NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058226

Metagenome / Metatranscriptome Family F058226

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058226
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 43 residues
Representative Sequence WNQRVDSNHRYTTSIAIRDQMVAKGGVAEGYGPNAVALCALP
Number of Associated Samples 117
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.148 % of family members)
Environment Ontology (ENVO) Unclassified
(44.444 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(54.815 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.86%    β-sheet: 11.43%    Coil/Unstructured: 75.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF13458Peripla_BP_6 8.15
PF02586SRAP 7.41
PF13365Trypsin_2 3.70
PF13180PDZ_2 2.96
PF01266DAO 2.96
PF12833HTH_18 1.48
PF03707MHYT 1.48
PF06580His_kinase 1.48
PF00072Response_reg 1.48
PF07171MlrC_C 0.74
PF13335Mg_chelatase_C 0.74
PF08279HTH_11 0.74
PF05726Pirin_C 0.74
PF05987DUF898 0.74
PF01053Cys_Met_Meta_PP 0.74
PF07298NnrU 0.74
PF02543Carbam_trans_N 0.74
PF12276DUF3617 0.74
PF08241Methyltransf_11 0.74
PF07883Cupin_2 0.74
PF00441Acyl-CoA_dh_1 0.74
PF14684Tricorn_C1 0.74
PF01425Amidase 0.74
PF03466LysR_substrate 0.74
PF14497GST_C_3 0.74
PF061895-nucleotidase 0.74
PF01874CitG 0.74
PF14559TPR_19 0.74
PF00392GntR 0.74
PF15780ASH 0.74
PF13565HTH_32 0.74
PF03279Lip_A_acyltrans 0.74
PF00908dTDP_sugar_isom 0.74
PF03480DctP 0.74
PF01641SelR 0.74
PF07228SpoIIE 0.74
PF08546ApbA_C 0.74
PF00293NUDIX 0.74
PF14907NTP_transf_5 0.74
PF00497SBP_bac_3 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 7.41
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 1.48
COG3300MHYT domain, NO-binding membrane sensorSignal transduction mechanisms [T] 1.48
COG3275Sensor histidine kinase, LytS/YehU familySignal transduction mechanisms [T] 1.48
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 1.48
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.74
COG5476Microcystin degradation protein MlrC, contains DUF1485 domainGeneral function prediction only [R] 0.74
COG4269Uncharacterized membrane protein YjgN, DUF898 familyFunction unknown [S] 0.74
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 0.74
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.74
COG4094Uncharacterized membrane proteinFunction unknown [S] 0.74
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.74
COG2192Predicted carbamoyl transferase, NodU familyGeneral function prediction only [R] 0.74
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.74
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.74
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.74
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG1898dTDP-4-dehydrorhamnose 3,5-epimerase or related enzymeCell wall/membrane/envelope biogenesis [M] 0.74
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.74
