forest Soil | QDPRSVSLVDLDPGPGYVAALAVLGRCDAVPAGDGSALLGEASFA* |
| Ga0126347_15179112 | 3300010867 | Boreal Forest Soil | FDLDAGSAYVAALAVIGCCDMVRARDGSALLAGPGAGAAS* |
| Ga0126361_106849041 | 3300010876 | Boreal Forest Soil | VSLLDLDAAPGYVAALAVIGPCRAVHDRDGSVLLAAVPSR* |
| Ga0137389_110831911 | 3300012096 | Vadose Zone Soil | GPRLPQGVSLLDLDVPDSGYVAALAVIGRCEAVRSRDGSALLAGPD* |
| Ga0137377_107072992 | 3300012211 | Vadose Zone Soil | PRDVSLLDLDAADGYVAALAVIGRCETVRARDGSALLAELGLT* |
| Ga0126375_106048682 | 3300012948 | Tropical Forest Soil | VSLLDLDAASGYVAALAVIGRCETVRARDGSALLGSVAGGGG* |
| Ga0164298_104749971 | 3300012955 | Soil | PYPRSPRDVSLHDLATDAGYVAALAVIGRCEAIRARDGSALLAGLGGS* |
| Ga0182041_108700711 | 3300016294 | Soil | PYPRSPREVSLLDLDAADGYVAALAVIGRCEAARARDGSALLAELGPS |
| Ga0182041_111958641 | 3300016294 | Soil | SVSLHDLDTEPGYVAALAVLGRCHTVRARDGSTLLAGLEAGALS |
| Ga0182037_106824732 | 3300016404 | Soil | DPRGVSLFDLDTAPGYVAALAVLGRCDAVRPGDGSALLAGLEAGALG |
| Ga0182037_120439922 | 3300016404 | Soil | EPGYVAALAVLGRCDTVQARDGSALLAGLEAGAPR |
| Ga0182038_106706872 | 3300016445 | Soil | VSLRDLDAAAGYVAALAVIGRCEAARARDGSALLAELGPS |
| Ga0182038_110365952 | 3300016445 | Soil | EPGYVAALAVLGRCHTVRARDGSTLLAGLEAGALS |
| Ga0187802_101770592 | 3300017822 | Freshwater Sediment | HDLDAEPGYVAALAVIGRCDTVRARDGSALLAAGAEALS |
| Ga0187807_10933321 | 3300017926 | Freshwater Sediment | PQDPRSVSLRDLDTEPGYVAALAVLGRCDTVRARDGSALLAGLEAGALS |
| Ga0187819_102022461 | 3300017943 | Freshwater Sediment | LDTEPGYVAALAVLGRCDTVRAGDGSALLAGLAAGALS |
| Ga0187879_102048642 | 3300017946 | Peatland | DLEAAAGYLAALAVLGRCDTVRARDGSALLAAPATP |
| Ga0187879_108535212 | 3300017946 | Peatland | HSVSLLDLDADPGYVAALAVIGRCEAVRARDGSALLAGRT |
| Ga0187847_108746101 | 3300017948 | Peatland | PRGVTLLDLDAAPGYLAALAVLGPCEAVTARDGSTLLAGLV |
| Ga0187781_113079161 | 3300017972 | Tropical Peatland | APESVCLLDLDAGPGYVAALAVLGRCEAVRTADGSALLAARACGDA |
| Ga0187777_104107881 | 3300017974 | Tropical Peatland | PDTVSLVDLDTEAGYVAALAVIGRCDTVRARDGSALLAAGA |
| Ga0187782_115151782 | 3300017975 | Tropical Peatland | LLDLDTEPGYVAALAVLGRCDKARVHDGSALLAWAP |
| Ga0187823_101419571 | 3300017993 | Freshwater Sediment | QDPRSVSLLDLDTAPGYVAALAVLGRCDMVRARDGSALLA |
| Ga0187804_103961181 | 3300018006 | Freshwater Sediment | VSLHDLDTEPGYVAALAVLGRCDTVRARDGSALLA |
| Ga0187765_113208282 | 3300018060 | Tropical Peatland | HDLDSEPGYVAALAVLGRCGTVRAGDGSALLAGLAAGALS |
| Ga0193751_12752892 | 3300019888 | Soil | YPRSPREVSLLDLDVDAGYVAALAVIGRCEAVRARDGSALLADVT |
