NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058291

Metagenome / Metatranscriptome Family F058291

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058291
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 58 residues
Representative Sequence MFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG
Number of Associated Samples 111
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.81 %
% of genes near scaffold ends (potentially truncated) 57.78 %
% of genes from short scaffolds (< 2000 bps) 91.11 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(37.037 % of family members)
Environment Ontology (ENVO) Unclassified
(34.815 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.00%    β-sheet: 0.00%    Coil/Unstructured: 65.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF13360PQQ_2 1.48
PF028262-Hacid_dh_C 0.74
PF04546Sigma70_ner 0.74
PF04545Sigma70_r4 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.74

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.33 %
UnclassifiedrootN/A6.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_2787_length_1365_cov_8.142124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1397Open in IMG/M
2170459010|GIO7OMY02I42I5All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47516Open in IMG/M
2199352025|deepsgr__Contig_42683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471620Open in IMG/M
3300004156|Ga0062589_102161998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47569Open in IMG/M
3300004479|Ga0062595_101740685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47589Open in IMG/M
3300005148|Ga0066819_1014038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47610Open in IMG/M
3300005331|Ga0070670_100008676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8675Open in IMG/M
3300005339|Ga0070660_100172394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1748Open in IMG/M
3300005539|Ga0068853_101896089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47578Open in IMG/M
3300005578|Ga0068854_101918101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47545Open in IMG/M
3300005614|Ga0068856_101539047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47679Open in IMG/M
3300005842|Ga0068858_100780493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47932Open in IMG/M
3300006038|Ga0075365_10005595All Organisms → cellular organisms → Bacteria6797Open in IMG/M
3300006042|Ga0075368_10166860All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47924Open in IMG/M
3300006178|Ga0075367_10255681Not Available1099Open in IMG/M
3300006178|Ga0075367_10573183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47717Open in IMG/M
3300006237|Ga0097621_100921070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47815Open in IMG/M
3300006581|Ga0074048_13387658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1619Open in IMG/M
3300006604|Ga0074060_10000302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47509Open in IMG/M
3300006606|Ga0074062_10008628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47737Open in IMG/M
3300006845|Ga0075421_100105786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3537Open in IMG/M
3300006847|Ga0075431_101912715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47549Open in IMG/M
3300006954|Ga0079219_11052364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47683Open in IMG/M
3300009156|Ga0111538_10215981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2431Open in IMG/M
3300009174|Ga0105241_11521456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47645Open in IMG/M
3300009551|Ga0105238_10141453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2383Open in IMG/M
3300009840|Ga0126313_10480139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47994Open in IMG/M
3300010147|Ga0126319_1022200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47939Open in IMG/M
3300010154|Ga0127503_10258430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300010154|Ga0127503_11165359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47698Open in IMG/M
3300010397|Ga0134124_10528934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471144Open in IMG/M
3300010400|Ga0134122_10542400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471062Open in IMG/M
3300011106|Ga0151489_1337370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47719Open in IMG/M
3300012212|Ga0150985_100214777Not Available827Open in IMG/M
3300012212|Ga0150985_102079218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47855Open in IMG/M
3300012212|Ga0150985_105270570Not Available602Open in IMG/M
3300012212|Ga0150985_106144258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47609Open in IMG/M
3300012212|Ga0150985_108282996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47872Open in IMG/M
3300012212|Ga0150985_121463105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47863Open in IMG/M
3300012212|Ga0150985_122416828Not Available529Open in IMG/M
3300012212|Ga0150985_122587956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47882Open in IMG/M
3300012469|Ga0150984_105960388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47540Open in IMG/M
3300012469|Ga0150984_113145721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471026Open in IMG/M
3300012469|Ga0150984_119406160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47820Open in IMG/M
3300012469|Ga0150984_119843999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47580Open in IMG/M
3300012469|Ga0150984_121850296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47801Open in IMG/M
3300012955|Ga0164298_10079735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1675Open in IMG/M
3300012987|Ga0164307_11275598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47613Open in IMG/M
3300012989|Ga0164305_10201734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1399Open in IMG/M
