| Basic Information | |
|---|---|
| Family ID | F058251 |
| Family Type | Metagenome |
| Number of Sequences | 135 |
| Average Sequence Length | 49 residues |
| Representative Sequence | APLEQNVQAALSFTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.48 % |
| % of genes near scaffold ends (potentially truncated) | 91.11 % |
| % of genes from short scaffolds (< 2000 bps) | 91.85 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.889 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.074 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.74% β-sheet: 0.00% Coil/Unstructured: 55.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 10.37 |
| PF13483 | Lactamase_B_3 | 9.63 |
| PF00117 | GATase | 4.44 |
| PF07690 | MFS_1 | 4.44 |
| PF13379 | NMT1_2 | 3.70 |
| PF01192 | RNA_pol_Rpb6 | 3.70 |
| PF01844 | HNH | 2.96 |
| PF08867 | FRG | 2.22 |
| PF09722 | Xre_MbcA_ParS_C | 1.48 |
| PF04909 | Amidohydro_2 | 1.48 |
| PF00248 | Aldo_ket_red | 1.48 |
| PF00596 | Aldolase_II | 1.48 |
| PF01402 | RHH_1 | 1.48 |
| PF04014 | MazE_antitoxin | 0.74 |
| PF00857 | Isochorismatase | 0.74 |
| PF03330 | DPBB_1 | 0.74 |
| PF02436 | PYC_OADA | 0.74 |
| PF01850 | PIN | 0.74 |
| PF03235 | DUF262 | 0.74 |
| PF02743 | dCache_1 | 0.74 |
| PF01717 | Meth_synt_2 | 0.74 |
| PF00271 | Helicase_C | 0.74 |
| PF06831 | H2TH | 0.74 |
| PF01118 | Semialdhyde_dh | 0.74 |
| PF11860 | Muramidase | 0.74 |
| PF08281 | Sigma70_r4_2 | 0.74 |
| PF05016 | ParE_toxin | 0.74 |
| PF00501 | AMP-binding | 0.74 |
| PF02604 | PhdYeFM_antitox | 0.74 |
| PF00398 | RrnaAD | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 10.37 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 10.37 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 3.70 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.74 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.74 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.74 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.74 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.74 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.74 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.74 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.89 % |
| Unclassified | root | N/A | 11.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13177608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10084020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 795 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1007810 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300000787|JGI11643J11755_11543937 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300000881|JGI10215J12807_1358378 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1061700 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300000955|JGI1027J12803_100495979 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300000955|JGI1027J12803_106938457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300001139|JGI10220J13317_12329003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas cavernicola | 992 | Open in IMG/M |
| 3300002155|JGI24033J26618_1055908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300002243|C687J29039_10257858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300004808|Ga0062381_10425226 | Not Available | 514 | Open in IMG/M |
| 3300005294|Ga0065705_10335945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300005295|Ga0065707_10808704 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005334|Ga0068869_100244444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1431 | Open in IMG/M |
