Basic Information | |
---|---|
Family ID | F058260 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 42 residues |
Representative Sequence | MNMTRKLGLTVVAAALLTAYGCGKEEPKKAEAPKAP |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 97.04 % |
% of genes from short scaffolds (< 2000 bps) | 91.85 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.074 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (10.370 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.296 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.852 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF16576 | HlyD_D23 | 14.81 |
PF13533 | Biotin_lipoyl_2 | 13.33 |
PF00873 | ACR_tran | 2.96 |
PF00529 | CusB_dom_1 | 2.22 |
PF12700 | HlyD_2 | 1.48 |
PF01135 | PCMT | 0.74 |
PF01966 | HD | 0.74 |
PF02321 | OEP | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.74 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.07 % |
All Organisms | root | All Organisms | 45.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104639183 | Not Available | 600 | Open in IMG/M |
3300002912|JGI25386J43895_10154451 | Not Available | 573 | Open in IMG/M |
3300004066|Ga0055484_10046826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 943 | Open in IMG/M |
3300004282|Ga0066599_100151187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1194 | Open in IMG/M |
3300004479|Ga0062595_100969436 | Not Available | 726 | Open in IMG/M |
3300004778|Ga0062383_10280773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 794 | Open in IMG/M |
3300005328|Ga0070676_10980321 | Not Available | 633 | Open in IMG/M |
3300005347|Ga0070668_101349628 | Not Available | 649 | Open in IMG/M |
3300005364|Ga0070673_100843773 | Not Available | 847 | Open in IMG/M |
3300005437|Ga0070710_11076390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Alicycliphilus → Alicycliphilus denitrificans | 589 | Open in IMG/M |
3300005457|Ga0070662_101880365 | Not Available | 517 | Open in IMG/M |
3300005575|Ga0066702_10280624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1016 | Open in IMG/M |
3300005615|Ga0070702_101150747 | Not Available | 623 | Open in IMG/M |
3300005618|Ga0068864_101694317 | Not Available | 637 | Open in IMG/M |
3300005719|Ga0068861_102019780 | Not Available | 575 | Open in IMG/M |
3300005764|Ga0066903_105594515 | Not Available | 662 | Open in IMG/M |
3300005764|Ga0066903_105928041 | Not Available | 641 | Open in IMG/M |
3300005841|Ga0068863_100308323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1536 | Open in IMG/M |
3300006224|Ga0079037_100005929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7418 | Open in IMG/M |
3300006358|Ga0068871_101475420 | Not Available | 642 | Open in IMG/M |
3300006603|Ga0074064_11392615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 681 | Open in IMG/M |
3300006605|Ga0074057_10329322 | Not Available | 536 | Open in IMG/M |
3300006796|Ga0066665_10459765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1049 | Open in IMG/M |
3300006806|Ga0079220_10912390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 683 | Open in IMG/M |
3300006881|Ga0068865_100860126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 786 | Open in IMG/M |
3300007521|Ga0105044_10206957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1976 | Open in IMG/M |
3300009009|Ga0105105_10451287 | Not Available | 726 | Open in IMG/M |