3300012989|Ga0164305_10912481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47739Open in IMG/M
3300013297|Ga0157378_10080712All Organisms → cellular organisms → Bacteria2939Open in IMG/M
3300013297|Ga0157378_10759296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47993Open in IMG/M
3300014325|Ga0163163_10087622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3123Open in IMG/M
3300015200|Ga0173480_10146380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471202Open in IMG/M
3300015374|Ga0132255_100260393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2482Open in IMG/M
3300017792|Ga0163161_10621502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47893Open in IMG/M
3300017965|Ga0190266_10651765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47648Open in IMG/M
3300017965|Ga0190266_10760129Not Available615Open in IMG/M
3300017997|Ga0184610_1089628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47964Open in IMG/M
3300018000|Ga0184604_10111215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47862Open in IMG/M
3300018027|Ga0184605_10014661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3064Open in IMG/M
3300018031|Ga0184634_10174908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47971Open in IMG/M
3300018054|Ga0184621_10066452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471233Open in IMG/M
3300018055|Ga0184616_10241718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47683Open in IMG/M
3300018066|Ga0184617_1143838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47694Open in IMG/M
3300018067|Ga0184611_1019244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2084Open in IMG/M
3300018077|Ga0184633_10401921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47684Open in IMG/M
3300018082|Ga0184639_10029679All Organisms → cellular organisms → Bacteria2781Open in IMG/M
3300018429|Ga0190272_11214231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47742Open in IMG/M
3300018466|Ga0190268_12287837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47509Open in IMG/M
3300018469|Ga0190270_10930028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47890Open in IMG/M
3300018476|Ga0190274_10109099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2226Open in IMG/M
3300018476|Ga0190274_11982059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47678Open in IMG/M
3300018481|Ga0190271_10197737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471998Open in IMG/M
3300019263|Ga0184647_1252131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47934Open in IMG/M
3300019269|Ga0184644_1264928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47548Open in IMG/M
3300019356|Ga0173481_10049840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471436Open in IMG/M
3300019356|Ga0173481_10476619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47630Open in IMG/M
3300020002|Ga0193730_1171237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47555Open in IMG/M
3300020016|Ga0193696_1048435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1123Open in IMG/M
3300020082|Ga0206353_11053276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47513Open in IMG/M
3300021339|Ga0193706_1207188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47528Open in IMG/M
3300021344|Ga0193719_10473952Not Available506Open in IMG/M
3300023263|Ga0247800_1055428All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47733Open in IMG/M
3300024055|Ga0247794_10128756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47776Open in IMG/M
3300025907|Ga0207645_10201027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471311Open in IMG/M
3300025914|Ga0207671_10486489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47984Open in IMG/M
3300025917|Ga0207660_10379805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471136Open in IMG/M
3300025918|Ga0207662_10087003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1916Open in IMG/M
3300025940|Ga0207691_10785973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47800Open in IMG/M
3300025986|Ga0207658_12205648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47500Open in IMG/M
3300026023|Ga0207677_11661258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47592Open in IMG/M
3300026035|Ga0207703_11812731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47586Open in IMG/M
3300026116|Ga0207674_10738586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47950Open in IMG/M
3300027866|Ga0209813_10331686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47598Open in IMG/M
3300027866|Ga0209813_10352617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47583Open in IMG/M
3300028714|Ga0307309_10212763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47513Open in IMG/M
3300028721|Ga0307315_10125518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47768Open in IMG/M
3300028787|Ga0307323_10150736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47839Open in IMG/M
3300028790|Ga0307283_10052039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47979Open in IMG/M
3300028790|Ga0307283_10231559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47538Open in IMG/M
3300028810|Ga0307294_10131923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47818Open in IMG/M
3300028876|Ga0307286_10073760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471178Open in IMG/M
3300028885|Ga0307304_10056588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1468Open in IMG/M
3300030829|Ga0308203_1030265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47752Open in IMG/M
3300030829|Ga0308203_1083853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47528Open in IMG/M
3300030830|Ga0308205_1014419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47848Open in IMG/M
3300030830|Ga0308205_1055143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47537Open in IMG/M