COG1767Triphosphoribosyl-dephospho-CoA synthetaseCoenzyme transport and metabolism [H] 0.74
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.74
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 0.74
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.74
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.74
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.74
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.74
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.74
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.74
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.70%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.22%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.22%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.22%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.96%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge2.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.48%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.48%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.74%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.74%
Active SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005147Soil and rhizosphere microbial communities from Laval, Canada - mgLMCEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009658Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaGEngineeredOpen in IMG/M
3300009711Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaGEngineeredOpen in IMG/M
3300009776Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaGEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012533Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MGEngineeredOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300025715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_021691402170459019Switchgrass, Maize And Mischanthus LitterMRADTNHRYTTSLAVRDQMVAKGYVPEGSGAAGRVFCAPL
F14TC_10225785023300000559SoilGVPIYRVWNKRKDANHRYTTXIAVRDQMVARGGVAVGYGPNAVVLCGLP*
Ga0062383_1052469723300004778Wetland SedimentVNRVWNRRADSNHRYTTDRALRDGMVARGYAAEGYGPDAVAMCAAP*
Ga0066821_102793423300005147SoilTVPVYRVWNNRVDSNHRYTTSLATRDAMVAMGYVKEGYGPNFVIMCAVP*
Ga0070676_1137902423300005328Miscanthus RhizosphereFNQRKDANHRYTTSIAIRNQMVARGGVAEGYGPNAVVLCGLA*
Ga0070683_10094845523300005329Corn RhizosphereDNRADANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA*
Ga0070690_10070286013300005330Switchgrass RhizospherePVYRVWNKRTDSNHRYTTSMAVRDQMVARGYIAEGYGPNNVTLCALP*
Ga0066388_10090706113300005332Tropical Forest SoilPDGNHRYTTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS*
Ga0070660_10181933513300005339Corn RhizosphereVWNQRYDSNHRYTTSTAIRDQMVQKGGIAEGYGPGAVALCALP*
Ga0070671_10085438023300005355Switchgrass RhizosphereRADTNHRYTTSLAVRDQMVAKGYVPEGSGPQAVVFCAPL*
Ga0070671_10104623613300005355Switchgrass RhizosphereIWNNRADSNHRYTTSMTMRDQMIAKGYVVEGYGSNGIALCALP*
