NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058292

Metagenome Family F058292

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058292
Family Type Metagenome
Number of Sequences 135
Average Sequence Length 168 residues
Representative Sequence MRAFTLGGGGLQSDPALEPSEAGGHTLFQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGTPRSAPVLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLL
Number of Associated Samples 120
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.11 %
% of genes near scaffold ends (potentially truncated) 97.04 %
% of genes from short scaffolds (< 2000 bps) 96.30 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.185 % of family members)
Environment Ontology (ENVO) Unclassified
(36.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.630 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.41%    β-sheet: 1.09%    Coil/Unstructured: 37.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF027373HCDH_N 3.70
PF13335Mg_chelatase_C 2.22
PF13561adh_short_C2 1.48
PF09966DUF2200 1.48
PF00036EF-hand_1 0.74
PF00150Cellulase 0.74
PF030614HBT 0.74
PF12282PdtaS_GAF 0.74
PF04885Stig1 0.74
PF03466LysR_substrate 0.74
PF00069Pkinase 0.74
PF07626PSD3 0.74
PF00216Bac_DNA_binding 0.74
PF00892EamA 0.74
PF06267DUF1028 0.74
PF13231PMT_2 0.74
PF00005ABC_tran 0.74
PF02502LacAB_rpiB 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.70
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 3.70
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 3.70
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 3.70
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 3.70
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 3.70
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 3.70
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.96
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.74
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.74
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.74
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.74
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105329518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium571Open in IMG/M
3300000789|JGI1027J11758_11327953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium573Open in IMG/M
3300000956|JGI10216J12902_104934857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1838Open in IMG/M
3300000956|JGI10216J12902_110937872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium777Open in IMG/M
3300005333|Ga0070677_10364616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium752Open in IMG/M
3300005334|Ga0068869_101792183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium549Open in IMG/M
3300005337|Ga0070682_102074698All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300005340|Ga0070689_100509382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1032Open in IMG/M
3300005340|Ga0070689_101463146All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium618Open in IMG/M
3300005347|Ga0070668_101010172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium748Open in IMG/M
3300005365|Ga0070688_100524807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium897Open in IMG/M
3300005455|Ga0070663_101139039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium683Open in IMG/M
3300005456|Ga0070678_101524916All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium626Open in IMG/M
3300005471|Ga0070698_101309002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium675Open in IMG/M
3300005544|Ga0070686_101500677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium568Open in IMG/M
3300005548|Ga0070665_101479474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium688Open in IMG/M
3300005578|Ga0068854_102038077All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium529Open in IMG/M
3300005614|Ga0068856_100889953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium909Open in IMG/M
3300005618|Ga0068864_102494837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium523Open in IMG/M
3300005719|Ga0068861_100758228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium907Open in IMG/M
3300005719|Ga0068861_100921220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium829Open in IMG/M
3300005836|Ga0074470_10498036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium783Open in IMG/M
3300005840|Ga0068870_10376040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium918Open in IMG/M
3300005842|Ga0068858_100999410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium820Open in IMG/M
3300005843|Ga0068860_101691374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium655Open in IMG/M
3300005937|Ga0081455_10755813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium614Open in IMG/M
3300006042|Ga0075368_10563161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium513Open in IMG/M
3300006177|Ga0075362_10446062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium657Open in IMG/M
3300006195|Ga0075366_10179194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1287Open in IMG/M
3300006358|Ga0068871_100527326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1067Open in IMG/M
3300006844|Ga0075428_102757924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium500Open in IMG/M
3300006876|Ga0079217_10780446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium659Open in IMG/M
3300006876|Ga0079217_11414325All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Cellulophaga → unclassified Cellulophaga → Cellulophaga sp. Hel_I_12544Open in IMG/M
3300006880|Ga0075429_101717155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum545Open in IMG/M
3300006894|Ga0079215_11024199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium610Open in IMG/M