3300030902|Ga0308202_1100755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47596Open in IMG/M
3300030902|Ga0308202_1150025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47518Open in IMG/M
3300030903|Ga0308206_1063365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47762Open in IMG/M
3300030903|Ga0308206_1115750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47615Open in IMG/M
3300030904|Ga0308198_1064520Not Available591Open in IMG/M
3300030905|Ga0308200_1043709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47816Open in IMG/M
3300030990|Ga0308178_1128918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47564Open in IMG/M
3300030993|Ga0308190_1073476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47704Open in IMG/M
3300031039|Ga0102760_10829847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47515Open in IMG/M
3300031058|Ga0308189_10262113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47658Open in IMG/M
3300031082|Ga0308192_1072304Not Available551Open in IMG/M
3300031091|Ga0308201_10088918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47868Open in IMG/M
3300031092|Ga0308204_10118060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47752Open in IMG/M
3300031093|Ga0308197_10100492Not Available855Open in IMG/M
3300031114|Ga0308187_10493339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47502Open in IMG/M
3300031152|Ga0307501_10022816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1207Open in IMG/M
3300031170|Ga0307498_10136193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47799Open in IMG/M
3300031231|Ga0170824_115759959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471165Open in IMG/M
3300031366|Ga0307506_10199054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47735Open in IMG/M
3300031547|Ga0310887_10236869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR471012Open in IMG/M
3300031740|Ga0307468_100503015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47961Open in IMG/M
3300031847|Ga0310907_10671668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47571Open in IMG/M
3300031854|Ga0310904_10098528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1600Open in IMG/M
3300032012|Ga0310902_10893036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47611Open in IMG/M
3300032174|Ga0307470_10824844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47721Open in IMG/M
3300034644|Ga0370548_113431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47561Open in IMG/M
3300034680|Ga0370541_051215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. FHR47542Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil37.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.41%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere5.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.44%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere4.44%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere3.70%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.22%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.22%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.48%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.48%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.74%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005148Soil and rhizosphere microbial communities from Laval, Canada - mgLMAEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031082Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034680Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_010235202140918013SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSNRR
F62_023139202170459010Grass SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETP
deepsgr_003859802199352025SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPETPEKDAALTSKRS
Ga0062589_10216199823300004156SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDAPKTDAATSNRR*
Ga0062595_10174068513300004479SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEM
Ga0066819_101403813300005148SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLAPKRG
Ga0070670_100008676113300005331Switchgrass RhizosphereMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSNRR*
Ga0070660_10017239423300005339Corn RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDATLTPRRG
Ga0068853_10189608913300005539Corn RhizosphereMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATS
Ga0068854_10191810123300005578Corn RhizosphereLPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG*
Ga0068856_10153904733300005614Corn RhizosphereILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG*
Ga0068858_10078049323300005842Switchgrass RhizosphereMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAVTPNRR*
Ga0075365_1000559563300006038Populus EndosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPELPEKDATLTPRRG
Ga0075368_1016686023300006042Populus EndosphereMFQTSRFILPYEPGYTGHWEAEKRRKETREWLRQRECEIAAPSIVPEMPERDATLTPKRG
Ga0075367_1025568113300006178Populus EndosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRRREREIAAPSIVPEMPERD
Ga0075367_1057318323300006178Populus EndosphereMFQTSRFILPYEPGYTGHWEAEKRRKETREWLRQRECEIAAPSIVPEMPE
Ga0097621_10092107023300006237Miscanthus RhizosphereMLQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKEATLTPKPG
Ga0074048_1338765813300006581SoilTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG*
Ga0074060_1000030223300006604SoilSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG*
Ga0074062_1000862833300006606SoilILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKEATLTPKPG*
Ga0075421_10010578643300006845Populus RhizosphereMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDSPKTDAATSNRR*
Ga0075431_10191271523300006847Populus RhizosphereWQGAVVLTKEIPMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSNRR*