3300009111|Ga0115026_11406562 | Not Available | 577 | Open in IMG/M |
3300009147|Ga0114129_10613609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1408 | Open in IMG/M |
3300009165|Ga0105102_10603684 | Not Available | 607 | Open in IMG/M |
3300009176|Ga0105242_12543111 | Not Available | 560 | Open in IMG/M |
3300009667|Ga0116147_1355512 | Not Available | 545 | Open in IMG/M |
3300010043|Ga0126380_10881184 | Not Available | 741 | Open in IMG/M |
3300010359|Ga0126376_12851434 | Not Available | 533 | Open in IMG/M |
3300010397|Ga0134124_11413891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 722 | Open in IMG/M |
3300010397|Ga0134124_11628673 | Not Available | 676 | Open in IMG/M |
3300010397|Ga0134124_12713759 | Not Available | 539 | Open in IMG/M |
3300010429|Ga0116241_10060622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3441 | Open in IMG/M |
3300012285|Ga0137370_10391949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 840 | Open in IMG/M |
3300012356|Ga0137371_10775972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 731 | Open in IMG/M |
3300012361|Ga0137360_11856715 | Not Available | 508 | Open in IMG/M |
3300012499|Ga0157350_1059875 | Not Available | 504 | Open in IMG/M |
3300012917|Ga0137395_10465066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 909 | Open in IMG/M |
3300013297|Ga0157378_11781239 | Not Available | 664 | Open in IMG/M |
3300013306|Ga0163162_10487982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1363 | Open in IMG/M |
3300013306|Ga0163162_13487834 | Not Available | 500 | Open in IMG/M |
3300014318|Ga0075351_1125749 | Not Available | 583 | Open in IMG/M |
3300014319|Ga0075348_1078405 | Not Available | 803 | Open in IMG/M |
3300014323|Ga0075356_1178463 | Not Available | 561 | Open in IMG/M |
3300014326|Ga0157380_10262602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1569 | Open in IMG/M |
3300014968|Ga0157379_11324286 | Not Available | 696 | Open in IMG/M |
3300015162|Ga0167653_1072953 | Not Available | 568 | Open in IMG/M |
3300015371|Ga0132258_10627976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2699 | Open in IMG/M |
3300015373|Ga0132257_101758250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 796 | Open in IMG/M |
3300015374|Ga0132255_102943876 | Not Available | 727 | Open in IMG/M |
3300015374|Ga0132255_103279329 | Not Available | 690 | Open in IMG/M |
3300017792|Ga0163161_11836913 | Not Available | 539 | Open in IMG/M |
3300017973|Ga0187780_10499038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 869 | Open in IMG/M |
3300018075|Ga0184632_10367031 | Not Available | 612 | Open in IMG/M |
3300018429|Ga0190272_11386789 | Not Available | 706 | Open in IMG/M |
3300018481|Ga0190271_13564149 | Not Available | 521 | Open in IMG/M |
3300021080|Ga0210382_10183952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 904 | Open in IMG/M |
3300022213|Ga0224500_10006350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5674 | Open in IMG/M |
3300025106|Ga0209398_1168888 | Not Available | 504 | Open in IMG/M |
3300025315|Ga0207697_10385031 | Not Available | 623 | Open in IMG/M |
3300025664|Ga0208849_1077696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 953 | Open in IMG/M |
3300025679|Ga0207933_1019332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2940 | Open in IMG/M |
3300025689|Ga0209407_1210848 | Not Available | 512 | Open in IMG/M |