Ga0070674_10132987213300005356Miscanthus RhizosphereVPIYRVFNQRKDANHRYTTSLAIRNQMVAKGGVAEGYGPNAVVLCGL*
Ga0070674_10204348913300005356Miscanthus RhizosphereWNHRADTNHRYTASRDVRDAMVAQGYVAEGSGPDVVTFCAPR*
Ga0070659_10120049823300005366Corn RhizosphereTTPVYRTWNQRADSNHRYTAVREIRDGMVARGYVAEGYGPDAVAMCAPR*
Ga0070705_10064617713300005440Corn, Switchgrass And Miscanthus RhizosphereNNRRDSNHRYTTKTAIRDQMVAKGGVAEGYGASAVALCGLP*
Ga0066682_1081467823300005450SoilPVYRVWNDRYDSNHRYTTSRTLRDQMLARGFLAEGYGADVVVMCAAQ*
Ga0070678_10112422113300005456Miscanthus RhizospherePVYRVWNARADNNHRYMTDKSIRDDMVAAGGIAEGYGADMVIMCAVP*
Ga0070685_1112914823300005466Switchgrass RhizosphereRVWNARADSNHRYTTSKSVRDQMIAKGYVAEGYGPDGVAMCAGGND*
Ga0068853_10042736133300005539Corn RhizosphereVPVYRVWNARTDSNHRYTTSIATRDQMVARGYIAEGYGPDNVTLCGLQ*
Ga0066697_1020536813300005540SoilRADTNHRYTTSLAIRAQMLAKGYIAEGYGPNAVSMCAAQAG*
Ga0066697_1020638823300005540SoilLIPLYRVWNQRTDSNHRYVTDRHVRDQMVAARGYVAEGYGPNAVTMCVTPFFDC*
Ga0066697_1067934513300005540SoilVYRVWNDRYDSNHRYTTSRTLRDQMLARGYLAEGYGADVVVMCAAQ*
Ga0070686_10036475813300005544Switchgrass RhizosphereGGVPIYRVFNQRKDVNHRYTTSTAIRDQMVAKGGVAEGYGANAVALCGLP*
Ga0070665_10229661423300005548Switchgrass RhizosphereAPIYRVWNNRSDSNHRYVKDRALRDSMVAKGYVAEGYGPDGVIMCAAQ*
Ga0070704_10210892823300005549Corn, Switchgrass And Miscanthus RhizosphereNVPVYRTWNGRADSNHRYMTSMPMRDQMIAKGHIAEGYGPNNVTLCALQ*
Ga0066707_1039089933300005556SoilDSNHRYTTSLTIRSQMLAKGYLAEGYGPVPVSMCAAW*
Ga0068857_10253534213300005577Corn RhizosphereHRYTTSLAIRNQMVAKGGIAEGYGPNAVVLCGLP*
Ga0068854_10175832323300005578Corn RhizosphereSNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP*
Ga0070702_10178007113300005615Corn, Switchgrass And Miscanthus RhizosphereVWNNRADSNHRYTTSIADRDAMVAKGYVKEGYGPQSVTLCALP*
Ga0068852_10046300633300005616Corn RhizosphereIWNKRTDSNHRYTTKSAIRDQMVAKGGIAEGYGPNAVALCGLP*
Ga0068859_10260012223300005617Switchgrass RhizosphereNRRRDSNHRYTTSATIRDQMVQKGGIAEGYGPNAVALCALQ*
Ga0066903_10656670923300005764Tropical Forest SoilNRADTNHRYTTSLAIRSQMLQKGYIAEGYGLTGVAMCAAQLPAAVQ*
Ga0066903_10709866523300005764Tropical Forest SoilIYRVWNNRADSNHRYTPSRTIRDQMVAKGYIAEGYGPDNVTLCGLP*
Ga0068851_1059880723300005834Corn RhizosphereSSGVAIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPNSVTLCAVP*
Ga0068863_10046548223300005841Switchgrass RhizosphereNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP*
Ga0068860_10096029933300005843Switchgrass RhizosphereVYRVWNQRRDSNHRYTTSVAIRDQMVAKGGVAEGYGANAVALCGLP*
Ga0068862_10241780723300005844Switchgrass RhizosphereREDSNHRYTTSIAIRDQMVAKGGVAEGYGPNSVALCGLS*
Ga0097621_10180681823300006237Miscanthus RhizosphereNQRKDANHRYATSIAIRDEMVSRGGVAEGYGPTSVALCALP*
Ga0068871_10126947423300006358Miscanthus RhizosphereRADANHRYTTSLAVRDQMVAKGYVPEGSGPDAVVFCAPL*
Ga0068871_10173550223300006358Miscanthus RhizosphereSGGVPIYRIFNQRKDANHRYTTSVVIRDQMVARGGVAEGYGPNAVALCGLP*