| 3300005338|Ga0068868_101369073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300005356|Ga0070674_100219753 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300005365|Ga0070688_101011746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300005434|Ga0070709_11090675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300005440|Ga0070705_101721271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 530 | Open in IMG/M |
| 3300005445|Ga0070708_100574346 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005518|Ga0070699_100216672 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300005563|Ga0068855_100187326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2336 | Open in IMG/M |
| 3300005713|Ga0066905_100064533 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300005713|Ga0066905_100507246 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300005764|Ga0066903_106492940 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005841|Ga0068863_101894002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300006224|Ga0079037_101309651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 721 | Open in IMG/M |
| 3300006755|Ga0079222_10045898 | All Organisms → cellular organisms → Bacteria | 1994 | Open in IMG/M |
| 3300006794|Ga0066658_10550932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300006806|Ga0079220_10603010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300006806|Ga0079220_11539851 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006852|Ga0075433_10261703 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300006854|Ga0075425_100825523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera | 1062 | Open in IMG/M |
| 3300006871|Ga0075434_100298817 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300006871|Ga0075434_101055074 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300006871|Ga0075434_101757548 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006904|Ga0075424_102306817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300007076|Ga0075435_100693087 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300009053|Ga0105095_10827647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300009100|Ga0075418_11876549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300009137|Ga0066709_102423812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300009148|Ga0105243_10444441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1215 | Open in IMG/M |
| 3300009148|Ga0105243_12836378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300009792|Ga0126374_10689424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300010029|Ga0105074_1054224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300010047|Ga0126382_11358731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300010326|Ga0134065_10028544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1623 | Open in IMG/M |
| 3300010362|Ga0126377_10181437 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300010366|Ga0126379_10435249 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300010375|Ga0105239_10182112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2351 | Open in IMG/M |
| 3300010399|Ga0134127_12762828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300010403|Ga0134123_12912253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300011427|Ga0137448_1010833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1934 | Open in IMG/M |
| 3300011432|Ga0137428_1150484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300011438|Ga0137451_1053513 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300012040|Ga0137461_1130349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300012167|Ga0137319_1118857 | Not Available | 529 | Open in IMG/M |