3300025905|Ga0207685_10167603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1008 | Open in IMG/M |
3300025907|Ga0207645_10241984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1192 | Open in IMG/M |
3300025925|Ga0207650_11363502 | Not Available | 603 | Open in IMG/M |
3300025930|Ga0207701_11725083 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300025931|Ga0207644_11885467 | Not Available | 500 | Open in IMG/M |
3300025940|Ga0207691_11603526 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300025986|Ga0207658_10211554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1625 | Open in IMG/M |
3300026041|Ga0207639_11355102 | Not Available | 668 | Open in IMG/M |
3300026067|Ga0207678_10399261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1190 | Open in IMG/M |
3300026118|Ga0207675_100178925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2030 | Open in IMG/M |
3300026118|Ga0207675_101754146 | Not Available | 640 | Open in IMG/M |
3300026343|Ga0209159_1100237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1262 | Open in IMG/M |
3300026547|Ga0209156_10452843 | Not Available | 531 | Open in IMG/M |
3300027735|Ga0209261_10089132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 796 | Open in IMG/M |
3300027818|Ga0209706_10268153 | Not Available | 815 | Open in IMG/M |
3300027885|Ga0209450_10625989 | Not Available | 785 | Open in IMG/M |
3300027897|Ga0209254_10287314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1265 | Open in IMG/M |
3300028536|Ga0137415_10588887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 923 | Open in IMG/M |
3300028590|Ga0247823_11013197 | Not Available | 623 | Open in IMG/M |
3300028679|Ga0302169_10124472 | Not Available | 636 | Open in IMG/M |
3300028870|Ga0302254_10021131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2259 | Open in IMG/M |
3300028870|Ga0302254_10154483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 843 | Open in IMG/M |
3300029923|Ga0311347_10104714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1760 | Open in IMG/M |
3300029990|Ga0311336_10506963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1022 | Open in IMG/M |
3300030010|Ga0302299_10361987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 746 | Open in IMG/M |
3300030838|Ga0311335_10870427 | Not Available | 639 | Open in IMG/M |
3300030943|Ga0311366_11172475 | Not Available | 662 | Open in IMG/M |
3300031679|Ga0318561_10760031 | Not Available | 532 | Open in IMG/M |
3300031720|Ga0307469_10747379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 892 | Open in IMG/M |
3300031726|Ga0302321_100305553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1703 | Open in IMG/M |
3300031726|Ga0302321_102118191 | Not Available | 654 | Open in IMG/M |
3300031740|Ga0307468_101401181 | Not Available | 642 | Open in IMG/M |
3300031740|Ga0307468_101500125 | Not Available | 625 | Open in IMG/M |
3300031740|Ga0307468_102172357 | Not Available | 536 | Open in IMG/M |
3300031763|Ga0318537_10050456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1509 | Open in IMG/M |
3300031769|Ga0318526_10232379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 754 | Open in IMG/M |
3300031820|Ga0307473_11392980 | Not Available | 528 | Open in IMG/M |
3300031847|Ga0310907_10419521 | Not Available | 701 | Open in IMG/M |
3300031854|Ga0310904_10108451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1540 | Open in IMG/M |