Ga0066665_1124487513300006796SoilNRADTNHRYTTSPTIRSQMIAKGYIPEGYGPNAVAMCAAL*
Ga0079220_1120143723300006806Agricultural SoilVYRVWNARPDSNHRYTTQAAIRDQMVARGGIAEGYGPDAVSMCVPQ*
Ga0075424_10032175133300006904Populus RhizosphereSGHRYMTSRAVRDQMVAEGYIAEGYGNDQVAFCAPQ*
Ga0074063_1233305713300006953SoilPVYRVWNNRADSNHRYTTSIAIRDQMVAKGGIAEGYGPNNVIMCAAP*
Ga0074063_1378446313300006953SoilDSNHRYTTSVATRDAMVAMGYVKEGYGPNFVIMCAVP*
Ga0079219_1151146313300006954Agricultural SoilRADANHRYTTSTVIRDQMVARGYIAEGYGPNNVTLCGLP*
Ga0099829_1092804623300009038Vadose Zone SoilNRADTNHRYTTSLTIRSQMLAKGYVAEGYGPNPVSMCAAW*
Ga0111539_1351804113300009094Populus RhizosphereNAAPVYRIWNQRSDSNHRYTIDPSIRDRMVREGGVAEGYGPNAVALCGLP*
Ga0105245_1216758123300009098Miscanthus RhizosphereYRVWNRRADANHRYTTSTAIRDQMVQRGGVAEGFGPNPVALCALP*
Ga0075418_1138079313300009100Populus RhizosphereASGGLPIYRVWNNRTDSNHRYTTSIADRDAMVAKGYIKEGYGVNAVTLCAVP*
Ga0075418_1156739913300009100Populus RhizosphereDNNHRYTTDKGIRDQMIVAGGIAEGYGPDAVIMCAAP*
Ga0105243_1168813813300009148Miscanthus RhizosphereVPIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP*
Ga0105248_1227966723300009177Switchgrass RhizosphereDSNHRYTTSKGIRDQMIVQGHVAEGYGPDGVALCALQ*
Ga0105248_1294859823300009177Switchgrass RhizosphereDSNHRYTTSIAIRDAMVQKGGVAEGYGPNAVALCALP*
Ga0116188_132450723300009658Anaerobic Digestor SludgeYRVLNGRRDANHRYVASRALRDSMVAAGWIAEGYGPAQVAMCSPARSAP*
Ga0116166_116214313300009711Anaerobic Digestor SludgeNHRYTTSTTVRAQMEAAGWIREGYGPNATIMCAVGAP*
Ga0116154_1018375913300009776Anaerobic Digestor SludgePDTNHRYTSDRAVRDAMVALGYVAEGSGPDIVTFCAPR*
Ga0131092_1047037433300009870Activated SludgeHRYTTDIAVRDAMVAKGYVAEGSGPNAVTFCSPQ*
Ga0126314_1123100523300010042Serpentine SoilSNHRYTTSTAVRDQMVARGGVAEGYGPNAVALCGLP*
Ga0105239_1181354613300010375Corn RhizosphereRADTNHRYTTSLSLRDTMVAQGYVSEGYGPYGVAFCVPTF*
Ga0126383_1124207623300010398Tropical Forest SoilMTLFTTSSAIRAQMEAMGWVAEGYGPGQVIMCAAQ*
Ga0134127_1152764613300010399Terrestrial SoilRRPDTNHRYTTSAAVRDQMVAAGGVAEGYGPNAVAMCAPR*
Ga0136623_1040973023300012045Polar Desert SandVWNNRADSNHRYTTDRTIREAMVAKGGVAEGYGVVGVSMCAIP*
Ga0136634_1028049813300012046Polar Desert SandADSNHRYTTDPAIRDMMVAQGGIAEGYGPDRVIMCAPQ*
Ga0137384_1144054833300012357Vadose Zone SoilVWNDRADSNHRYTTDRATRDAMVAMGYIAEGYGPTQVSMCAAQAG*
Ga0138256_1024225513300012533Active SludgeRAWNRRPDTNHRYTSERSVRDAMVALGYLAEGSGPDVVTFCAPR*
Ga0157282_1018953813300012904SoilNHRYTTSLAVRDQMVNKGYVPEGSGPDAVVFCAPL*
Ga0157310_1021836333300012916SoilSNHRYTTSIADRDAMVAKGYVKEGYGPNSVTLCALP*
Ga0157374_1290797813300013296Miscanthus RhizosphereVPVYRVFNQRTDANHRYTTSIAIRDQMVAKGGIAEGYGPNAITLCGLP*
Ga0163162_1146316613300013306Switchgrass RhizosphereDANHRYTTSIAIRDEMVARGGVAEGYGPNAVVLCGLP*
Ga0163162_1193500613300013306Switchgrass RhizosphereSNHRYTSKIAIRDQMVARGGIAEGYGPNAVVLCGLP*
Ga0163162_1289171023300013306Switchgrass RhizosphereDSNHRYTTKTSIRDQMVAKGGVAEGYGANAVALCALP*