| 3300012200|Ga0137382_10644515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300012210|Ga0137378_10317310 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300012211|Ga0137377_10229438 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300012228|Ga0137459_1062183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300012355|Ga0137369_10292333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300012582|Ga0137358_11061399 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012912|Ga0157306_10129480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300012971|Ga0126369_11125585 | Not Available | 874 | Open in IMG/M |
| 3300012976|Ga0134076_10471472 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012985|Ga0164308_10376706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1153 | Open in IMG/M |
| 3300012987|Ga0164307_10729963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300013308|Ga0157375_10513609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1362 | Open in IMG/M |
| 3300014296|Ga0075344_1033723 | Not Available | 859 | Open in IMG/M |
| 3300014315|Ga0075350_1084664 | Not Available | 731 | Open in IMG/M |
| 3300014745|Ga0157377_11067319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300014870|Ga0180080_1101366 | Not Available | 512 | Open in IMG/M |
| 3300014883|Ga0180086_1015691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 1653 | Open in IMG/M |
| 3300014968|Ga0157379_11070665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300015052|Ga0137411_1039077 | Not Available | 1149 | Open in IMG/M |
| 3300015052|Ga0137411_1206436 | Not Available | 1152 | Open in IMG/M |
| 3300015372|Ga0132256_100137371 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
| 3300015374|Ga0132255_100281441 | All Organisms → cellular organisms → Bacteria | 2388 | Open in IMG/M |
| 3300015374|Ga0132255_102948420 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300016319|Ga0182033_10225056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1509 | Open in IMG/M |
| 3300016387|Ga0182040_10302354 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300017944|Ga0187786_10059096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1181 | Open in IMG/M |
| 3300017966|Ga0187776_10982882 | Not Available | 619 | Open in IMG/M |
| 3300017997|Ga0184610_1064984 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300018028|Ga0184608_10326679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300018063|Ga0184637_10418571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 794 | Open in IMG/M |
| 3300018063|Ga0184637_10583687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300018064|Ga0187773_10069862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1664 | Open in IMG/M |
| 3300018074|Ga0184640_10051828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1699 | Open in IMG/M |
| 3300018079|Ga0184627_10423658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 692 | Open in IMG/M |
| 3300018081|Ga0184625_10134764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
| 3300018082|Ga0184639_10110688 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300018429|Ga0190272_10248789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1332 | Open in IMG/M |
| 3300018431|Ga0066655_10146819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1394 | Open in IMG/M |
| 3300018432|Ga0190275_10161786 | Not Available | 2076 | Open in IMG/M |
| 3300018468|Ga0066662_12395432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300018469|Ga0190270_10943458 | Not Available | 884 | Open in IMG/M |
| 3300018482|Ga0066669_10417684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300019377|Ga0190264_10083233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1435 | Open in IMG/M |