| Ga0193730_10671513 | 3300020002 | Soil | VSLLDLDVDAGYVAALAVIGRCEAVRARDGSALLAELGRS |
| Ga0210404_104780671 | 3300021088 | Soil | SPRDVALLDLDAADGYVAALAVIGRCEAVRARDGSALLAELSRT |
| Ga0210404_105314762 | 3300021088 | Soil | VTLLDLDAAPGYLAALAVMGPCRQVRERDGSALLAE |
| Ga0210405_102247813 | 3300021171 | Soil | SPWEVSLLDLDAADGYVAALAVIGRCEAVRARDGSALLAELSRT |
| Ga0213874_101047062 | 3300021377 | Plant Roots | YPRDPGRVTLLDLDADAGYVAALAVIGRCEAVRAMDGSALLAGRPAS |
| Ga0210393_104079922 | 3300021401 | Soil | RDPGPGYVAALAVIGRCHAALARDGSALLAQAVLA |
| Ga0210393_110944172 | 3300021401 | Soil | QDPRSVSLLDLDPGPGYVAALAVIGRCHVAPSRDGSTLLAEALLA |
| Ga0210397_114821741 | 3300021403 | Soil | WPYPQPPDSVSLLDLDAAPGYVAALAVIGPCRAVRERDGSALLAE |
| Ga0210383_116729312 | 3300021407 | Soil | VSLLDLDAGPGYVAALAVLGRCHTARARDGSALLNGPAVEPAG |
| Ga0210398_102440771 | 3300021477 | Soil | SLLDLDPAPGYVAALAVIGPCRAVRERDGSALLAE |
| Ga0210410_109229161 | 3300021479 | Soil | PQDPRSVSLLDLDPGPGYVAALAVIGRCHVAPARDGSTLLTEAVLA |
| Ga0213853_105375892 | 3300021861 | Watersheds | PRSVSLLDLEVATGYVAALAVIGRCDAVRARDGSALLADRA |
| Ga0224562_10225371 | 3300022733 | Soil | YHRSPRDVSLFDLDLDAGYVAALAVLGRCEEVLVKDGSALLTGVR |
| Ga0207684_101426131 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DPGPGYVAALAVIGRCDVAPARDGSALLAEAPLAEAPLA |
| Ga0207679_117166212 | 3300025945 | Corn Rhizosphere | PYPRDPGEVTLLDLDAAPGYVAALAVLGRCAAVTPRDGSALLAELP |
| Ga0207640_106313942 | 3300025981 | Corn Rhizosphere | WPYPRSPRDVSLLDLDAPDGYVAALAVIGRCEAVRARDGSALLAELS |
| Ga0209648_107732592 | 3300026551 | Grasslands Soil | PQGVSLLDLDVPDTGYVAALAVIGRCEAARCRDGSALLAALG |
| Ga0208725_10083422 | 3300027158 | Forest Soil | PAMTRLGLVDLDAPPGYVAALAVLGPCDTVRAGDGSALLTGLEAGALS |
| Ga0208199_10007751 | 3300027497 | Peatlands Soil | SLLDLDAAPGYVAALAVIGRCEAVRARDGSALLADRA |
| Ga0209074_101363001 | 3300027787 | Agricultural Soil | TLLDLGTLPGYVAALAVLGRCAAVKPRDGSALLAELP |
| Ga0209040_100858511 | 3300027824 | Bog Forest Soil | SVSLLDLDADPGYVAALAVIGRCEAVRARDGSALLAEAP |
| Ga0209040_101127133 | 3300027824 | Bog Forest Soil | SVSLLDLDADPGYVAALAVIGRCEAVRARDGSALLADRA |
| Ga0302220_101211621 | 3300028742 | Palsa | SLMDLEAAAGYVAALAVLGRCDTVRARDGSALLAAPA |
| Ga0302228_102457081 | 3300028808 | Palsa | LMDLEVAAGYVAALAVLGRCDTVRAHDGSALLAAPA |
| Ga0307310_103260991 | 3300028824 | Soil | LLDLDVDAGYVAALAVIGRCEAVRARDGSALLAELGRS |
| Ga0302302_13301611 | 3300029997 | Palsa | PESVSLLDLETAPGYVAALAVLGRCDTVRARDGSALLAAPAAA |