Ga0163162_1289552813300013306Switchgrass RhizospherePAGDVPVYRVWNQRYDSNHRYTTSTAIRDQMVQKGGVAEGYGPTAVALCALP*
Ga0163162_1290593313300013306Switchgrass RhizosphereVPIYRIFNQRADVNHRYTTSTAIRDQMVAKGGVAEGYGPNAVTLCGLP*
Ga0157372_1324779913300013307Corn RhizosphereADTNHRYTTSLSLRDTMVAQGYVSEGYGPYGVAFCVPTF*
Ga0163163_1059158943300014325Switchgrass RhizosphereDANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA*
Ga0182008_1029833023300014497RhizosphereTDANHRYTTSIAIRDQMVARGGIGEGYGPNAVALCGLP*
Ga0182008_1037865113300014497RhizosphereTCAPGQIAVYRVWNARRDSDHRYTTQVAIRDAMVARGGIAEGYGPDAVAMCAPQ*
Ga0157376_1027367743300014969Miscanthus RhizosphereVPIYRVFNQRKDANHRYTTSTAIRDQMVAKGGVAEGYGPNAVALCGLH*
Ga0157376_1309303713300014969Miscanthus RhizosphereIWNQRSDSNHRYTIDPSIRDRMVREGGAAEGYGPNAVALCGLP*
Ga0173483_1061243113300015077SoilPIYRVWNNRADSNHRYTTTIADRDAMVAKGYIKEGYGPNAVTLCALP*
Ga0173478_1059394023300015201SoilVWNQRRDSNHRYTTSVAIRYQMVAKGGVAEGYGPNAV
Ga0132258_1130370333300015371Arabidopsis RhizosphereARVDSNHRYTTSPAIRDLMRAQGYVAEGSGSGVVAMCVGGGLGNE*
Ga0182032_1079617813300016357SoilRPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS
Ga0182034_1005209213300016371SoilPDGNHRYTTDPAIRDQMVAAGGIAEGYGPNAVIMCAPQ
Ga0136617_1135540213300017789Polar Desert SandVWNNRADSNHRYTTDPAIRDAMVALGGIAEGYGPDRVIMCAPQ
Ga0163161_1198507313300017792Switchgrass RhizosphereQRKDANHRYTTSIAIRDQMVARGGVAEGYGPNAVVLCGLP
Ga0190270_1123574113300018469SoilNHRYVTSRALRDQMLYRGYIAEGYGTDEVIMCAGG
Ga0190274_1270857213300018476SoilNTTPIYRVWNKRVDSNHRYLANRALRDVMVARGYVAEGYGPDAVVMCGP
Ga0190271_1084068933300018481SoilVYRTWNRRADTNHRYTSNIGVRDQMVALGHVAEGSGPNVVTFCAPL
Ga0190271_1126339723300018481SoilPQNMVPVYRLWNNRSDSNHRYTNHRSTRDEMVAKGYVVEGYGVDPVIMCGAP
Ga0190271_1382407023300018481SoilYVPVYRVWNNRGDSNHRYMTDKALRDSMVAAGGIAEGYGPDQVILCAAP
Ga0173479_1017708123300019362SoilVWNRRLADTNHRYTASRAIRDAMVAQGYVAEGSGPDVVTFCAPR
Ga0209310_121178113300025715Anaerobic Digestor SludgePDTNHRYTSDRAVRDAMVALGYVAEGSGPDIVTFCAPR
Ga0207654_1010558123300025911Corn RhizosphereVFDNRADANHRYTTSRAIRDQMVALGYIAEGYGNDAVIMCAAA
Ga0207662_1125747623300025918Switchgrass RhizosphereRRDSNHRYTTSVAIRDQMVAKGGVAEGYGANAVALCGLP
Ga0207646_1044420713300025922Corn, Switchgrass And Miscanthus RhizosphereDTNHRYTTSLAIRSQMIAKGYIPEGYGPNSVGMCAAL
Ga0207659_1020224713300025926Miscanthus RhizosphereSGVAIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPNSVTLCAVP
Ga0207644_1156365823300025931Switchgrass RhizosphereDTNHRYTTSAAVRDQMVAAGGVAEGYGPNAVAMCAPR
Ga0207686_1003272043300025934Miscanthus RhizospherePDTNHRYTTSAAVRDEMVAAGGVAEGYGPNAVAMCAPR
Ga0207711_1170196613300025941Switchgrass RhizosphereRIWNQRRDSNHRYTTSIAIRDAMVQKGGVAEGYGPNAVALCALP
Ga0207651_1037994723300025960Switchgrass RhizosphereNRADSNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP
Ga0207668_1087514923300025972Switchgrass RhizosphereTNHRYTTSQEIRDRMVVRGYVAEGYGPSPVAWCVAP