| 3300019889|Ga0193743_1128063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 905 | Open in IMG/M |
| 3300020004|Ga0193755_1064271 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300020034|Ga0193753_10201306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300020060|Ga0193717_1015387 | All Organisms → cellular organisms → Bacteria | 3455 | Open in IMG/M |
| 3300021073|Ga0210378_10064255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1442 | Open in IMG/M |
| 3300022756|Ga0222622_10407144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300025157|Ga0209399_10277136 | Not Available | 662 | Open in IMG/M |
| 3300025174|Ga0209324_10225947 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300025313|Ga0209431_10118516 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300025909|Ga0207705_11001032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300025931|Ga0207644_11603855 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300025958|Ga0210069_1059215 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025972|Ga0207668_10425477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1128 | Open in IMG/M |
| 3300026058|Ga0208421_1014483 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300026088|Ga0207641_11668478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300027577|Ga0209874_1009947 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300027639|Ga0209387_1030167 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300027654|Ga0209799_1092468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300027722|Ga0209819_10124955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300027765|Ga0209073_10074003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1163 | Open in IMG/M |
| 3300027775|Ga0209177_10086368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300027787|Ga0209074_10394494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300027815|Ga0209726_10095460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1818 | Open in IMG/M |
| 3300028379|Ga0268266_12324884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300031912|Ga0306921_11310911 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300031949|Ga0214473_10680922 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300032122|Ga0310895_10704526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300032180|Ga0307471_101625381 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032180|Ga0307471_103425417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300032421|Ga0310812_10243671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300033406|Ga0316604_10500569 | Not Available | 668 | Open in IMG/M |
| 3300033408|Ga0316605_11395985 | Not Available | 679 | Open in IMG/M |
| 3300033480|Ga0316620_10680209 | Not Available | 976 | Open in IMG/M |
| 3300034151|Ga0364935_0034775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1427 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.19% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.48% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.74% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.74% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.74% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.74% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025958 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026058 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_131776082 | 3300000363 | Soil | PVASVIIGCELMAPLEQNVQAALNFTPISESGKQKLQEKLAPSRSAWEDFLRDHEDTIAV |
| AF_2010_repII_A1DRAFT_100840202 | 3300000597 | Forest Soil | IGCEQIARLEENVQAALHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSVTV* |