3300031873|Ga0315297_10325943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1283 | Open in IMG/M |
3300031918|Ga0311367_10181103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2210 | Open in IMG/M |
3300032009|Ga0318563_10671202 | Not Available | 557 | Open in IMG/M |
3300032053|Ga0315284_10814751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1078 | Open in IMG/M |
3300032143|Ga0315292_11295042 | Not Available | 596 | Open in IMG/M |
3300032156|Ga0315295_10160395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
3300032156|Ga0315295_10866124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
3300032164|Ga0315283_10105682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2951 | Open in IMG/M |
3300032164|Ga0315283_11492157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 693 | Open in IMG/M |
3300032164|Ga0315283_11863217 | Not Available | 603 | Open in IMG/M |
3300032164|Ga0315283_12104660 | Not Available | 558 | Open in IMG/M |
3300032256|Ga0315271_10101819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2186 | Open in IMG/M |
3300032256|Ga0315271_10156666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1790 | Open in IMG/M |
3300032256|Ga0315271_11588150 | Not Available | 563 | Open in IMG/M |
3300032401|Ga0315275_10640547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1185 | Open in IMG/M |
3300032516|Ga0315273_12329434 | Not Available | 624 | Open in IMG/M |
3300033004|Ga0335084_11186217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 763 | Open in IMG/M |
3300033408|Ga0316605_11452172 | Not Available | 665 | Open in IMG/M |
3300033418|Ga0316625_101110084 | Not Available | 715 | Open in IMG/M |
3300033418|Ga0316625_102118897 | Not Available | 557 | Open in IMG/M |
3300033419|Ga0316601_100834584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 913 | Open in IMG/M |
3300033419|Ga0316601_101050559 | Not Available | 814 | Open in IMG/M |
3300033419|Ga0316601_101090238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 799 | Open in IMG/M |
3300033482|Ga0316627_102358552 | Not Available | 559 | Open in IMG/M |
3300033483|Ga0316629_10809761 | Not Available | 720 | Open in IMG/M |
3300033487|Ga0316630_11171588 | Not Available | 680 | Open in IMG/M |
3300033521|Ga0316616_102300693 | Not Available | 719 | Open in IMG/M |
3300034156|Ga0370502_0041013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1456 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.15% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.70% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.22% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.22% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.22% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.96% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.48% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.48% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.48% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.74% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.74% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.74% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.74% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.74% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010429 | AD_USRAca | Engineered | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1046391833 | 3300000364 | Soil | MIMTKKLGLTLVAAALISVYGCSKEEPKKAAEAPKAPA |