Ga0207639_1125185723300026041Corn RhizosphereRDSNHRYTTKIAIRDQMVAKGGVAEGYGPNAVALCGLP
Ga0207708_1177313023300026075Corn, Switchgrass And Miscanthus RhizosphereRADTNHRYTSSRTVRDTMVAQGYVAEGSGPDIVTFCAPR
Ga0207708_1190160213300026075Corn, Switchgrass And Miscanthus RhizosphereRLDSNHRYTTSIATRNQMIAKGHVAEGYGPNAVALCGLS
Ga0207641_1008872523300026088Switchgrass RhizosphereVWNQRADSNHRYVTTLGLRDQMVAKGYVAEGYGPNAVTLCASQ
Ga0207683_1085979523300026121Miscanthus RhizosphereNHRPDTGHRYTIDPAVRDQMVALGYVPEGAGPQAVAMCAPA
Ga0209375_131747423300026329SoilVYRVWNDRYDSNHRYTTSRTLRDQMLARGFLAEGYGADVVVMCAAQ
Ga0209966_101069813300027695Arabidopsis Thaliana RhizosphereRPDTNHRYTTDIGVRDGMVAKGYIAEGSGPDAVTFCAPL
Ga0209465_1033796023300027874Tropical Forest SoilPDGNHRYTTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS
Ga0268265_1207916313300028380Switchgrass RhizosphereVFNQRKDANHRYTTSIAIRDQMVAKGGIAEGYGPDAVVLCGLP
Ga0247827_1118018313300028889SoilVWNKRADTNHRYTTSLAVRDQMVAKGYVPEGSGPDAVVFCAPL
Ga0311336_1112631913300029990FenVYRVWNTRRDSNHRYMTDRSLRDLMVAKGYVAEGYGQDAVIMCAPM
Ga0311360_1003934243300030339BogSVPIYRVWNRRVDSNHRYTTDRALRDAMVARGYVAEGYGPDTVGMCGPR
Ga0311335_1115871923300030838FenANGVPVYRAWNGGADSNHRYMTSLAIRAQMQGRGYIAEGYGPNQVTLCALP
Ga0318516_1014460833300031543SoilDTNHRYTTSLATKQQMQATGWVAEGYGPSQVIMCAPQ
Ga0310915_1017544533300031573SoilNTIPVYRVFNNRPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS
Ga0318496_1082951523300031713SoilRVFNNRPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS
Ga0310813_1181851613300031716SoilDTNHRYTASRAIRDAMVAQGYVAEGSGPDVVTFCAPR
Ga0306917_1137884923300031719SoilSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS
Ga0311351_1076523123300031722FenVPVYRVWNGLAAANHRYTTRRDIRDAMVAQGWIAEGTGPNAVTMCAPQ
Ga0318546_1127386613300031771SoilGWTPVYRVWNQRADSNHRYMTDRALRDAMVAQGYVAEGYGPDAVIMCAPP
Ga0310885_1064946623300031943SoilRVFNDRHDANHRYTTSVAIRDTMVALGWRREGYGPDATIMCATSP
Ga0308176_1036738323300031996SoilVFRVWNARADSNPRYTASRSVRDTMVAAGGVAEGFGPDAVAMCAPQ
Ga0318575_1051317513300032055SoilADTNHRYTTSLATKQQMQATGWVAEGYGPSQVIMCAPQ
Ga0308173_1011953633300032074SoilRADANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA
Ga0315283_1055936733300032164SedimentRADTNHRYMTSAAVRANMVASGWVAEGYGPDQVIMCAPK
Ga0315270_1101372433300032275SedimentPVYRVWNQRADSNHRYTADRSVRDAMVVHNYLAEGYGPDNVIMCAPA
Ga0315287_1221336313300032397SedimentAGGAAPAPRSNHRYTTSTTIRDAMVAKGGIAEGYGPNAVIMCAPQ
Ga0335082_1018480013300032782SoilWNQRVDSNHRYTTSIAIRDQMVAKGGVAEGYGPNAVALCALP
Ga0335079_1215872213300032783SoilDSNHRYTVSLTIRQQMIDAGWVAEGYGPNAVIMCAPA
Ga0335070_1126518313300032829SoilDARADTNHRYTTSTVVRAQMEAQGWVAEGYGPAQVIMCAPQ
Ga0335083_1094965813300032954SoilYRVWNQRADSNHRYTTSLALRDQMVAQGWLAEGYGPNAVVLCGVM
Ga0316616_10254674823300033521SoilPDANHRYTTDRGVRDLMVSLGGTAEGYGDDAVIMCAPPGTSTAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.