| AF_2010_repII_A100DRAFT_10078103 | 3300000655 | Forest Soil | CEQVVPLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQQFLQSHDDSLPV* |
| JGI11643J11755_115439372 | 3300000787 | Soil | ASVVIGCEQIAPLEQNVQAAMIFRPISESDKQRLQEKVAPSRSTWENFLRTHEDSVAV* |
| JGI10215J12807_13583782 | 3300000881 | Soil | TPISESSKQKLQDKVAPSRSAWQNFLRTHEDSVTV* |
| AP72_2010_repI_A001DRAFT_10617001 | 3300000893 | Forest Soil | VPLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQQFLQSHDDSLPV* |
| JGI1027J12803_1004959791 | 3300000955 | Soil | EQMAPLEQNVQAALAFTPMNESGKQKLQEKVAPSRSAWQQFLKSHDDSLPV* |
| JGI1027J12803_1069384571 | 3300000955 | Soil | CVVIGCEQMAPLEQNVQAALNFTPMSESGKQKLQEKVAPSRSAWQRFLQSHDDSV |
| JGI10220J13317_123290032 | 3300001139 | Soil | ALNFTPISESSKQKLQDKVARSRSAWQNFLRTHEDSVTV* |
| JGI24033J26618_10559082 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | AALSYTPASESDTQRLREKIASSRSAWENFLRTHENGTVV* |
| C687J29039_102578581 | 3300002243 | Soil | CEQLATLEQNIQAALNFTPISESDKQKLREKVAPSRSAWQGFLQHHDDSAAV* |
| Ga0062381_104252262 | 3300004808 | Wetland Sediment | QAAINFTPIGADGKQKLQEKVAPSRSAWEQFLRTHEDTIVV* |
| Ga0065705_103359452 | 3300005294 | Switchgrass Rhizosphere | AASFTPMSENGKQRVKEKVAPSRAAWENFLRTHDDSAVV* |
| Ga0065707_108087042 | 3300005295 | Switchgrass Rhizosphere | AALTFTPISESGKEKLQEKVAPSRSAWENFLRTHEDSVAV* |
| Ga0068869_1002444441 | 3300005334 | Miscanthus Rhizosphere | ASVIIGCEQMALLGQSIQAALSFTPASDSDKQRLREKIASSRSAWENFLRTHENGTVV* |
| Ga0068868_1013690731 | 3300005338 | Miscanthus Rhizosphere | PVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV |
| Ga0070674_1002197532 | 3300005356 | Miscanthus Rhizosphere | VASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0070688_1010117462 | 3300005365 | Switchgrass Rhizosphere | AALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0070709_110906752 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IQVAQSFTPVSESGKQRLREKLAPSRSAWENFLRAHEDGPIA* |
| Ga0070705_1017212711 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PVASVIIGCEQLAPLEQNVQAAMNFTPISESGKQKLQEQVAPSRAAWENFLRSHEDSAAV |
| Ga0070708_1005743462 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | QAALAFTPMNESGKQKLQEKVAPSRSAWQGFLRSHDDSLPV* |
| Ga0070699_1002166721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | APLEQNVQAALAFTPMNESGRQRLQEKVAPSRSAWQGFLRSHDDSMPV* |
| Ga0068855_1001873261 | 3300005563 | Corn Rhizosphere | NIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0066905_1000645331 | 3300005713 | Tropical Forest Soil | VASVVIGCEQIARLEENVQAALHFTPMSESGKQKLQERVVPSRSAWQNFLRSHEDSVTV* |
| Ga0066905_1005072461 | 3300005713 | Tropical Forest Soil | VIGCEQVVPLEQNVQTALAFTPMNESGRQRLQEKVAPSRSAWQQLLQSHDDSLPV* |
| Ga0066903_1064929402 | 3300005764 | Tropical Forest Soil | VASVVIGCEQIARLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTA* |
| Ga0068863_1018940021 | 3300005841 | Switchgrass Rhizosphere | CEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0079037_1013096511 | 3300006224 | Freshwater Wetlands | GVEQMALLEENVQTARAFTPMTDSHRQRLQEKVAPSRAAWQRFLQSHGDSLPA* |
| Ga0079222_100458983 | 3300006755 | Agricultural Soil | ASVIIGCEQIAPLEQNIQAALNFTPASDSRKQQLREKLAPARSAWENFLRTHEDGTVA* |
| Ga0066658_105509322 | 3300006794 | Soil | EQMARLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV* |
| Ga0079220_106030102 | 3300006806 | Agricultural Soil | MSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0079220_115398512 | 3300006806 | Agricultural Soil | LTQPVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0075433_102617031 | 3300006852 | Populus Rhizosphere | VVIGCEQMARLEENVQAALNFTPISESGKQKLQQKVAPSRSAWQNFLRDHDDSAVV* |
| Ga0075425_1008255231 | 3300006854 | Populus Rhizosphere | PMNESGKQKLQEKVAPSRSAWQGFLRSHDDSMPV* |