JGI25386J43895_101544512 | 3300002912 | Grasslands Soil | MTLNRSFGLSLVAAALLAAYGCGKEEPKQAATPAPAAAPAMPEMTVKV |
Ga0055484_100468261 | 3300004066 | Natural And Restored Wetlands | MNLNKFGLTLVASAVVALNGCGKEEPKKAEAPKAAPAAPAA |
Ga0066599_1001511871 | 3300004282 | Freshwater | MTKSRQLGLTLVAAALVALYGCGKEEPKKAEAPKAAAPVEESVTVK |
Ga0062595_1009694362 | 3300004479 | Soil | LPNPYLEDSMDMSRKLGLTIVAAALISIYGCGKEEPKKSAEAPKTTA |
Ga0062383_102807731 | 3300004778 | Wetland Sediment | MNMTRKLGLTAIAAALVTFYGCGKEEPKKAEAPKAPVEEVLVVKIGHAG |
Ga0070676_109803212 | 3300005328 | Miscanthus Rhizosphere | MNKTRTLGLSLVAAALMVAYGCGKEEPKKAAEAPKAAPPPAPVEEVV |
Ga0070668_1013496281 | 3300005347 | Switchgrass Rhizosphere | MNMTRAFGLTIVAAALFTAYGCGKEEPKKAAEAPKAAPAAP |
Ga0070673_1008437732 | 3300005364 | Switchgrass Rhizosphere | LPNPNFEDLMDMSRKLGLTIVAAALITVYGCGKEEPKKAAEAPKAA |
Ga0070710_110763901 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLNRSFGLSLVAAALLAAYGCGKEEPKQAATPAPAAAPAMP |
Ga0070662_1018803651 | 3300005457 | Corn Rhizosphere | MIMTKKLGLTFVAAALIAVYGCSKEEPKKTAEAAKPAPAAEEVVTVKIGHA |
Ga0066702_102806242 | 3300005575 | Soil | MKFNRSLGLTFVAAALVTAYGCGKEEPKKVEAPATAGAPAMP |
Ga0070702_1011507472 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLSKKLGLTLFAAALATTYGCGKEEPKKADAPKAAAAADD |
Ga0068864_1016943172 | 3300005618 | Switchgrass Rhizosphere | MNITKKLGLSLIAAALVTVYGCSKEEPKKADAPKAAADDSVTVKIGH |
Ga0068861_1020197802 | 3300005719 | Switchgrass Rhizosphere | MNKTRTLGLSLVAAALMVAYGCSKEEPKKTAEAPK |
Ga0066903_1055945151 | 3300005764 | Tropical Forest Soil | MNVTHKLGLTVVAAAVFALYGCGKEEPKKAEAPKAPTAAAEDVQVVKIGHA |
Ga0066903_1059280412 | 3300005764 | Tropical Forest Soil | MNLTRKLGVTLVAAALATVYGCSKEEPKKAAEAVKAPAPPPEETVTVKIGHAGP |
Ga0068863_1003083231 | 3300005841 | Switchgrass Rhizosphere | MNVTHKLGLTVVAAAVLALYGCGKEEPKKAEAPKAAAEDVM |
Ga0079037_1000059291 | 3300006224 | Freshwater Wetlands | MNHLSKLGLTLVASAVVALYGCGKEEPKKAEAPKAA |
Ga0068871_1014754202 | 3300006358 | Miscanthus Rhizosphere | MNMSRKLGLTVVAAALITVYGCGKDEPKKSAEAPKTTAAAPADD |
Ga0074064_113926152 | 3300006603 | Soil | MTLTKKLGLTLVAAALFTAYGCGKEEPKKAETAKAP |
Ga0074057_103293222 | 3300006605 | Soil | MNMSRKLGLTIIAAALISVYGCGKEEPKKAAEAPKAAAPAEDVVTVKI |
Ga0066665_104597652 | 3300006796 | Soil | MTLNRPLGLSLVAAALLAVYGCGKEEPKPVAPAAAPAMPEMTVKIGHV |
Ga0079220_109123901 | 3300006806 | Agricultural Soil | MRFNRTLGLTLVAAALMTAYGCGKEEPKKAAEAPAAAP |
Ga0068865_1008601261 | 3300006881 | Miscanthus Rhizosphere | MNMSRKLGLTIVTAALFTMYGCGKEEPKKAAEAPKAAPAAAP |
Ga0105044_102069573 | 3300007521 | Freshwater | MNMSKKLGLTLVAAALVTVYGCSKEEPKKAEAPKAPVEEVV |
Ga0105105_104512871 | 3300009009 | Freshwater Sediment | MNTPSKFGLTLVPVAIATLVGCGKEEPKKDEAPKAPAAPVE* |
Ga0115026_114065621 | 3300009111 | Wetland | MNLSRKLGLSLVAAALVTAYGCSKEEPKKAEAPKAPDEEVVTV |
Ga0114129_106136091 | 3300009147 | Populus Rhizosphere | MTFTRKLAVALIGAALITAYGCGKEEPKKAAEAPKAAPAAPAE |
Ga0105102_106036842 | 3300009165 | Freshwater Sediment | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKADAEKPAE* |
Ga0105242_125431111 | 3300009176 | Miscanthus Rhizosphere | MKIAHTLGLTLISAALVTVYGCGKEESKKAEAPKAGTTAAAP |
Ga0116147_13555121 | 3300009667 | Anaerobic Digestor Sludge | MNISKTLGLTLVAAALITAYGCGKKEEPKKAEAPKAEEA |
Ga0126380_108811842 | 3300010043 | Tropical Forest Soil | MRINRSLGLTLVAAALVVAYGCGKEEAPKQAAAPAATPAP |