Ga0079219_1105236413300006954Agricultural SoilPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAVTPNRR*
Ga0111538_1021598113300009156Populus RhizosphereMFETSKFILPYEPGDTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERD
Ga0105241_1152145633300009174Corn RhizosphereLPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAVTPNRR*
Ga0105238_1014145333300009551Corn RhizosphereMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVAEMPVRDATLTPKRG
Ga0126313_1048013933300009840Serpentine SoilMFHTSKFILPYEPGYTGHWEAAKRRKETREWLRQREREIAAPSIVPDLPERDATLTPKHG
Ga0126319_102220013300010147SoilTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDVALTSKRS*
Ga0127503_1025843013300010154SoilLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETLERDAALTSKRS*
Ga0127503_1116535923300010154SoilSMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDATLTSKRI*
Ga0134124_1052893433300010397Terrestrial SoilWNGGWQGAVVLTKEIPMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSNRR*
Ga0134122_1054240023300010400Terrestrial SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKHG
Ga0151489_133737033300011106SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATQTPKRR
Ga0150985_10021477713300012212Avena Fatua RhizospherePYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG*
Ga0150985_10207921833300012212Avena Fatua RhizosphereSMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMLERDATLTPKRG*
Ga0150985_10527057023300012212Avena Fatua RhizosphereYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG*
Ga0150985_10614425823300012212Avena Fatua RhizosphereSMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKHAASTSKRG*
Ga0150985_10828299613300012212Avena Fatua RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMP
Ga0150985_12146310533300012212Avena Fatua RhizosphereRRYATKEISMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREVAAPSIVPEMPERDATLTPKRG*
Ga0150985_12241682813300012212Avena Fatua RhizosphereSMFQTSKFILPYEPGYIGHWDAEKCRKETSEWLRQGEREIAAPSIVPEIR*
Ga0150985_12258795613300012212Avena Fatua RhizosphereRRYATKEISMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLAPKRG*
Ga0150984_10596038823300012469Avena Fatua RhizosphereFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG*
Ga0150984_11314572133300012469Avena Fatua RhizosphereEISMFQTSKFLLPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG*
Ga0150984_11940616033300012469Avena Fatua RhizosphereLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG*
Ga0150984_11984399913300012469Avena Fatua RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETLAWLRQREREIAAPSIVPEMPEKHAASTSKRG
Ga0150984_12185029623300012469Avena Fatua RhizosphereLPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLAPQRG*
Ga0164298_1007973513300012955SoilARKEISMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLAPKRG*
Ga0164307_1127559823300012987SoilMFQTSKYILPYEPGYTGHWEAETRRKETREWLRQREREIAAPSIVPEMPERDATLAPKRG
Ga0164305_1020173413300012989SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLT
Ga0164305_1091248123300012989SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREMAAPSIVPEMPERDATLAPKRG
Ga0157378_1008071243300013297Miscanthus RhizosphereMFQTSKYILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG
Ga0157378_1075929623300013297Miscanthus RhizosphereMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSDRR*
Ga0163163_1008762213300014325Switchgrass RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRD
Ga0173480_1014638013300015200SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVRELP
Ga0132255_10026039353300015374Arabidopsis RhizosphereTKEIPMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAVTPNRR*
Ga0163161_1062150233300017792Switchgrass RhizospherePYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSDRR
Ga0190266_1065176513300017965SoilKEISMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEMPEKDATLTPKRG
Ga0190266_1076012913300017965SoilTSKFILPYEPGYTRHWESEKRRKETREWLRQRERDLAAPSIVPETPEKDAVLTSKRS
Ga0184610_108962823300017997Groundwater SedimentMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0184604_1011121513300018000Groundwater SedimentMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREVAAPSIVPEMPERDATLTPKHG
Ga0184605_1001466113300018027Groundwater SedimentMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERNAALTSKRS
Ga0184634_1017490813300018031Groundwater SedimentMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPEKPEKDAALTSKRS
Ga0184621_1006645213300018054Groundwater SedimentMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKRS
Ga0184616_1024171813300018055Groundwater SedimentMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0184617_114383823300018066Groundwater SedimentMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0184611_101924413300018067Groundwater SedimentMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDVALTSKRS
Ga0184633_1040192113300018077Groundwater SedimentMFQTAKFSLPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0184639_1002967943300018082Groundwater SedimentMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRC
Ga0190272_1121423123300018429SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKHG
Ga0190268_1228783723300018466SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0190270_1093002813300018469SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDATLTPKRG
Ga0190274_1010909933300018476SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKHG
Ga0190274_1198205933300018476SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERELAAPSIVPEMPERDAPLMLKRG
Ga0190271_1019773733300018481SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0184647_125213123300019263Groundwater SedimentMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0184644_126492823300019269Groundwater SedimentEISMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0173481_1004984023300019356SoilMLKTSKFILPYKPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDAPKTDAATSNRR
Ga0173481_1047661913300019356SoilMLQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG
Ga0193730_117123713300020002SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRELEIASPSIVPEPPERDAALASKGS
Ga0193696_104843533300020016SoilPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0206353_1105327613300020082Corn, Switchgrass And Miscanthus RhizosphereLPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDATLTPRRG
Ga0193706_120718823300021339SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKRG
Ga0193719_1047395223300021344SoilEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0247800_105542823300023263SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDAT
Ga0247794_1012875623300024055SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDAPKTDAATSNRR
Ga0207645_1020102733300025907Miscanthus RhizosphereMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG
Ga0207671_1048648923300025914Corn RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATPTPKRG
Ga0207660_1037980523300025917Corn RhizosphereMFQTSKYILPYEPGYTGHWEAETRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG
Ga0207662_1008700313300025918Switchgrass RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVAEMPVRDATLTPKRG
Ga0207691_1078597313300025940Miscanthus RhizosphereWQGAVVLTKEIPMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAVTPNRR
Ga0207658_1220564813300025986Switchgrass RhizosphereMLQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERD
Ga0207677_1166125823300026023Miscanthus RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRKREREIAAPSIVPEMPERDAALTPKRG
Ga0207703_1181273123300026035Switchgrass RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDATQTPRRG
Ga0207674_1073858623300026116Corn RhizosphereMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKDATLTPR
Ga0209813_1033168613300027866Populus EndosphereMFQTSRFILPYEPGYTGHWEAEKRRKETREWLRQRECEIAAPSIVPEMPEKGVTLTSKRG
Ga0209813_1035261733300027866Populus EndospherePYEPGYTGHWEAEKRRKETREWLRQRECEIAAPSIVPEMPERDATLTPKRG
Ga0307309_1021276313300028714SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAAL
Ga0307315_1012551813300028721SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKGSCS
Ga0307323_1015073613300028787SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRHRERDLAAPSIVPETPEKDAALTSK
Ga0307283_1005203923300028790SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEKEATLTPKPG
Ga0307283_1023155913300028790SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPETPEKDAALTSKGSCS
Ga0307294_1013192313300028810SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPAIVPETPEKDAALT
Ga0307286_1007376013300028876SoilTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVSEMPVRDATLTPKRG
Ga0307304_1005658813300028885SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPEMPEKEATLTP
Ga0308203_103026533300030829SoilSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKRS
Ga0308203_108385313300030829SoilFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSILPEIPVRDATLTPKRG
Ga0308205_101441913300030830SoilKEISMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0308205_105514313300030830SoilKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0308202_110075513300030902SoilFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDATLTPKHG
Ga0308202_115002513300030902SoilILPYEPGYTGHWEAAKRRKETREWLRQREREIAAPSIVPDLPERDATLTPKHG
Ga0308206_106336533300030903SoilLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKRS
Ga0308206_111575023300030903SoilILPYEPGYTGHWEAAKRRKETREWLRQREREIAAPSIVPDLPERDAPLTPKHG
Ga0308198_106452013300030904SoilPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0308200_104370933300030905SoilQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0308178_112891823300030990SoilQTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPEMPEKEATLTPKPG
Ga0308190_107347613300030993SoilKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0102760_1082984713300031039SoilTSKFILPYEPGYTGHWEAAKRRKETREWLRQREREIAAPSIVPDLPERDATLTPKHG
Ga0308189_1026211313300031058SoilEISMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKRS
Ga0308192_107230423300031082SoilEISMLKTSKFILPYEPGYRGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKRS
Ga0308201_1008891833300031091SoilSMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIMPEMPEKEATLTPKP
Ga0308204_1011806023300031092SoilFHTSKFILPYEPGYTGHWEAAKRRKETREWLRQREREIAAPSIVPDLPERDAPLTPKHG
Ga0308197_1010049213300031093SoilMLKTSKFILPYEPGYTGQWEAEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS
Ga0308187_1049333913300031114SoilFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDAALTSKGSCS
Ga0307501_1002281633300031152SoilATKKISMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPERDAPLMLKRG
Ga0307498_1013619323300031170SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDATLTSKRI
Ga0170824_11575995933300031231Forest SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDLAAPSIVPETPEKDATLTPKRI
Ga0307506_1019905433300031366SoilKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG
Ga0310887_1023686913300031547SoilFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0307468_10050301523300031740Hardwood Forest SoilMFQTSKFILPYEPGYTGHWEAERRRKETREWLRQREREIAAPSIVPEIPLRDATLTPKRG
Ga0310907_1067166823300031847SoilGAVVLTKEIPMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSDRR
Ga0310904_1009852823300031854SoilMFQTSKFILPYEPGYTGHWEAETRRKETREWLRQREREIAAPSIVPEIPVRDATLTPKRG
Ga0310902_1089303623300032012SoilMLKTSKFILPYEPGYTGHWEAEKRRKETREWLRQRERDIAAPSIVPDTPKTDAATSDRR
Ga0307470_1082484423300032174Hardwood Forest SoilMFQTSKFILPYEPKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSIVPEMPVRDATLTPKRG
Ga0370548_113431_86_2683300034644SoilMFQTSKFILPYEPGYTGHWEAEKRRKETREWLRQREREIAAPSVVPEMPERDAPLMLKRG
Ga0370541_051215_359_5413300034680SoilMLKTSKFILPYEPGYTGHWEVEKRRKETREWLRQRERDLAAPSIVPETPERDAALTSKRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.