| Ga0075434_1002988171 | 3300006871 | Populus Rhizosphere | NLSQPVASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0075434_1010550741 | 3300006871 | Populus Rhizosphere | VASVVIGCEQMAPLEQNVQAALAFTPLNESGKQRLQEKVAPSRSAWQRFLNSHDDSLPA* |
| Ga0075434_1017575482 | 3300006871 | Populus Rhizosphere | AALAFTPMNESGKQKLQEKVAPSRSAWQGFLRSHDDSLPV* |
| Ga0075424_1023068172 | 3300006904 | Populus Rhizosphere | CEQMAPLEQNVQAALNFTPMTESGKQKLQEKVAPSRSAWQNFLRTHEDSVAV* |
| Ga0075435_1006930871 | 3300007076 | Populus Rhizosphere | QNVQAALAFTPMNESGKQKLQEKIAPSRSAWQQFLKSHDDSLPV* |
| Ga0105095_108276471 | 3300009053 | Freshwater Sediment | NFTPISESGKQKLQEKVAPSRSAWENFLRSHEDSVAV* |
| Ga0075418_118765491 | 3300009100 | Populus Rhizosphere | VASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0066709_1024238122 | 3300009137 | Grasslands Soil | MEKKGPLEENVQVARSFTPMNESGKQKLREKVAPSRSAWQRFLRSHDDSLPV* |
| Ga0105243_104444412 | 3300009148 | Miscanthus Rhizosphere | FTPASESDKQRLREKIASSCSAWENFLRTHEDGTVV* |
| Ga0105243_128363782 | 3300009148 | Miscanthus Rhizosphere | LEQNVQAALNFTPLSEGSKQKLQEKVAPSRSAWENFLRSHEDSVTV* |
| Ga0126374_106894241 | 3300009792 | Tropical Forest Soil | LEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSVTV* |
| Ga0105074_10542242 | 3300010029 | Groundwater Sand | CVVIGCEQMARLEENVQAALDFTPISESGKQRLQEKVAPSRSAWEISCGHMRIQ* |
| Ga0126382_113587311 | 3300010047 | Tropical Forest Soil | LEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTV* |
| Ga0134065_100285443 | 3300010326 | Grasslands Soil | VIGVEQMARLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV* |
| Ga0126377_101814373 | 3300010362 | Tropical Forest Soil | PMSEDEKQKLQEKVAPSRSAWQRFLQSHDDLLPA* |
| Ga0126379_104352491 | 3300010366 | Tropical Forest Soil | NVRAALAFTPMSETNRQRLQEKVAPSRSAWQQFLQSHDDSCPV* |
| Ga0105239_101821121 | 3300010375 | Corn Rhizosphere | QMPLLGQNIQAVLSYTPASESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0134127_127628281 | 3300010399 | Terrestrial Soil | SVIIGCEQLAPLEQNVQAALNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV* |
| Ga0134123_129122532 | 3300010403 | Terrestrial Soil | ALNFTPITENEKERVKEKVAPSRSAWENFLRTHEDSAVV* |
| Ga0137448_10108331 | 3300011427 | Soil | MAPLEQNVHAVLNFTPISEHGKQTLQEKVAPSQSAWDNFLGIHADSVMV* |
| Ga0137428_11504841 | 3300011432 | Soil | MVRLEENVQAALNFTPISESGKQKLQEKVAPSRSAWQNFLRNHDDSVTV* |
| Ga0137451_10535132 | 3300011438 | Soil | PLEHNVQAALNFTPISESNKQKLQEKVAPSRSAWQNYLRRHEDTAV* |
| Ga0137461_11303492 | 3300012040 | Soil | VIGCEQMARLEENVQAALNFTPISESAKQRLQDKVAPSRAAWQNFLRSHNDTIAV* |
| Ga0137319_11188572 | 3300012167 | Soil | QVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTYEDSVTV* |
| Ga0137382_106445152 | 3300012200 | Vadose Zone Soil | NFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV* |
| Ga0137378_103173101 | 3300012210 | Vadose Zone Soil | AALNFTPISESGRQRLQEKVAPSRSAWENFLRTHEDSLPV* |
| Ga0137377_102294381 | 3300012211 | Vadose Zone Soil | QNVQAAMNFTPISESDKQKLQEKVAPSRSAWENFLRTHEDSVTV* |
| Ga0137459_10621832 | 3300012228 | Soil | LAPLEQNVQVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTYEDSVTV* |
| Ga0137369_102923332 | 3300012355 | Vadose Zone Soil | MAPLEQNVQAALNFTPISESGKQKLQEKVTPSRSAWQNFPRTHEDSVTV* |
| Ga0137358_110613991 | 3300012582 | Vadose Zone Soil | EQNVQAAMNFTPISESGRQRLQEKVAPSRSTWENYLRTHEDSVTV* |
| Ga0157306_101294802 | 3300012912 | Soil | ALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0126369_111255851 | 3300012971 | Tropical Forest Soil | PLEQNVQAAIRFTPISESGKQRLRERVAPSRSAWENFLRNHDDSIAMKA* |
| Ga0134076_104714721 | 3300012976 | Grasslands Soil | QAALNFTPISESGKQRLQEKVAPSRSAWENFLRTHEDSLPV* |