Ga0126376_128514341 | 3300010359 | Tropical Forest Soil | MTFNRSFGLSLVAAALLTVYGCGKEEPAKQQAAAPAAPPPAPEVSVK |
Ga0134124_114138911 | 3300010397 | Terrestrial Soil | MNITKKLGLSLIAAALVTVYGCSKEEPKKADAPKA |
Ga0134124_116286732 | 3300010397 | Terrestrial Soil | MNMTRAFGLTIVAAALFTAYGCGKEEPKKAAEAPKAAPAAPAEEVVTVKI |
Ga0134124_127137592 | 3300010397 | Terrestrial Soil | MNMNRKLGLSLVAAALVTFYGCGKEEPKKADSPKTRAPP |
Ga0116241_100606223 | 3300010429 | Anaerobic Digestor Sludge | MNITRKLGLTLVAAALVTVYGCGKKEEPKKAEAPKAEEAVASRSATRVR* |
Ga0137370_103919492 | 3300012285 | Vadose Zone Soil | MRFNRSLGLTFVAAALVTAYGCGKEELQKVEAPPTAGAPPMPKG |
Ga0137371_107759722 | 3300012356 | Vadose Zone Soil | MRLNRLLGLTIVAAALVTAYGCGKEEPKKVEAPATAAAPAMPEAVVKI |
Ga0137360_118567151 | 3300012361 | Vadose Zone Soil | MTLNRPLGLSLVAAALLAVYGCGKEEPKTVAPAAAPAMPEVTVKIGHV |
Ga0157350_10598751 | 3300012499 | Unplanted Soil | MTLNRSLGLTLVAAALLAAYGCGKEEPKKVETAAPSAAP |
Ga0137395_104650662 | 3300012917 | Vadose Zone Soil | MILNRSLGLTIVAAAFVTAYGCGKEEPKKVEAPATAAAPAMPE |
Ga0157378_117812391 | 3300013297 | Miscanthus Rhizosphere | MNKTRTLGLSLVAAALMVAYGCSKEEPQKAAEAPKTTAPPPAPVEEVVTVKI |
Ga0163162_104879821 | 3300013306 | Switchgrass Rhizosphere | MNINRNLGLTLVAAALVTFYGCGKEEPKKAEAPKAAAPPAEEV |
Ga0163162_134878341 | 3300013306 | Switchgrass Rhizosphere | MNMTTKLGLTLVSAALMSAYGCGKEEPKKAAEAPKAVAPAAP |
Ga0075351_11257491 | 3300014318 | Natural And Restored Wetlands | MNMSRKLGLTVVAAALVTFYGCGKEEPKKAEAPKAPVED |
Ga0075348_10784051 | 3300014319 | Natural And Restored Wetlands | MNMSRKLGLTAIAAALITFYGCGKEEPKKAEAPKAPPAPVEEVVV |
Ga0075356_11784632 | 3300014323 | Natural And Restored Wetlands | MKTTHKLGLTILAAALMTAYGCGKEEPKKAEAPKAPAEEVVVVKIGHA |
Ga0157380_102626021 | 3300014326 | Switchgrass Rhizosphere | MTLSKKLGLTLFAAALATAYGCGKEEAKKADAPKAAAPAEDVVVVKIGH |
Ga0157379_113242862 | 3300014968 | Switchgrass Rhizosphere | MKIAQKLGLTLISAALVTVYGCGKEESKKAEAPKAGTTAAAPA |
Ga0167653_10729531 | 3300015162 | Glacier Forefield Soil | MRLDRSLGLTLVAAALATAYGCGKEEPKKVDAPAVSAAPATPESVVKI |
Ga0132258_106279761 | 3300015371 | Arabidopsis Rhizosphere | MNMSRKLGLTIVAAALITAYGCGKEEPKKSAEAPKAAAAPAEEV |
Ga0132257_1017582502 | 3300015373 | Arabidopsis Rhizosphere | MNVTHKLGLTVVAAAVLALYGCGKEEPKKAEAPKAPA |
Ga0132255_1029438761 | 3300015374 | Arabidopsis Rhizosphere | MKVTHQLGLTVVAAAVFALYGCGKEEPKKAEAPKAPAAAAA |
Ga0132255_1032793291 | 3300015374 | Arabidopsis Rhizosphere | MNVTHKLGLTVVAAAVLALYGCGKEEPKKAEAPKAGAPAAAAAEDVTVVKI |
Ga0163161_118369131 | 3300017792 | Switchgrass Rhizosphere | MKIAHTLGLTLISAALVTVYGCGKEESKKAEAPKAGTTAAAPAEETV |
Ga0187780_104990382 | 3300017973 | Tropical Peatland | MRINRSLGLTLVAAALAVAYGCGKEEPAKQAAAPAA |
Ga0184632_103670312 | 3300018075 | Groundwater Sediment | MTLSKKLGLTLIAAALATAYGCGKEEPKKAEAPKAPVE |
Ga0190272_113867891 | 3300018429 | Soil | MIMTKKLGLTLVAAALISVYGCSKEEPKKAAEAPKAPPAEAVT |
Ga0190271_135641491 | 3300018481 | Soil | MNMSKKLGLTLVAAALVTMYGCSKEEPKKAEAPKAPVVAA |
Ga0210382_101839522 | 3300021080 | Groundwater Sediment | MRLNRSLGLTIVAAALVTAYGCGKEEPKKVEAPATAAAPAMPEAVVKI |
Ga0224500_100063501 | 3300022213 | Sediment | MNMSRKLGLTAIAAALITFYGCGKEEPKKAEAPKAPPA |
Ga0209398_11688881 | 3300025106 | Groundwater | MTHLSKLGLTLVASAVVALYGCGKEEPKKAEAPKAPAAPVAEVIVV |
Ga0207697_103850311 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMTKKLGLTLVAAALISVYGCSKEEPKKAAEAPKAPAAEAVTTVKI |