3300006918|Ga0079216_10586423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria763Open in IMG/M
3300007004|Ga0079218_10599645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1005Open in IMG/M
3300007004|Ga0079218_10827259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium895Open in IMG/M
3300009094|Ga0111539_12715727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium574Open in IMG/M
3300009100|Ga0075418_11847366All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium657Open in IMG/M
3300009156|Ga0111538_13453376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium549Open in IMG/M
3300009156|Ga0111538_14128884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300009176|Ga0105242_12617111All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium554Open in IMG/M
3300009448|Ga0114940_10213943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium847Open in IMG/M
3300009545|Ga0105237_10751691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium981Open in IMG/M
3300010038|Ga0126315_10511961All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium766Open in IMG/M
3300010042|Ga0126314_11399332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium525Open in IMG/M
3300010166|Ga0126306_11480303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium563Open in IMG/M
3300010371|Ga0134125_12516197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium560Open in IMG/M
3300010399|Ga0134127_11841042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium682Open in IMG/M
3300010400|Ga0134122_11960460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium623Open in IMG/M
3300010401|Ga0134121_10688133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium968Open in IMG/M
3300010403|Ga0134123_12017879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium635Open in IMG/M
3300011433|Ga0137443_1149514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium691Open in IMG/M
3300011440|Ga0137433_1269931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium554Open in IMG/M
3300012046|Ga0136634_10034964All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300012204|Ga0137374_11166605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium542Open in IMG/M
3300012895|Ga0157309_10319622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium530Open in IMG/M
3300012896|Ga0157303_10245319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium543Open in IMG/M
3300012898|Ga0157293_10200046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium601Open in IMG/M
3300012899|Ga0157299_10091090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium771Open in IMG/M
3300012901|Ga0157288_10258641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium588Open in IMG/M
3300012904|Ga0157282_10042906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1069Open in IMG/M
3300012906|Ga0157295_10191046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium646Open in IMG/M
3300012914|Ga0157297_10220161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium669Open in IMG/M
3300012916|Ga0157310_10323871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium613Open in IMG/M
3300012961|Ga0164302_10831520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium701Open in IMG/M
3300012987|Ga0164307_10569059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium868Open in IMG/M
3300013297|Ga0157378_11844312All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium653Open in IMG/M
3300013308|Ga0157375_12591407All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium606Open in IMG/M
3300014326|Ga0157380_11773880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium676Open in IMG/M
3300014969|Ga0157376_12311145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium577Open in IMG/M
3300015200|Ga0173480_10481739All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium739Open in IMG/M
3300015200|Ga0173480_10895507All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium575Open in IMG/M
3300015201|Ga0173478_10414169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium650Open in IMG/M
3300015248|Ga0180079_1066535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium550Open in IMG/M
3300017965|Ga0190266_10192298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium966Open in IMG/M
3300017965|Ga0190266_10671182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium641Open in IMG/M
3300018422|Ga0190265_12385746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium629Open in IMG/M
3300018429|Ga0190272_12083862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium604Open in IMG/M
3300018432|Ga0190275_10334038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1500Open in IMG/M
3300018432|Ga0190275_10685965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1080Open in IMG/M
3300018465|Ga0190269_10006402All Organisms → cellular organisms → Bacteria → Proteobacteria5334Open in IMG/M
3300018469|Ga0190270_11406041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium744Open in IMG/M
3300018476|Ga0190274_10446093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1273Open in IMG/M
3300018476|Ga0190274_10733151All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1037Open in IMG/M
3300018481|Ga0190271_10734861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1110Open in IMG/M
3300018481|Ga0190271_11851398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium715Open in IMG/M
3300019356|Ga0173481_10479641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium628Open in IMG/M
3300019361|Ga0173482_10006766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium2760Open in IMG/M