| Ga0164308_103767061 | 3300012985 | Soil | TPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0164307_107299631 | 3300012987 | Soil | NLTQPVASVIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0157375_105136091 | 3300013308 | Miscanthus Rhizosphere | IQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0075344_10337231 | 3300014296 | Natural And Restored Wetlands | VIIGCEHLSPLEENIQAAINFSPISDDAKQRLQEKVAPSRSAWENFLRHHEDSATV* |
| Ga0075350_10846642 | 3300014315 | Natural And Restored Wetlands | LSPLEENIQAAINFSPISDDAKQRLQEKVAPSRSAWENFLRHHEDSATV* |
| Ga0157377_110673191 | 3300014745 | Miscanthus Rhizosphere | VLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0180080_11013662 | 3300014870 | Soil | EQNVQVAMNFTPIEETGKHKLQEKVAPSRSAWEQFLRTHEDSVTV* |
| Ga0180086_10156911 | 3300014883 | Soil | TAHLEQNVQAALNFTPISESGKQKLQEKVAPSRSAWQGFLKSHDASLAV* |
| Ga0157379_110706652 | 3300014968 | Switchgrass Rhizosphere | MALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV* |
| Ga0137411_10390773 | 3300015052 | Vadose Zone Soil | AMNFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV* |
| Ga0137411_12064361 | 3300015052 | Vadose Zone Soil | AAMNFTPISESVKQKLQEKVAPSRSAWEKFLESHEDSVTV* |
| Ga0132256_1001373714 | 3300015372 | Arabidopsis Rhizosphere | EEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV* |
| Ga0132255_1002814411 | 3300015374 | Arabidopsis Rhizosphere | APLEQNIHAALNFTPMSESGKQKLQEKVAPSRWAWQRFLESHDDSAAV* |
| Ga0132255_1029484202 | 3300015374 | Arabidopsis Rhizosphere | GCEQLAPLEQNVQAALNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV* |
| Ga0182033_102250561 | 3300016319 | Soil | LEQNIQAALNFTPMSESGKERVREKVAPSRSAWENFLRNHDDRSQ |
| Ga0182040_103023542 | 3300016387 | Soil | CEQMTPLEQNIQAALNFTPMSESGKERVREKVAPSRSAWENFLRNHDDRSQ |
| Ga0187786_100590962 | 3300017944 | Tropical Peatland | FTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV |
| Ga0187776_109828822 | 3300017966 | Tropical Peatland | TPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV |
| Ga0184610_10649841 | 3300017997 | Groundwater Sediment | SVVIGCEQMARLEENVQAALNFTPISESGKQKLQEKVAPSRSAWENFLRSHEDSVTV |
| Ga0184608_103266792 | 3300018028 | Groundwater Sediment | LEENVQAAMHFTPMSESNKQKLQERVAPSRSAWENFLRSHVDSVAV |
| Ga0184637_104185711 | 3300018063 | Groundwater Sediment | NVQAALNFTPISEGGKQKLQEKVAPSRAAWQNFLRSHDDTIAV |
| Ga0184637_105836871 | 3300018063 | Groundwater Sediment | QLAPLEQNVQAAMNFIPISESGKQKLQEKVAPSRSAWENFLRTHEDSVAV |
| Ga0187773_100698621 | 3300018064 | Tropical Peatland | APLEQNVQAALSFTPISESGKQKLQEKVAPSRAAWENFLRTHEDSVTV |
| Ga0184640_100518281 | 3300018074 | Groundwater Sediment | VIGCEQLAPLEQNVQAALNFTPISESGKQKLQEKVAPSRAAWQNFLRTHEDTATV |
| Ga0184627_104236581 | 3300018079 | Groundwater Sediment | NVQAAINFTPMSESGKEKLQEKVAPSRSAWENFLRTHEDSVTV |
| Ga0184625_101347641 | 3300018081 | Groundwater Sediment | QPVASVVIGCEQMARLEENVQAALNFTPISENGKQKLQEKVAPSRAAWQNFLRSHDDSVA |
| Ga0184639_101106885 | 3300018082 | Groundwater Sediment | VVIGCEQLAPLEQNVQAALNFTPISESGKQKLQEKVAPSRAAWQNFLRSHDDTIAV |
| Ga0190272_102487892 | 3300018429 | Soil | FTPMDESGKQKLQEKVAPSRSAWENFLRTHEDTIPV |
| Ga0066655_101468191 | 3300018431 | Grasslands Soil | RLEQNIQAARSFVAMNDGEKQKLRDAVAPSRSAWHRFLESHDDSLPV |
| Ga0190275_101617863 | 3300018432 | Soil | TPMGESAKQRLQEKVAPSRSAWENFLRTHEDAATV |
| Ga0066662_123954322 | 3300018468 | Grasslands Soil | PLEQNVQAALNFTPMSENGKQKLQEKVAPSRSAWQRFLQSHDDSVAV |
| Ga0190270_109434581 | 3300018469 | Soil | VASVIIGCEQLAPLEQNVQAAMNFTPMGETGRHKLQEEVAPSRSAWENFLRTHEDTIPV |
| Ga0066669_104176843 | 3300018482 | Grasslands Soil | APLEQNVQAALNFTPISETGKQKLQEKVAPSRSAWENFLRAHEDSVAV |
| Ga0190264_100832331 | 3300019377 | Soil | SQPVASVVIGCEQLAPLEQNVQAAMNFTPIGESAKQRLQEKVAPSRSAWENFLRTHEDAATV |