Ga0208849_10776962 | 3300025664 | Arctic Peat Soil | MNVSHKLGLSLVAAALLTVYGCSNKEEPKTAAVAPAPADDSATVT |
Ga0207933_10193321 | 3300025679 | Arctic Peat Soil | MNVSHKLGLSLVAAALLTVYGCSNKEEPKTAAVAPAPADDSVTVTI |
Ga0209407_12108481 | 3300025689 | Anaerobic Digestor Sludge | MNISKTLGLTLVAAALITAYGCGKKEEPKKAEAPKAE |
Ga0207685_101676031 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFNRTLGLTLVAAALMTAYGCGKEEPKKAAEAPAATPAAPAAPGVV |
Ga0207645_102419841 | 3300025907 | Miscanthus Rhizosphere | MDMSRKLGLTIVAAALITIYGCGKEEPKKSAEAPKTTAAA |
Ga0207650_113635022 | 3300025925 | Switchgrass Rhizosphere | MKIAHTLGLTLISAALVTVYGCGKEESKKAEAPKAGTTAAA |
Ga0207701_117250831 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MIMTKKLGLTLVAAALISVYGCSKEEPKKAAEAPKAKPQRRRAAAGA |
Ga0207644_118854671 | 3300025931 | Switchgrass Rhizosphere | MNKTHTLGLSLVAAALMVAYGCSKEEPKKAAEAPKTTAPPPAP |
Ga0207691_116035261 | 3300025940 | Miscanthus Rhizosphere | MRMSRQLGLTLVAATLLAVYGCSKTEEPKKAAEAPTPAPAAAPPAEETVTVKIG |
Ga0207658_102115541 | 3300025986 | Switchgrass Rhizosphere | MRFNRTLGLTLVAAALMTAYGCGKEEPKKAAEAPAAAPAA |
Ga0207639_113551021 | 3300026041 | Corn Rhizosphere | MDMSRKLGLTIVAAALITAYGCGKEEPKKSAEAPKAA |
Ga0207678_103992611 | 3300026067 | Corn Rhizosphere | MRFNRTLGLTLVAAALMTAYGCGKEEPKKAAEAPAATPAAPAAPGVVVK |
Ga0207675_1001789253 | 3300026118 | Switchgrass Rhizosphere | MNTNTKLGLSLVAAALVTIYGCGKEEAKKAEAPKAPAAPAEETVTVK |
Ga0207675_1017541461 | 3300026118 | Switchgrass Rhizosphere | MNKTRTLGLSLVAAALMVAYGCSKEEPKKTAEAPKTTAAP |
Ga0209159_11002372 | 3300026343 | Soil | MTLNRSFGLSLVAAALLAAYGCGKEEPKQAATPAATPTAPAAPEMT |
Ga0209156_104528431 | 3300026547 | Soil | MTLNRPLGLSLVAAALLAVYGCGKEEPKPVAPTAAPA |
Ga0209261_100891321 | 3300027735 | Wetland Sediment | MNTPRMLGLTLVAAALATFYGCGKEEPKKAEAPKAA |
Ga0209706_102681531 | 3300027818 | Freshwater Sediment | MTLNKIGLTLVASAVVALYGCGQEQPKQAQAPAAPAAPAAPV |
Ga0209450_106259892 | 3300027885 | Freshwater Lake Sediment | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKAAPAAPVEEVV |
Ga0209254_102873141 | 3300027897 | Freshwater Lake Sediment | MTLNKIGLTLIASAVVALYGCGQEQPKQQAKAPAAPAAP |
Ga0137415_105888871 | 3300028536 | Vadose Zone Soil | MTINRSLGLSLVAAALLAAYGCGKEEPKQAATPAPAPAATP |
Ga0247823_110131972 | 3300028590 | Soil | MNLGTNHRNIGLTLVAAALVTVYGCGKEEPKKAEAPKTTTAPAA |
Ga0302169_101244721 | 3300028679 | Fen | MTLSRKLGLTIIAAALATAYGCGKEEPKKAEAPKAPVEEVVVVKIG |
Ga0302254_100211313 | 3300028870 | Fen | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKA |
Ga0302254_101544832 | 3300028870 | Fen | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKAPVEDVVVVKI |
Ga0311347_101047143 | 3300029923 | Fen | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKAPVEEVVVVKIDHAGP |
Ga0311336_105069631 | 3300029990 | Fen | MTLSRKLGLTIIAAALATAYGCGKEEPKKAEAPKA |
Ga0302299_103619872 | 3300030010 | Fen | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKAPVEEVVV |
Ga0311335_108704272 | 3300030838 | Fen | MTLSKKLGLTILAAALATAYGCGKEEAKKAEAPKAP |
Ga0311366_111724752 | 3300030943 | Fen | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKAP |
Ga0318561_107600311 | 3300031679 | Soil | MRMNRSLGLTLVAAALVVAYGCGKEEPAKSAAPTAAAP |
Ga0307469_107473792 | 3300031720 | Hardwood Forest Soil | MTLNRSFGLSLVAAALLAAYGCGKEEPKQAATPAPA |
Ga0302321_1003055533 | 3300031726 | Fen | MTLSRKLGLTIIAAALATAYGCGKEEPKKAEAAKA |
Ga0302321_1021181912 | 3300031726 | Fen | MTLSKKLGLTLLAAALATAYGCGKEEPKKAAEAPKAPVEE |