3300019361|Ga0173482_10637059All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium541Open in IMG/M
3300019362|Ga0173479_10540262All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium597Open in IMG/M
3300019377|Ga0190264_10002269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales4463Open in IMG/M
3300022549|Ga0212091_10437336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium544Open in IMG/M
3300022893|Ga0247787_1021320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium868Open in IMG/M
3300022894|Ga0247778_1226745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium527Open in IMG/M
3300022904|Ga0247769_1153845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium576Open in IMG/M
3300022906|Ga0247766_1173758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium563Open in IMG/M
3300022917|Ga0247777_1077414All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1140Open in IMG/M
3300022917|Ga0247777_1214194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium622Open in IMG/M
3300022917|Ga0247777_1253900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium563Open in IMG/M
3300023062|Ga0247791_1079430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium541Open in IMG/M
3300023073|Ga0247744_1054704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium657Open in IMG/M
3300023102|Ga0247754_1024309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1338Open in IMG/M
3300023268|Ga0247765_1093631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium633Open in IMG/M
3300023269|Ga0247773_1107715All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium876Open in IMG/M
3300023275|Ga0247776_10405166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium501Open in IMG/M
3300024055|Ga0247794_10106158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium840Open in IMG/M
3300025908|Ga0207643_11058054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium524Open in IMG/M
3300025932|Ga0207690_11525791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium559Open in IMG/M
3300025934|Ga0207686_11420240All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium571Open in IMG/M
3300025942|Ga0207689_11711615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium521Open in IMG/M
3300025961|Ga0207712_10462604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1078Open in IMG/M
3300025981|Ga0207640_11836243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium548Open in IMG/M
3300025986|Ga0207658_12140571All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium508Open in IMG/M
3300026075|Ga0207708_10995447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium728Open in IMG/M
3300026078|Ga0207702_10639228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1046Open in IMG/M
3300026088|Ga0207641_10636784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1046Open in IMG/M
3300026116|Ga0207674_10173020All Organisms → cellular organisms → Bacteria2112Open in IMG/M
3300026118|Ga0207675_100584844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1118Open in IMG/M
3300026118|Ga0207675_101741264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium643Open in IMG/M
3300026121|Ga0207683_10033690All Organisms → cellular organisms → Bacteria4450Open in IMG/M
3300027886|Ga0209486_10652488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium673Open in IMG/M
3300027993|Ga0247749_1013364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium825Open in IMG/M
3300028379|Ga0268266_10799899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium911Open in IMG/M
3300028380|Ga0268265_11594155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium658Open in IMG/M
3300028714|Ga0307309_10194573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium532Open in IMG/M
3300031455|Ga0307505_10485201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium594Open in IMG/M
3300031740|Ga0307468_102021263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium553Open in IMG/M
3300031858|Ga0310892_11192884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium542Open in IMG/M
3300032005|Ga0307411_10848704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium808Open in IMG/M
3300032013|Ga0310906_11467297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium502Open in IMG/M
3300032126|Ga0307415_101034815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium765Open in IMG/M
3300032157|Ga0315912_11362048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium560Open in IMG/M
3300032205|Ga0307472_101211738All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium722Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.19%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter6.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.44%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.70%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.70%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.22%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.22%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.48%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.74%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.74%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009448Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek SourceEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300022549Cold Creek_combined assemblyEnvironmentalOpen in IMG/M
3300022893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022904Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023268Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6EnvironmentalOpen in IMG/M