| Ga0193743_11280632 | 3300019889 | Soil | SFTPISESGKQKLQEKVAPSRSAWENFLRTHEDSIVV |
| Ga0193755_10642712 | 3300020004 | Soil | LEQNVQATLNFTPMSEGGKQKLQEKVAPSRSAWENFLRSHEDSVTV |
| Ga0193753_102013062 | 3300020034 | Soil | VQAALSFTPISESGKQKLQEKVAPSRSAWENFLRTHEDSIVV |
| Ga0193717_10153874 | 3300020060 | Soil | NFTPISESGKQKLQEKIAPSRSAWENFLRGHEDSITV |
| Ga0210378_100642551 | 3300021073 | Groundwater Sediment | AAMNFIPISENGKQKLQEKVAPSRSAWQKFLEMHDDSATV |
| Ga0222622_104071442 | 3300022756 | Groundwater Sediment | SQPVASVIIGCEQLAPLEQNVQATLNFTPMSEGGKQKLKEKVAPSRSAWENFLRSHEDSVTV |
| Ga0209399_102771362 | 3300025157 | Thermal Springs | RAALHFTPITEGAKHKLQEKVAPSRSAWQHFLQSHNDSPPV |
| Ga0209324_102259473 | 3300025174 | Soil | EQMAPLEQNVQAALNFTPISESGKQELQEKVAPSRSAWQRFLQSHDDSVAA |
| Ga0209431_101185161 | 3300025313 | Soil | HLEQNVQATLNFTPISESGKQKLQEKVAPSRSAWQRFLQSHGDSLPA |
| Ga0207705_110010322 | 3300025909 | Corn Rhizosphere | MFCLSSVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV |
| Ga0207644_116038552 | 3300025931 | Switchgrass Rhizosphere | VIIGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV |
| Ga0210069_10592151 | 3300025958 | Natural And Restored Wetlands | IGCEQFSPLEENIQAALNFKPISDGAKQRLQEKVAQSRSAWENFLRHHEDSATV |
| Ga0207668_104254771 | 3300025972 | Switchgrass Rhizosphere | DGAARAKHQAALSYTPASESDTQRLREKIASSRSAWENFLRTHEDGTVV |
| Ga0208421_10144831 | 3300026058 | Natural And Restored Wetlands | QPVASVVIGCEQLAPLEQNVQAAMNFRPISESGKQRLQEKVAPSRSAWENFLRTHEDSVA |
| Ga0207641_116684782 | 3300026088 | Switchgrass Rhizosphere | IGCEEMAPLEENVLAAASFTPMSENGKQRVKEKVAPSRAAWENFLRTHEDSAVV |
| Ga0209874_10099473 | 3300027577 | Groundwater Sand | VACVVIGCEQMAPLEQNIQAALNFTPMSESEKPKLQEKVAPSRSAWQRFLQSHDDSIAV |
| Ga0209387_10301672 | 3300027639 | Agricultural Soil | EQNVQAAANFTPISESGKQKLQEKVAPSRSAWQKFL |
| Ga0209799_10924681 | 3300027654 | Tropical Forest Soil | ARLEENVQAAMHFTPMSESGKQKLQERVAPSRSAWENFLRSHVDSLTV |
| Ga0209819_101249552 | 3300027722 | Freshwater Sediment | PVACVVIGCEQMVRLEENVQAALNFTPINESGKQKLQEKVAPSRSAWQRFLQSHDDSVAI |
| Ga0209073_100740031 | 3300027765 | Agricultural Soil | LGQNIQAVLSYTPASESDKQRLREKIAPSRSAWENFLRTHEDGTVV |
| Ga0209177_100863682 | 3300027775 | Agricultural Soil | NLSQPVASVIIGCEQITPLEQNIQAALNFTPASDSRKQQLREKLAPARSAWENFLRTHEDGTVV |
| Ga0209074_103944941 | 3300027787 | Agricultural Soil | PVASVIIGCEQMAALEQNIQAALNSTPMSESAKQQVREKVAPSRSAWENFLRTHEDSALV |
| Ga0209726_100954603 | 3300027815 | Groundwater | MDPLEQNVQAALDFRPMSESGKQKLQEKVAPSWAAWENFLRTHEDSVAV |
| Ga0268266_123248842 | 3300028379 | Switchgrass Rhizosphere | NLSQPVASVIIGCAQMALLGQNIQAALSFTPARESDKQRLREKIAPSRSAWENFLRTHEDGTVV |
| Ga0306921_113109112 | 3300031912 | Soil | ALSFAPMSEPDKQKLQEKVAPSRSAWQRFLESHDDFVAV |
| Ga0214473_106809221 | 3300031949 | Soil | ASVVIGCEQMARLEENVLAALNFTPISEIGKQKLQEKVAPSRSAWQNFLRNHDDSVAV |
| Ga0310895_107045262 | 3300032122 | Soil | EQLAPLEQNVQAALNFTPISESSKQKLQEKVAPSRSAWENFLRSHEDSVTV |
| Ga0307471_1016253811 | 3300032180 | Hardwood Forest Soil | VASVIIGCEQLAPLEQNVQAALNFTPISESSKQKLQEKVAPSRSAWENFLRSHEDSVTV |
| Ga0307471_1034254171 | 3300032180 | Hardwood Forest Soil | PVACVVIGCEQMAPLEQNVQAAQSFVPMNENDKQKLQEKVAPSRSAWQQFLQSHDDSVAV |
| Ga0310812_102436711 | 3300032421 | Soil | PVASVIIGCEQIAPLEQNIQAALNFTPASDSRKQRLREKLAPSRSAWENFLRTHEDGTVV |
| Ga0316604_105005691 | 3300033406 | Soil | EQNVQAALNFTPLGETGKQKLQEQVAPSRSAWEKFLRAHEDSITV |
| Ga0316605_113959851 | 3300033408 | Soil | LSQPVASVIIGCEQLSPLEENIRAALNFKPISDDAKQRLQEKVAPSRSAWEKFLRQHEDSITV |
| Ga0316620_106802092 | 3300033480 | Soil | VACVVIGCEQMAPLEQNLQAAIKFTPLGENEKRKLQEKVVPSRSGWQQFLRSHADS |
| Ga0364935_0034775_1142_1291 | 3300034151 | Sediment | MVRLEENVQAALNFTPISESGKQKLQEKVAPSRSAWQNFLRNHDDSVTV |
| ⦗Top⦘ |