Ga0307468_1014011811 | 3300031740 | Hardwood Forest Soil | MNTQSKLGLTVLAAALVTFYGCGKEEPKKAEAPKAAAAPAAPAE |
Ga0307468_1015001252 | 3300031740 | Hardwood Forest Soil | MNMSRKLGLTIVAAALITVYGCGKEEPKKAAEAPKTAPAAAP |
Ga0307468_1021723571 | 3300031740 | Hardwood Forest Soil | MKIAHKLGLTLISAALLTVYGCGKEEPKKAADAPKAPAA |
Ga0318537_100504562 | 3300031763 | Soil | MQVTKQLGLTLIAAALLAAYGCGQKEEPKKAAEAPKAAPAEETITV |
Ga0318526_102323791 | 3300031769 | Soil | MQVTKQLGLTLIAAALLAAYGCGQKEEPKKAAEAPKAAPAEETITVKIG |
Ga0307473_113929801 | 3300031820 | Hardwood Forest Soil | MRINRSLGLTLVASALLVAYGCGKEEAPKQAAAPAAAPA |
Ga0310907_104195211 | 3300031847 | Soil | MNISKKLGVTLVAAALITAYGCGKEEPKKAAAPAAVDDSVTVKIG |
Ga0310904_101084512 | 3300031854 | Soil | MNLAQKFGVTLVAAALVTAYGCGKEEPKKAAEAPKAAAPAPADDSVTVKI |
Ga0315297_103259432 | 3300031873 | Sediment | MNITHKLGLSLVAAALVTFYGCGKEEPKKAEAPKAVDDTVTVKIGH |
Ga0311367_101811031 | 3300031918 | Fen | MTLSRKLGLTIIAAALATAYGCGKEEPKKAEAAKAPM |
Ga0318563_106712021 | 3300032009 | Soil | MKNVHKLGLTLISAALVTVYGCGKEEPKKAAEAPKA |
Ga0315284_108147511 | 3300032053 | Sediment | MNMSRKLGLTAIAAALVTFYGCGKEEPKKAEAPKAPVEEVLVV |
Ga0315292_112950421 | 3300032143 | Sediment | MNMSRKLGLTAIAAALVTFYGCGKEEPKKAEAPKAPVEEVLVVKIGH |
Ga0315295_101603953 | 3300032156 | Sediment | MNMSRKLGLTAIAAALITFYGCGKEEPKKAEAPKAP |
Ga0315295_108661241 | 3300032156 | Sediment | MNMSRKLGLTAIAAALVTFYGCGKEEPKKAEAPKAPVEEVL |
Ga0315283_101056821 | 3300032164 | Sediment | MNMSRKLGLTAIAAALVTFYGCGKEEPKKAEAPKASVEEVLVVKIG |
Ga0315283_114921571 | 3300032164 | Sediment | MTLSKKLGLTLIAAALATAYGCGKEEPKKVEAPKAAA |
Ga0315283_118632172 | 3300032164 | Sediment | MNMTRKLGLTVVAAALVTFYGCGKEEPKKAEAPKAPAEEVVVVKIGPA |
Ga0315283_121046602 | 3300032164 | Sediment | MNMTRTLGLSLVAAALMTAYGCGKEEPKKAAEAPKAAAPAEEVV |
Ga0315271_101018193 | 3300032256 | Sediment | MIMSKKLGLTLVAAALVSFYGCSKEEPKKVEAPKAPVEDVVVVKIGH |
Ga0315271_101566663 | 3300032256 | Sediment | MNMTHKLGLTLVAAALMTAYGCGKEEPKKAAEAPKAAAPA |
Ga0315271_115881502 | 3300032256 | Sediment | MNLSKKLGLTLVAAALATAYGCGKEEPKKAEAPKAAVEDVMV |
Ga0315275_106405471 | 3300032401 | Sediment | MNMTRKLGLTLVAAALMTAYGCGKEEPKKAAEAPKAAPPAEE |
Ga0315273_123294342 | 3300032516 | Sediment | MTLSRKLGLTIIAAALATAYGCGKEEPKKAEAPKAPV |
Ga0335084_111862171 | 3300033004 | Soil | MNLTRKLGVTLVAAALATVYGCSKEEPKKAAEAPKAAPPAEEVVTVKI |
Ga0316605_114521721 | 3300033408 | Soil | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKAAPAA |
Ga0316625_1011100841 | 3300033418 | Soil | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKAAPA |
Ga0316625_1021188972 | 3300033418 | Soil | MNMTHKLGLTVLAAALVTFYGCGKEEPKKAEAPKAA |
Ga0316601_1008345842 | 3300033419 | Soil | MNMTRKLGLTVVAAALLTAYGCGKEEPKKAEAPKAP |
Ga0316601_1010505591 | 3300033419 | Soil | MNTPNKFGLTLVAFAIATLVGCGKEEPKKAEAPKAAAPVEEVIVVK |
Ga0316601_1010902383 | 3300033419 | Soil | MNMTPKLGLTILAAALMTAYGCGKEEPKKAEAPKAPAA |
Ga0316627_1023585521 | 3300033482 | Soil | MNMTPKLGLTILAAALMTAYGCGKEEPKKAEAPKAPAAPVAEVVTV |
Ga0316629_108097612 | 3300033483 | Soil | MTKTRQLGLTLIAAALVAMYGCGKDEPKKAEAPKAAAPVEESV |
Ga0316630_111715881 | 3300033487 | Soil | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKAAPAAPVEEVVTIKL |
Ga0316616_1023006932 | 3300033521 | Soil | MTLNKIGLTLIASAVVALYGCGKEEPKKAEAPKAAPAAP |
Ga0370502_0041013_1304_1456 | 3300034156 | Untreated Peat Soil | MTLSKKLGLTILAAALATAYGCGKEEPKKAEAPKAPVEEVVVVKIGHAGPL |
⦗Top⦘ |