| Ga0311338_104066631 | 3300030007 | Palsa | PQQVALLDLDAAPGYVAALPVLGRCDTARSRDDLRCSATR |
| Ga0311338_117681572 | 3300030007 | Palsa | SVSLLDLDPAAGYVAALAVIGRCDTARPRDGSALLAGLGAAAAG |
| Ga0311353_108205521 | 3300030399 | Palsa | ETVSLRDLETETGYVAAMAVIGRCDAVQAGDGSALLAAQT |
| Ga0307500_102527101 | 3300031198 | Soil | SPRDVSLLDLDAAPGYVAALAVIGRCEAVRARDGSALLAELSHGRVV |
| Ga0307497_100411061 | 3300031226 | Soil | DAAAGYVAALAVIGRCEAVRARDGSALLAELNRGRVV |
| Ga0302307_102682922 | 3300031233 | Palsa | QGVSLVDLEAAAGYVAALAVLGRCDAVRARDGSALLAARG |
| Ga0302324_1034552791 | 3300031236 | Palsa | DLEAAAGYVAALAVLGRCDTVRARDGSALLAAAGRAGQLPFP |
| Ga0302326_125034493 | 3300031525 | Palsa | YPQPPDSVSLMDLEAAAGYVAALAVLGRCDTVRARDGSALLAAPA |
| Ga0318534_100856161 | 3300031544 | Soil | GVSVHDLETEAGYVAALAVIGRCEDVRTRDGSALLAGL |
| Ga0318541_107105712 | 3300031545 | Soil | VSLHDLNTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0310887_108061772 | 3300031547 | Soil | VSLRDLATDAGYVAALAVIGRCEAVRARDGSALLAELGRS |
| Ga0318573_102611901 | 3300031564 | Soil | VSLLDLDADTGYVAALAVIGRCDAVRARDGSALLAEQA |
| Ga0318555_103845531 | 3300031640 | Soil | LRDLDTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318574_103630941 | 3300031680 | Soil | DVSLLDLDPPAGYVAALAVIGRCEAARARDGSALLAGLA |
| Ga0318574_108584751 | 3300031680 | Soil | PQPPQGVSVHDLETEAGYVAALAVIGRCEDVRTRDGSALLAGL |
| Ga0318493_100700321 | 3300031723 | Soil | WPYPQTPESVSVHDLDTEAGYVAALAVIGRCELVRARDGSALLTGL |
| Ga0318502_103148691 | 3300031747 | Soil | SPRDVSLLDLDAAAGYVAALAVIGRCETVRAMDGSALLGSVTGGGG |
| Ga0318492_100514632 | 3300031748 | Soil | LHDLETEAGYVAALAVIGRCEDVRTRDGSALLAGL |
| Ga0318492_101518091 | 3300031748 | Soil | VSLHDLDTEPGYVAAIAVLGRCDTVRAGDGSALLTGLEAGAPS |
| Ga0318535_105029661 | 3300031764 | Soil | LDTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318521_101373352 | 3300031770 | Soil | LHDLDTEAGYVAALAVIGRCELVRARDGSALLTGL |
| Ga0318521_109665512 | 3300031770 | Soil | SLHDLDTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318498_100272651 | 3300031778 | Soil | SVHDLETEAGYVAALAVIGRCEDVRTRDGSALLAGL |
| Ga0318552_104092841 | 3300031782 | Soil | LLDLDAADGYVAALAVIGRCEAARARDGSALLAELGPS |
| Ga0318548_104808512 | 3300031793 | Soil | SLLDLDAADGYVAALAVIGRCEAARARDGSALLAELGPS |
| Ga0318550_102133122 | 3300031797 | Soil | PRSPRDVSLLDLDAAAGYVAALAVIGRCETVRAMDGSALLGSVTGGGG |
| Ga0318497_101237313 | 3300031805 | Soil | PYPRPPGDVCLRDLDAAAGYVAALAVIGRCESVRARDGSALLAGLT |