3300023269Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L092-311B-6EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10532951813300000364SoilGGHTLLQRRLALYGKVLILQSILYWLIYAAIWGPTVGFRKSISCIASWDIVLLTAIYSMFWIVARGRARSTSVLLATDILGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVRRTLVCGLLMCGPTILGVVFGPHRFDDQTLSWITMVGFSVNWSVLAVIFSCVAAAVLYGLRREV
JGI1027J11758_1132795313300000789SoilGGHTLLQRRLALYGKVLILQSILYWLIYAAIWGPTVGFRKSISCIASWDIVLLTAIYSMFWIVARGRARSTSVLLATDILGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVRRTLVCGLLMCGPTILGVVFGPHRFDDQTLSWITMVGFSVNWSVLAVIFSCVAXAVLYGLRREVR
JGI10216J12902_10493485733300000956SoilMRPSFAPGNSAGQESDPALEPSADGHTLLQHRLALFGKVLVAQSILYWLIYAIVWAPSVGFTRSLRHLASWDVVLLTVIYALYWIVAGGRPRSVPVLLAMDVGGSLLIGIDNVFLMLGDLGTISGVFENLIGFI
JGI10216J12902_11093787223300000956SoilMRRTFLAQGREGGTDGDPALEPSEVGGHTLLQRRLALYGKVLVVQSIVYWLIYAAIWGPSVGFARSLGHLASWDVVLLTAIYALYWIVARGRPRSASVLLATDVVGSLLIGIDNVFLMLGDLGTI
Ga0070677_1036461613300005333Miscanthus RhizosphereMRATFAPGGGGGLHSDPALEPSEVSGHTLLQRRLSLYGKALVVQSILYWLIYALIWGPTVGFTESLGHIASWDVVLLTAIYSLYWVVARGRPRSTPVLLATDVVGSLAIGIDNVSLMLGDLGTI
Ga0068869_10179218313300005334Miscanthus RhizosphereMRATFALGGDRGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTRSLGHLVSWDVILLTGIYSLYWVVARGRPRSATLLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLM
Ga0070682_10207469813300005337Corn RhizosphereSGLSTESQDSGLLSSMRAKFALGGEAGLESDPALEPSEGGGHTLLQRRLSLYGKALVAQSIVYWVIYALIWGPTVGFARSLKYIASWDVVLLTGIYSLFWLVGRGRPRSTTILLGTDVLGSLAIGVDYLFLMLSDLGTISGVFENLIGFICVLLFRALIVPSTVKR
Ga0070689_10050938213300005340Switchgrass RhizosphereMSAALFDLGRNGGTQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWVVARGQPRSAPVLLATDVGGGLAIGIDNVFLMLGDLGTLSGIFENLIGFICILLLRALIVPSTVKRTLLCGVLMCGP
Ga0070689_10146314613300005340Switchgrass RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFICIL
Ga0070668_10101017213300005347Switchgrass RhizosphereMERVLPVVLDSGLLSSMRATFAPGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWIAARGQPRSTPFLLATDVGGSLAIGIDNVFLMLGDL
Ga0070688_10052480713300005365Switchgrass RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGID
Ga0070663_10113903913300005455Corn RhizosphereMRTTFAPGSTGGLESDPALEPSEVGGQTLLQRRLALYGKVLVVQSILYWLIYALIWAPTVGFRESLGHLASWDVGLLTAIYSLYWVVARGRPRSAPVLLATDIAGSLAIGIDNVWLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLC
Ga0070678_10152491613300005456Miscanthus RhizosphereMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWGPTVGFRQSLGHIVSWDVVLLTAIYSLYWFVARGSARSAPVLLATDVAGSLAIGVDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVGLGPHRFDDQALSWITMVGFS
Ga0070698_10130900213300005471Corn, Switchgrass And Miscanthus RhizosphereMRATFLAQGRDGGAASDPALEPSEVGGHTLLQRRLALYGKVLVAQSIVYWLIYAVIWGPTVGFARSLGHLASWDVVLLTAIYSSFWIVARGRPRSPSILLATDVLGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLL
Ga0070686_10150067713300005544Switchgrass RhizosphereMRAAFAPGGGEGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYALIWGPTVGFEQSLEYIASWDVVLLTAIYSLFWVVARGRPRSATFLFATDIAGSLAIGIDNVFLMLGDLGTISGVFE
Ga0070665_10147947413300005548Switchgrass RhizosphereGRVDSGLLSSMRATFALGGGGGLQSDPALEPSQEGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFRESLGHIVSWDVVLLTAIYSLYWVVARGGVRSAPVLLATDVVGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDHQSLSWITMIGFTVNWSVIALIFSGVASATLYGLRREVRDARRL
Ga0068854_10203807713300005578Corn RhizosphereFLVAQSILYWLIYAMVWGPTVGFARSLGHILSWEVILLNVIYSVFWIVARGRPRSTSFLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLWRALIIPSTVKRTLLCGLLMCGPTVLGVAWGTHRFDRQTVSWITMVGFSINWSAFALIFSCVASAVLYGLRRDVRD
Ga0068856_10088995313300005614Corn RhizosphereMLMRATFALGGAEGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSILYWLIYAMVWGPTVGFARSLGHIVSWEVVLLNVIYSAFWIVARGRPRSTSFLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLWRALIVPSTVKRTLLCGLLMCGPTVLGVAWGSHRFDRQTVSWITM
Ga0068864_10249483713300005618Switchgrass RhizosphereMLTTFAPGSTGGRESDPALEPTEVGGHTLLQRRLALYGKVLVVQSIIYWLIYALIWGPTVGFRQSLGYIASWDVVLLTAIYSLFWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRT
Ga0068861_10075822823300005719Switchgrass RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVVLGRHRFDDQSLSWITMVGFSVNWSTIALIFSCVASAVLY
Ga0068861_10092122013300005719Switchgrass RhizosphereMRATFAPGGTGGLESDPALEPSDVGGHTLLQRRLSLYGKVLVAQSIVYWLIYAIIWGPSVGFARSLGHIVSWDVVLLTGIYSLYWIVARGRPRSATVLLATDIVGSLAIGIDNVYLMLGDLGTISGIFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVAF
Ga0074470_1049803623300005836Sediment (Intertidal)MRATFAPRGDGGLESDPALEPSEVGGHTLLQRRLAPYGQVLVVQSILYLLIYAAIWGPTVRFARSLGHIASWDVVLLTAIYSLYWIIAAGRPRPAPVLLATDVGGSLLIGID
Ga0068870_1037604023300005840Miscanthus RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIV
Ga0068858_10099941013300005842Switchgrass RhizosphereMRATFALGGAEGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSILYWLIYAMVWGPTVGFARSLGHIVSWEVVLLNVIYSAFWIVARGRPRSTSFLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLWRALIIPSTVKRTLLCGLLMCGPTVLGVAWGTHRFDR
Ga0068860_10169137423300005843Switchgrass RhizosphereMRATFALGGGKGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSILYWLIYAMVWGPTVGFARSLGHIVSWEVVLLNVIYSAFWIVARGRPRSTSFLLATDVAGSLAIGIDNVFLMLG
Ga0081455_1075581313300005937Tabebuia Heterophylla RhizosphereRFPLSSMRATFAPGAAGGQKSDPALEPSEAGGHTLLQRRLALYGKALVAQSILYWLIYALIWGPTVGFAHSPRYIASWDVLALTGIYALYWIVARGRPRATPVLLATDVAGSLAIGIDNVFLMLTDLGTISGVFENLIGFICILLFRALIVPSTVKRTLLCGLLMCGPTVVAVAFGPHRFDDQSLSWITMLGFGVNWSLIALIF
Ga0075368_1056316113300006042Populus EndosphereATTLEASGAPAHWVWTAPLYSGLFSSMRATFAPGGSGGLESDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTAGFARSLGHIVSWDVALLTAIYSLYWIVARGKPRSTPVLLATDVIGSLAIGIDNVSLMLGDLGTISGVFENLIGFICILLLRSLI
Ga0075362_1044606223300006177Populus EndosphereMSAALLDQGRDWSTQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFRRSLGHIVSWDVVLLTAIYSLYWIVARGKPRSTPVLLAADVVGSLAIGIDNVSLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTVLC
Ga0075366_1017919413300006195Populus EndosphereMHRGGVRYVAFGLRHPKAFSRSLTRDRATTLEASGAPAHWVWTAPLYSGLFSSMRATFAPGGSGGLESDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTAGFARSLGHIVSWDVALLTAIYSLYWIVARGRPRSTPVLLATDVVGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLI
Ga0068871_10052732613300006358Miscanthus RhizosphereMRVAFAPGGAGELQSDPALEPSELGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWGPTVGFAQSLGHIVSWDVVLLTAIYSFYWIVAQGQPRSAPVLIATDIVGSLAIGIDNVFLMLGDLGTLSGIFENLIGFICILLLRSLIVPSTIKRTLLCGLLMCGPTILGVAFNRHRFDDQALSWITMLGFSVNWSIIALIF
Ga0075428_10275792413300006844Populus RhizosphereDPALEPSEVGGHTLLQRRLSLYGKVLVVQSIIYWLIYAIIWGPTVGFAQSLGHIASWDVVLLTAIYSLYWIVARGQPRSTPVLLATDVVGSLAIGIDNVYLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTLLGVAFGPHRFDDQALSW
Ga0079217_1078044613300006876Agricultural SoilMLATFASGGAGGDQSDPALEPSEVGGHTLLQRRLALYGKVLVAQSILYWLIYAIIWGPTVGFTRSLGHIASWDVVLLTAIYSLYWFAARGRPRSTPVLLATDIGGSLAIGINNVFLMLGDLGTLSGAFENLIGFICILLLRSLIVPSTAKRTLLCGVLTCGPT
Ga0079217_1141432513300006876Agricultural SoilEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFRQSLGHIASWDVVLLTAIYSLFWIVARGQPRSAPVLLATGVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILFFRSLIVPSTVKRTLLCGLLMCGPTILGVTFGPHRFDDQVLSWITVVGFTINWSVIALIFSGAA
Ga0075429_10171715513300006880Populus RhizosphereRVGQRPGSEGRLSTGPLDSGLLSSMLATFSPGGDGGGQSDPALEPSEVGGHTLLQRRLSLYGKVLVGQSILYWLIYAIIWGPTVGFARSLGHIASWDVVLLTAIYSLYWIVARGRPRSAPVLLAMDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFLCILFFRALIVPSTVKRTLLCG
Ga0079215_1102419913300006894Agricultural SoilLDLRRDGGTQSDPALEPSEAGGHTLLQRRLSLYGKALVVQSIIYWLIYALIWGPTVGFTRSLGHLASWDVFLLTAIYAVYWVVARGRPRSTSVLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRALIVPSTVKRTLLCGLLMCGPTVLGVALGPHRFDDQSLSWVTVVGFGLKWAVLALISSSVVSAVLY
Ga0079216_1058642313300006918Agricultural SoilMRTTFAPGGGEGQNSDPALEPSEAGGHTLLQRRLSLYGKVLVAQSILYWLIYAIIWGPTVGFTRSLGHIVSWEVALLTAIYSLYWFAARGRPRSTPVLLATDIGGSLAIGINNVFLMLGD
Ga0079218_1059964513300007004Agricultural SoilMRVTFARDHLGKDVAPDSDPALVASEAGGHTLLQRRLSLYGKVLVVQSILYWLIYALVWAPTVGFTRSLGHLASWDVVLLTAIYSLFWILTRGRPLSLRALLALDVIGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILFFRSLIVPST
Ga0079218_1082725913300007004Agricultural SoilMRPSFAPGNSGGKESDPALEPSEVGGHTLLQRRLSLYGKVLVFQSILYWLIYAIIWGPTVGFTRSLSHIASWDVVLLTAIYSLYWIVARGRPLSAPVLLALDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRSLIVPSTVKRTLFCGLLMCGPTILGVALGRHRFDDQTLSWITVVGFSINWSFIALIFSGVASAV
Ga0111539_1271572713300009094Populus RhizosphereMRSFAAGNSAGQESDPALEPSEGGHTLLQRRLSLFGKVLVAQSILYWLIYAIVWAPSVGFTRSLRHLASWDVVLLTVIYALYWIVARGRPRSVPVLLAMDVVGSLLIGIDNVFLMLGDLGTISGVFENLIGFICILLSRALIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDDQSLSWITMVGF
Ga0075418_1184736613300009100Populus RhizosphereVITDAPETSRLSTGRLDSGLLSSMRATFAPGGGGLESDPALEPSEVGGHTLLQRRLSLYGKVLVVQSIIYWLIYAIIWGPTVGFTRSLGHLASWDVVLLTAIYALYWLVARGQPRSVPVLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRA
Ga0111538_1345337613300009156Populus RhizosphereLYGKVLVGQSILYWLIYAIIWGPTVGFARSLGHIASWDVVLLTAIYSLYWIVARGRPRSASVLLALDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFLCILFFRALIVPSTVKRTLLCGLLMCRPTTLGMAIGPHRFDDQTLSWITVVGFSINWSI
Ga0111538_1412888413300009156Populus RhizosphereMRSFAAGNSAGQESDPALEPSEGGHTLLQRRLSLFGKVLVAQSILYWLIYALIWGPSVGFARSLSHLASWDVVLLTAIYSLYWYVARGRPRSTSVLLATDVAGSLAIGIDNVFLMLGDLGTISGVF
Ga0105242_1261711113300009176Miscanthus RhizosphereGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFKESLGHIASWDVVLLTAIYSLYWIVARGRPRSTPILLATDVVGSLAIGIDNVYLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDAQALSWLTMMGVSVNWSVIALLFSCVASSTLYG
Ga0114940_1021394323300009448GroundwaterEPSEVGGHTLLQRRLSLYGKVLVAQSIVYWLIYAIIWGPTVGFAQSLGHIVSWDVFLLTAIYSLYWIVARGRPRSTPVLLATDVGGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCVPTILGVVFGSHRFDDQSLSWITMMGFSINWSVIALIFSCVASATLYGLRREVRDARKLG*
Ga0105237_1075169113300009545Corn RhizosphereMRATFALGGAKGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSILYWLIYAMVWGPTVGFARSLGHIVSWEVVLLNVIYSLFWVVARGRPRSTTFLLATDVIGSLAIGIDNVFLMPGDLGTISGVFENLVGFICILLWRALIVPSTVRRTLLCGLLMCGPTVIGVAWGT
Ga0126315_1051196113300010038Serpentine SoilMRAALFGQGRDGGTQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYATIWGPTVGFARSLGHIASWDVVLLTAIYSLYWVVARGKPRSTPVLLAADVVGSLAIGIDNVFLMLDDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLACGVLMCGPTILAVAFGSHRFDDQSLSWITMMGFSIN
Ga0126314_1139933213300010042Serpentine SoilMRVTFAPGGGGGSESDPALEPSEVGGHTLLQRRLSLYGKVLVFQSILYWLIYAIIWGPTVGFTRSLEHIASWDVVLLTAIYSFYWLVARGPPRSTLVLLATDVSGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLL
Ga0126306_1148030313300010166Serpentine SoilMGAALLDQGRDGGTQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTRSLGHIASWDVVLLTAIYSLYWVVARGKPRSTPVLLATDVVGSLA
Ga0134125_1251619713300010371Terrestrial SoilMDAAALDDPALEPSEVGGHTLLQRRLSLYGKVLIVQSILYWLIYALIWWPTVGFTRSLEHIATWDVLLLTGIYSLFWIVARGRARPASLLIAADVVGSL
Ga0134127_1184104213300010399Terrestrial SoilMRAAFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKALVGQSILYWLIYAIIWGPTVGFKESLGHIASWDVVLLTAIYSLYWIVARGRPRSAAVLLATDLVGALAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRALVVPSTVKRTLLCGLLMCGPTILGVAFGPHRFDDQALSWITVVGFSINWSFIALIFSGVASGVLYGLRR
Ga0134122_1196046013300010400Terrestrial SoilMRAPFAQAGDVGSQSDPALEPSEVGGHTLLQRRLALFGKALVAQSILYWLIYALIWGPTVGFAKSLRYIASWDVLLLTAIYALYWVVARGRPRSTPVLLAADVVGSLAIGIDNVYLMLSDLGT
Ga0134121_1068813313300010401Terrestrial SoilMRATFALGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVFLLTAIYSLYWIVARGRPRSTPVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVVFGRSRFDDQALSWITMVGFSINWSIIALIFSGVATATLYGLRREVRDARRLGQ
Ga0134123_1201787913300010403Terrestrial SoilMSAALLGQGRDGTESDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWIPTVGFERSLGHIASWDVVLLTAIYSLYWIVARGKPRSTPVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLMRSLIVPSTVK
Ga0137443_114951413300011433SoilMRATFAPGGGGELESDPALEPSEVGGHTLLQRRLSLYGKVLVAQSIIYWLIYAIIWGPTVGFTRSLSHIASWDVVLLTGIYSLYWIVARGKPRSAAVLLATDVVGSLAIGIDNVYLMLGDLGTLSGVFENLIGFICILLLR
Ga0137433_126993123300011440SoilMLLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFAQSLGHIASWDVVLLTAIYSLFWLVARGQPRPAPVLLAADVIGSLAIGIDNVFLMLGDLGTISGVFENLIGFISILFFRSLIVPSTVKRT
Ga0136634_1003496433300012046Polar Desert SandMRATFAPGGDEGLQSDPALEPSEVGGHTLLQRRLSLYGKALVAQSILYWLIYALIWGPTVGFTRSLGHIASWDVFLLTAIYSLFWVVARGRARSTPVLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICI
Ga0137374_1116660513300012204Vadose Zone SoilTARLDSGLLSSMRATFAPGGTGGLESDPALEPSDVGGHTLLQRRLSLYGKVLVAQSVVYWLIYAIIWGPTVGFARSLGHIVSWDVVLLTGIYSLYWIVARGRPRSATVLLATDIVGSLAIGIDNVYLMLGDLGTISGIFENLIGFICILLLRSLIVPSTVKRTLLCGVLMCGPTIVGVAF
Ga0157309_1031962213300012895SoilALEPSEIGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGAHRFDHQSLSWITMLGFSVNWSI
Ga0157303_1024531913300012896SoilETGTLDKTPGLRSLVSMRATFAPGGSGGLESDPALEPSEVGGHTLLQRRLSLYGKVLVAQSIVYWLIYALIWGPTVGFAKSLRYIASWDVVLLTGIYALYWVVARGRPRSTPVLLAADVVGSLAIGIDNVYLMLSDLARFPGFSRT*
Ga0157293_1020004613300012898SoilLQSDPALEPSETGGHTLLQRRLALYGQVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGRARSTPILLATDVAGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVMRTLSCGLLMCGPTILGVAFGRHRFDHQSLSWITMMGFSINWSVIALIFSGVASATLYGLRRE
Ga0157299_1009109023300012899SoilMPVTFALGNDAGLHSDPALVPSEAGGHTLLQRRLSLYGKVLVAQSIIYWLIYAIIWGPTVGFAQSLGYITSWAVVLLTAIYSLYWFVARGRPRSARALLATDVVGSLAIGIDNFFLMLGDLGLISGVFENLIGFICILLLRALIVPSTVKRTLLCGFLMCGPTILGVAFGPH
Ga0157288_1025864113300012901SoilPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYALIWGPTVGFRQSLGHIVSWDVVLLTAIYSLYWFVARGSARSAPILLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLMCGLLMCGPTILGVALGSHRFDDQSLSWITMMGFSINWSVIALIFS
Ga0157282_1004290623300012904SoilMRATFAPGNSGGLESDPALQPSEDGGHTFFQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFEQSLGHIVSWDVGLLTAIYSLFWIVARGRPRSAPVLLATDVIGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGVLMCGPTILGVVFGRHRFDDQALSWITMVGFSINWSVIALIFSGVASAVLYGLR
Ga0157295_1019104613300012906SoilLDSGLLASMRAMFAPGGVGLESDPALEPSDVGGHTLLQRRLALFGKVLVGQSILYWLIYALIWGPTVGFAQSLKYLASWDVVLLTAIYAFYWLVARGRPRSAAVLFATDIVGSVAIGIDNVFLMLTDLGTISGVFENLIGFICILLFRALIVPSTVKRTLLCGLLMCGPTVLGVAFGRHRFDDQSLSWITVLGFGVNWSIIALIFSCVATAVLY
Ga0157297_1022016113300012914SoilMLTTFAPGSTGGRESDPALEPTEVGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGAHRIDHQSLSWITMLGFSVNWSIIA
Ga0157310_1032387113300012916SoilMRRTFAPGGSGGLHSDPALEPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYAIIWGPTVGFAQSLGYITSWAVVLLTAIYSLYWFVARGRPRSMRVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLV
Ga0164302_1083152013300012961SoilMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLVARGQPRSAPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVRRTLLCGFLMCGPTILGVAFGRHR
Ga0164307_1056905913300012987SoilMRTTFAPGSTGGLESDPALEPSEVGGQTLLQRRLALYGKVLVVQSILYWLIYALIWAPTVGFRESLGHLASWDVGLLTAIYSLYWVVARGRPRSAPVLLATDIAGSLAIGIDNVWLMLGDLGTISGVFENLIGFIC
Ga0157378_1184431213300013297Miscanthus RhizosphereMERFLPVVLDSGLLSSMRATFAPGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWIAARGQPRSTPFLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMAGPTILGVAFGRHRFDDQA
Ga0157375_1259140713300013308Miscanthus RhizosphereMRATFAPGGSGGLESDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWLAARGRPRSAPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFI
Ga0157380_1177388013300014326Switchgrass RhizosphereMRPSFAPGNSGGLESDPALEPSEVGGHTLLQRRLALFGKVLVGQSILYWLIYAIIWGPSVGFARSLGHLASWDVVLLTVIYALYWVIARGRPRPTSVLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRALIVPSTVQRTLLCGLLMCGPTLLGVAFGPHRFDDQALSWITVVGFGINWSTIAL
Ga0157376_1231114513300014969Miscanthus RhizosphereMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLVARGQPRSAPLLLATDVAGSLAIG
Ga0173480_1048173913300015200SoilMRATFALGGGGGLQSDPALEPSEAGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTRSLGHIASWDVFLLTAIYSLYWIVARGKPRSTSVLLAADVVGSLAIGIDNVFLMLGDLGTLSGVFENLIGFI
Ga0173480_1089550713300015200SoilMRANFALGNDAGLHSDPALVPSEAGGHTLLQRRLSLYGKVLVAQSILYWLIYAIIWGPTVGFAQSLGYVTSWYVVLLTAIYSLFWLVARGRPRSMRVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENL
Ga0173478_1041416913300015201SoilMRRTFAPGGSGGLHSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWVVARGQPRSAPVLLATDVGGGLAIGIDNVFLMLGDLGTISGVFENLIG
Ga0180079_106653513300015248SoilQRRLSLYGKVLVAQSIVYWLIYAIIWGPTVGFTRSLGHIASWDVVLLTAIYSLYWIVARGRPRSTLVLLASDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDDQALSWITMLGFSINWSVIALIFSGVASATLYGMRREV
Ga0190266_1019229813300017965SoilMRAALFDQGRDGGTQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGRARSTPVLLATDVGGSLAIGIDNGFLILGDLSTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDDQALSWITMMGFSINWSVIALIFSGVASAT
Ga0190266_1067118213300017965SoilGGGEGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVAQSIVYWLIYAIIWGPTVGFTQSLGHIVSWDVVLLTAIYSLYWIVARGRPRSTPVLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENRIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDDQALSWITMMGFSINWSVIALIFSGVASATLYGLRREVRDARRLG
Ga0190265_1238574613300018422SoilATFAPGGDEGQKSDPALEPSEVGGHTLLQRRLSLYGKVLVGQSILYWLIYALIWGPTVGFTRSLGHIASWDVVLLTAIYSLYWVVARGQPRSTLVLLATDVVGSLAIGIDNVYLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDDQALSWITMLGFSVNWSVIALIFSGVASATLYGLRR
Ga0190272_1208386213300018429SoilGGLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTRSLGHIASWDVALLTAIYSLYWIVARGRPRSTPLLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDDQALSWITMVGFSINWSVIALIFSGVASATLYGLR
Ga0190275_1033403813300018432SoilMRTTFAPGGGEGQNSDPALEPSEAGGHTLLQRRLALYGKVLVAQSILYWLIYAIIWGPTVGFTRSLRHIASWDVVLLTAIYSLFWIVARGRPRSAPVLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLM
Ga0190275_1068596513300018432SoilVSPMPATFAPGRDGALESDPALEPSELGGHTLLQRRLALYGKVLVAQSILYWLVYAIIWGPTVGFARSLGHIASWDVVLLTAIYSFYWIVARGRPRSASVLVATDVVGSLAIGIDNVSLMLGDLGTI
Ga0190269_1000640213300018465SoilMRVPFAPGGGSGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAMIWGPTVGFARSLEHIASWDVVLLTAIYSLYWIVARGRPRSASILLATDIGGSLAVGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSSVRRTLLCGVLMWTDHPRRGVRPSPLRRPDAVVDHDA
Ga0190270_1140604113300018469SoilRPGSGPAALAGALEARVMAAQRFLAIAEQDAVCSGRSTGRLDSGLLSSMRATFAPGNSGGLESDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFAQSLGHIASWDVVLLTAIYSLYWIVARGRPRSAPVLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRGLIVPSTVKRTLLCGLLMCGPTILGVALGRHRFDDQALSWITMMGFSINWSVIALIFS
Ga0190274_1044609323300018476SoilMRATFAPGSSGGHESDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGKPRSTPILLVTDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDDQALSWITMVGFS
Ga0190274_1073315123300018476SoilMRATFAPGGSGGLLSDPALEPSEAGGHTLLQRRLSLYGKVLVAQSIVYWLIYAIIWGPTVGFAQSLGHIVSWDVVLLTAIYSLYWIVARGRPRSTPVLLATDIGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIV
Ga0190271_1073486113300018481SoilMRATFAPGGGGGTQSDPALEPSEVGGHTLLQRRLALYGKVLVAQSIVYWLIYAIIWGPTVGFAQSLGHIVSWDVFLLTAIYSLYWIVARGQPRSTPVLLATDVVGSLAIGIDNVSL
Ga0190271_1185139813300018481SoilMRATFAPGGGGGLLSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYALIWGPTVGFAQSLGHIASWDVVLLTAIYSLYWIVARGQPRSTPVLLATDVVGSLAIGIDNVSLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTILCGLLMCGPTILGVAFGSHRFDDQS
Ga0173481_1047964113300019356SoilMRVTFAPGNDAGLASDPALVPSEAGGHTLLQRRLSLYGKVLVAQSILYWLIYAIIWGPTVGFAQSLGYVTSWYVVLLTAIYSLFWLVARGRPRSMRVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILG
Ga0173482_1000676613300019361SoilMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLAARGRPRSSPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVRRTLLCGFLMCGPTILGVAFGRHRFDAQALSWITMMGFSINWSVIALIFSCVASATLYGLRR
Ga0173482_1063705913300019361SoilGGSISTAPRDSALLFPMRAMFALGGDGGSLSDPALEPSEAGGHTLLQRRLSLFGKALVAQSILYWLIYALIWGPTVGFRQSLGHIVSWDVVLLTAIYSLYWFVARGSARSAPILLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTI
Ga0173479_1054026213300019362SoilMLTTFAPGSTGGRDSDPALEPSEIGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVA
Ga0190264_1000226963300019377SoilMRSTFALGGGGGLQSDPALEPSETGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGRARSAPVLLATDVGGSLAVGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVRRTLLCGLLMCGPTILGVALARTASTTNRCRGSP
Ga0212091_1043733613300022549GroundwaterALEPSVAGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHLASWDVVMLTALYSLYWIVARGRPRSTPVLLATDVGGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCVPTILGVVFGSHRFDDQSLSWITMLGFSINWSVIALI
Ga0247787_102132023300022893SoilMRRTFAPGGSGGLHSDPALEPSEVGGHTLLQRRLALFGKVLVGQSILYWLIYAIIWGPSVGFARSLGHLASWDVVLLTVIYALYWVIARGRPRPTPVLLATDVVGSLAIGIDNV
Ga0247778_122674513300022894Plant LitterSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGAHRFDHQSLSWITMLGFSVNWSIIALIFSGVASAVLYGLRREVRDARRL
Ga0247769_115384513300022904Plant LitterMLTTFAPGSTGGRDSDPALEPSEIGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFE
Ga0247766_117375813300022906Plant LitterGGLQSDPALEPSEVGGHTLLQRRLALYGKVLVAQSILYWLIYAIIWGPTVGFTQSLGHIASWDVFLLTAIYSLYWLVAHGQPRSALVLLATDVVGSLAIGVDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGRHRFDHQSLSWITMMGFSINWSVIALI
Ga0247777_107741423300022917Plant LitterMRATFALGGGGGLQSDPALEPSEAGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFAESLGHIASWDVFLLTAIYSLYWIVARGKARSTPVLLATDVIGSLAIGIDNVYLMLSDLGTISGVFENLIGFICILLFRALIVPSTIKRTLLCGLLM
Ga0247777_121419413300022917Plant LitterMLTTFAPGSTGGRDSDPALEPSEIGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNVSLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVAFGAHRFDHQSLSWITM
Ga0247777_125390013300022917Plant LitterLSKVRGTFAPGGGGELQSDPALEPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWGPSVGFTQSLGHIASWDVVLLTAIYSLYWIVARGQPRAAPLLLATDVGGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDHQSL
Ga0247791_107943013300023062SoilMLTTFAPGSTGGRDSDPALEPSEIGGHTLLQRRLALYGKALVVQSIIYWLIYALIWAPTVGFRQSLGHIASWDVVLLTAIYSLYWVAARGRPRSTPVLLATDIAGSLAIGVDNV
Ga0247744_105470413300023073SoilMRATFALGGGGGLQSDPALEPSEAGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFAESLGHIASWDVFLLTAIYSLYWIVARGKARSTPVLLATDVIGSLAIGIDNVSLM
Ga0247754_102430913300023102SoilMPVTFAPGGGGGLESDPALEPSEVGGHTLLQRRLSLFGKVLVFQSILYWLIYAIIWGPTVGFDQSLGHIVSWDVGLLTAIYSLFWIVARGRPRSAPVLLATDVIGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCG
Ga0247765_109363113300023268Plant LitterDSTRRLDSGLLAAMSAALFDLGRNGGTQSDPALEPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYAIIWGPTVGFKESLGHIASWDIVLLTAIYSLYWIAARGKPRSAPVLLAIDVGGALAVGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTIVGVGFGSHRFDNQSLSWITMVGFSVNWSIIALI
Ga0247773_110771523300023269Plant LitterMSAALWDLSRDRHSDPALEPSEVGGLTLLQRRLSLYGKALVVQSILYWLIYAIIWGPSVGFTRSLGHIASWDVGLLTAIYALYWLVARGKPRSTSVLLATDVVGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTIVGV
Ga0247776_1040516613300023275Plant LitterDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWGPTVGFRQSLGHIVSWDVVLLTAIYSLYWFVARGSARSAPILLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTIVGVALGSHRFDDQSLSW
Ga0247794_1010615813300024055SoilMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLAARGRPRSSPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVRRTLLCGFLMCGPTILGVAFGRHRFDAQALSWITMMGFSVNWSVIALIFSCVASSTLYGLRRQVRDA
Ga0207643_1105805413300025908Miscanthus RhizosphereFDTWKMPSTPPLDSGLLSSMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFICILLLSAQLPHSALAAQGAP
Ga0207690_1152579113300025932Corn RhizosphereRLGSGVRLGLVSSMRATFAPGGGGGLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLAARGRPRSSPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVRRTLLCGFLMCGPTILGVAFGRHR
Ga0207686_1142024013300025934Miscanthus RhizosphereLQSDPALDPSEVGGHTLLQRRLSLYGKVLVAQSILYWLIYALIWAPTVGFTQSLGHIASWDVVLLTAIYSLYWLVARGQPRSAPLLLATDVAGSLAIGVDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVRRTLLCGFLMCGPTILGVAFGSLTLYASHRPALFAFLPLALLPLIGRMTLEQD
Ga0207689_1171161513300025942Miscanthus RhizosphereWLIYAIIWGPTVGFTRSLGHLVSWDVILLTGIYSLYWVVARGRPRSATLLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGVLMCGPSILGVAFGTHRFDDQALSWITMVGFSVNWSVIALIFSCVATAVLYGLRRDVRDARRLGQ
Ga0207712_1046260423300025961Switchgrass RhizosphereMERVLSVVLDSGLLSSMRATFAPGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWIAARGQPRSTPFLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMAGPTILGVAFGRHRFD
Ga0207640_1183624313300025981Corn RhizosphereMRTTFAPGSTGGLESDPALEPSEVGGQTLLQRRLALYGKVLVVQSILYWLIYALIWAPTVGFRESLGHLASWDVGLLTAIYSLYWVVARGRPRSAPVLLATDIAGSLAIGIDNVWLMLGDLGTISGVFENLIGFICILLLRALIVPSTV
Ga0207658_1214057113300025986Switchgrass RhizosphereMRATFAPGGDSGLKSDPALEPSEAGGHTLLQRRLSLYGKALVVQSILYWLIYAIIWGPTVGFKRSLGHLASWDVVLLTAIYSLYWIVARGRPRSTSVLLATDIAGSLA
Ga0207708_1099544713300026075Corn, Switchgrass And Miscanthus RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFIC
Ga0207702_1063922813300026078Corn RhizosphereMRATFALGGAEGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSILYWLIYAMVWGPTVGFARSLGHIVSWEVVLLNVIYSAFWIVARGRPRSTSFLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLWRALIVPSTVKRTLLCGLLMCGPTVLGVAWGTHRFDRQTVSWITMVGFSINWSAIALIFSCVASAV
Ga0207641_1063678413300026088Switchgrass RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDN
Ga0207674_1017302013300026116Corn RhizosphereMRATFALGGAKGLQSDPALEPSEVGGYTLLQRRVAVYGKFLVAQSLLYWLIYALVWGPTVGFARSLGHIVAWEVVLLNVIYSLFWLVARGRPRSTLFLLATDVAGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGVLMCGPSILGVAFGTHRFDDQALSWITMVGFSINWSIIALIFSGVASAVLYGLRREVRDARPTRVDRRTLSHSNS
Ga0207675_10058484413300026118Switchgrass RhizosphereMRAPFAPGGDGGQKSDPALEPSEAGGHTLLQRRLALYGQVLVAQSILYWLIYAAIWGPSVGFARSLSHLVSWDVVLLTGIYSLYWLVARGRPRGTSVLLATDVLGSLAVGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVVLGRHRFDDQSLSWITMVGFSVNWSTIALMTRSLSACVSVGRAMEVRYAEITVPCTAPRTQPGSNANVRVCPSFA
Ga0207675_10174126413300026118Switchgrass RhizosphereMLATFAPGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVLQSILYWLIYAIIWGPTVGFKESLGHIASWDVVLLTAIYSLYWIVARGQARSTPVLLATDVAGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVAWGRHRFDDQALSWITMMGFSINWSVIALIFSGVA
Ga0207683_1003369013300026121Miscanthus RhizosphereMLATFAPGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVLQSILYWLIYAIIWGPTVGFKESLGHIASWDVVLLTALYSLYWIVARGKPRSTPVLLATNVVGALAIGIDNVFLMLGDLGTISGVF
Ga0209486_1065248813300027886Agricultural SoilMRVTFARDHLGKDVAPDSDPALVASEAGGHTLLQRRLSLYGKVLVVQSILYWLIYALVWAPTVGFTRSLGHLASWDVVLLTAIYSLFWILTRGRPLSLRALLALDVIGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILFFRSLIVPSTV
Ga0247749_101336423300027993SoilMRRTFAPGGSGGLHSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWVVARGQPRSAPVLLATDVGGGLAIGIDNVFLMLGDLGTISGVFENLIGFICILLL
Ga0268266_1079989913300028379Switchgrass RhizosphereMRATFALGGGGGLQSDPALEPSQEGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFRESLGHIVSWDVVLLTAIYSLYWVVARGGVRSAPVLLATDVVGSLAIGIDNVFLMLGDLGTLSGVFENLIGFICILLLRALIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDHQSLSWITMIGFTVNWSVIALIFSHNRATRFRLGLPHSSHRPVRFERCRPNV
Ga0268265_1159415513300028380Switchgrass RhizosphereMRAFTLGGGGLQSDPALEPSEAGGHTLFQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLYWIVARGTPRSAPVLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGLL
Ga0307309_1019457313300028714SoilGRDGGTQSDPALEPSEAGGHTLLQRRLSLYGKALVVQSIFYWLIYAVIWGPTVGFTRSLGHIASWDVIVLTAIYSLYWVVARGKPRSTPVLLATDIVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTILSGLLMCVPTILGVVFGSHRFDHQSLSWIT
Ga0307505_1048520113300031455SoilPATFAPGGAGGLESDPALEPSEVGGHTLLQRRLALYGKVLVVQSILYWLIYAIIWGPTVGFTRSLAHIASWDVVLLTAIYSLYWIVARGQPRSAPVLLATDVIGSLAIGIDNVYLMLGDLGTISGVFENLIGFICILLLRSLIVPSTVKRTLLCGLLMCGPTILGVVFGRHRFDDQALSWITMVGFSVNWSVIALIFS
Ga0307468_10202126313300031740Hardwood Forest SoilSEVDGHTLLQRRLSLYGKVLVAQSIVYWLIYAVIWGPTVGFARSLSHIASWDVVLLTAIYSLYWIVARGRPRSASVLLVTDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVERTLLCGLLMCGPTILGVAFGPHRFDDQALSWITMMGFCINWSVIALIFSGVASGV
Ga0310892_1119288413300031858SoilGTHSDPALVPSEAGGHTLLQRRLSLYGKVLVVQSILYWLIYAIVWAPTVGFTESLAHIASWDVALLTAIYSLFWVVTRGRPLSMPVLLATDVIGSMAIGIDNVFLMLGDLGTISGVFENLIGFICILLFRALVVPSTVKRTMLCGLLMCGPTLLGVALGPHRFDDQALSWITVVGFGINW
Ga0307411_1084870423300032005RhizosphereMRASFAPGVDEGRESDPALEPSQVGGHTLLQRRLSLYGKALVAQSIVYWLIYAIIWGPSVGFKRSLAHIVSWEVILLTAIYSLFWLVARGRPRSARALLAADIGGSLLIGVDNFFLMLGDLGMISGVFENLIGFICILLLRSLIVPSTVKRTILCGVLMCGPTIVGVA
Ga0310906_1146729713300032013SoilLHSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTQSLGHIASWDVVLLTAIYSLFWVVARGQPRSAPDHLATDVGGGQAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTVKRTLLCGVLMCGPTLLGVVFGRHRFDDQAL
Ga0307415_10103481523300032126RhizosphereMRATFALGGGGGLQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFAQSLGHIASWDVFLLTALYSLYWVVARGKARPAPVLLATDVVGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRSL
Ga0315912_1136204813300032157SoilRRQHLIADEHRTGIQRAQRGLFIMDSTEPPDSGLLSSMLATFAPGADRGSQSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILYWLIYAIIWGPTVGFTRSLGHIASWDVALLSAIYSLYWIVARGGPRSTPVLLATDVGGSLAIGIDNVFLMLGDLGTISGVFENLIGFICILLLRALIVPSTV
Ga0307472_10121173813300032205Hardwood Forest SoilMRATFAPGGGGGLHSDPALEPSEVGGHTLLQRRLSLYGKVLVVQSILSWLIYAIIWGPTVGFAKSLGHIASWDVVLLTGIYSIYWIVARGKPRPTPVLLATDIVGSLAIGIDNVYLMLGDLGTLSGVFENLIGFICILLLRSLIVPSTVKRTLLCGVLMCGPTILGVAFGPHRFDDQALSWITMVGFSINWSIIALIFSGVASAVLYGLRREVRDARR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.