| Ga0318497_107246701 | 3300031805 | Soil | EPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318568_100457292 | 3300031819 | Soil | YPQTPESVSVHDLDTEAGYVAALAVIGRCESVRARDGSALLTGL |
| Ga0318567_100474051 | 3300031821 | Soil | TPESVSVHDLDTEAGYVAALAVIGRCESVRARDGSALLTGL |
| Ga0318564_100626102 | 3300031831 | Soil | PYPQPPQGVSLHDLETEAGYVAALAVIGRCEDVRTRDGSALLAGL |
| Ga0318564_100778322 | 3300031831 | Soil | SLHDLDTEPGYVAALAVLGRCDTVQARDGSALLAGLEAGAPR |
| Ga0318512_104498492 | 3300031846 | Soil | VSLLDLDAAAGYVAALAVIGRCETVRARDGSALLAALSPT |
| Ga0318527_100942001 | 3300031859 | Soil | LHDLDTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318495_100468161 | 3300031860 | Soil | PESVSLHDLDTEAGYVAALAVIGRCELVRARDGSALLTGL |
| Ga0306919_106464662 | 3300031879 | Soil | PRDVSLLDLDAAAGYVAALAVIGRCETVRARDGSALLGSVAGGGG |
| Ga0318551_100768492 | 3300031896 | Soil | SLHDLDPGPGYVAALAVLGRCDTVRTRDGSALLAGLAADVLS |
| Ga0318520_102978831 | 3300031897 | Soil | RSVSLHDLDTEPGYVAALAVLGRCHTVRARDGSTLLAGLEADALS |
| Ga0308175_1012424562 | 3300031938 | Soil | DLDAATGYVAALAVIGRCEAVRARDGSALLAELDRGRVV |
| Ga0308174_107376382 | 3300031939 | Soil | DLATDPGYVAALAVIGRCEAVRARDGSALLAELSRGRVV |
| Ga0310910_111679331 | 3300031946 | Soil | DTEPGYVAALAVLGRCDTVQARDGSALLAGLEAGAPR |
| Ga0310909_110999311 | 3300031947 | Soil | PRPPQGVSLLDLDADTGYVAALVVIGRCDAVRARDGSALLAEHA |
| Ga0318533_113422152 | 3300032059 | Soil | VSLLDLDAADGYVAALAVIGRCEAARARDGSALLAELGPS |
| Ga0318513_106802421 | 3300032065 | Soil | YPRPPQSVSLLDLDADTGYVAALAVIGRCDAVRARDGSALLAEHA |
| Ga0318514_101608682 | 3300032066 | Soil | PGSVSLHDLDTEPGYVAALAVLGRCDTIRTRDGSALLAGLEAGALS |
| Ga0318553_100569701 | 3300032068 | Soil | TPESVSVHDLDTEAGYVAALAVIGRCELVRARDGSALLTGL |
| Ga0318518_102844442 | 3300032090 | Soil | PQTPKSVSLHDLDTEAGYVAALAVIGRCESVRARDGSALLTGL |
| Ga0311301_116023721 | 3300032160 | Peatlands Soil | SLLDLDTDPGYVAALAVIGRCEAVRARDGSALLADQA |
| Ga0348332_139554981 | 3300032515 | Plant Litter | AGPGYVAALAVLGRCEAVESADGSALLAARACGGA |
| Ga0335079_118699202 | 3300032783 | Soil | LDLDVADGYVAALAVIGRCGAVRARDGSALLADPDPA |
| Ga0335080_105213921 | 3300032828 | Soil | PRSPRDVALLDLDAAAGYVAALAVLGRCAAVTPRDGSALLAELA |
| Ga0335073_109329592 | 3300033134 | Soil | YPRSPRDVSLRDLATDAGYVAALAVIGRCEAVRARDGSALLAELGRS |
| Ga0335073_110175562 | 3300033134 | Soil | SLRDLATDPGYVAALAVIGRCEAVRARDGSALLAELSRGRVV |
| Ga0318519_101414831 | 3300033290 | Soil | PRSVSLHDLDTEPGYVAALAVLGRCDTVQARDGSALLAGLEAGAPR |
| Ga0373948_0031616_919_1041 | 3300034817 | Rhizosphere Soil | VSLHDLATDAGYVAALAVIGRCEAVRARDGSALLAELGRS |
| ⦗Top⦘ |