| Basic Information | |
|---|---|
| Family ID | F058226 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 43 residues |
| Representative Sequence | WNQRVDSNHRYTTSIAIRDQMVAKGGVAEGYGPNAVALCALP |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.148 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.815 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.86% β-sheet: 11.43% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF13458 | Peripla_BP_6 | 8.15 |
| PF02586 | SRAP | 7.41 |
| PF13365 | Trypsin_2 | 3.70 |
| PF13180 | PDZ_2 | 2.96 |
| PF01266 | DAO | 2.96 |
| PF12833 | HTH_18 | 1.48 |
| PF03707 | MHYT | 1.48 |
| PF06580 | His_kinase | 1.48 |
| PF00072 | Response_reg | 1.48 |
| PF07171 | MlrC_C | 0.74 |
| PF13335 | Mg_chelatase_C | 0.74 |
| PF08279 | HTH_11 | 0.74 |
| PF05726 | Pirin_C | 0.74 |
| PF05987 | DUF898 | 0.74 |
| PF01053 | Cys_Met_Meta_PP | 0.74 |
| PF07298 | NnrU | 0.74 |
| PF02543 | Carbam_trans_N | 0.74 |
| PF12276 | DUF3617 | 0.74 |
| PF08241 | Methyltransf_11 | 0.74 |
| PF07883 | Cupin_2 | 0.74 |
| PF00441 | Acyl-CoA_dh_1 | 0.74 |
| PF14684 | Tricorn_C1 | 0.74 |
| PF01425 | Amidase | 0.74 |
| PF03466 | LysR_substrate | 0.74 |
| PF14497 | GST_C_3 | 0.74 |
| PF06189 | 5-nucleotidase | 0.74 |
| PF01874 | CitG | 0.74 |
| PF14559 | TPR_19 | 0.74 |
| PF00392 | GntR | 0.74 |
| PF15780 | ASH | 0.74 |
| PF13565 | HTH_32 | 0.74 |
| PF03279 | Lip_A_acyltrans | 0.74 |
| PF00908 | dTDP_sugar_isom | 0.74 |
| PF03480 | DctP | 0.74 |
| PF01641 | SelR | 0.74 |
| PF07228 | SpoIIE | 0.74 |
| PF08546 | ApbA_C | 0.74 |
| PF00293 | NUDIX | 0.74 |
| PF14907 | NTP_transf_5 | 0.74 |
| PF00497 | SBP_bac_3 | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 7.41 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 1.48 |
| COG3300 | MHYT domain, NO-binding membrane sensor | Signal transduction mechanisms [T] | 1.48 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 1.48 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 1.48 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.74 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.74 |
| COG4269 | Uncharacterized membrane protein YjgN, DUF898 family | Function unknown [S] | 0.74 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.74 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.74 |
| COG4094 | Uncharacterized membrane protein | Function unknown [S] | 0.74 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.74 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.74 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.74 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.74 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.74 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.74 |
| COG1767 | Triphosphoribosyl-dephospho-CoA synthetase | Coenzyme transport and metabolism [H] | 0.74 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.74 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.74 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.74 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.74 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.74 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.74 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.74 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.19% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.70% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.22% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.22% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.48% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.74% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.74% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009711 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_02169140 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MRADTNHRYTTSLAVRDQMVAKGYVPEGSGAAGRVFCAPL |
| F14TC_1022578502 | 3300000559 | Soil | GVPIYRVWNKRKDANHRYTTXIAVRDQMVARGGVAVGYGPNAVVLCGLP* |
| Ga0062383_105246972 | 3300004778 | Wetland Sediment | VNRVWNRRADSNHRYTTDRALRDGMVARGYAAEGYGPDAVAMCAAP* |
| Ga0066821_10279342 | 3300005147 | Soil | TVPVYRVWNNRVDSNHRYTTSLATRDAMVAMGYVKEGYGPNFVIMCAVP* |
| Ga0070676_113790242 | 3300005328 | Miscanthus Rhizosphere | FNQRKDANHRYTTSIAIRNQMVARGGVAEGYGPNAVVLCGLA* |
| Ga0070683_1009484552 | 3300005329 | Corn Rhizosphere | DNRADANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA* |
| Ga0070690_1007028601 | 3300005330 | Switchgrass Rhizosphere | PVYRVWNKRTDSNHRYTTSMAVRDQMVARGYIAEGYGPNNVTLCALP* |
| Ga0066388_1009070611 | 3300005332 | Tropical Forest Soil | PDGNHRYTTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS* |
| Ga0070660_1018193351 | 3300005339 | Corn Rhizosphere | VWNQRYDSNHRYTTSTAIRDQMVQKGGIAEGYGPGAVALCALP* |
| Ga0070671_1008543802 | 3300005355 | Switchgrass Rhizosphere | RADTNHRYTTSLAVRDQMVAKGYVPEGSGPQAVVFCAPL* |
| Ga0070671_1010462361 | 3300005355 | Switchgrass Rhizosphere | IWNNRADSNHRYTTSMTMRDQMIAKGYVVEGYGSNGIALCALP* |
| Ga0070674_1013298721 | 3300005356 | Miscanthus Rhizosphere | VPIYRVFNQRKDANHRYTTSLAIRNQMVAKGGVAEGYGPNAVVLCGL* |
| Ga0070674_1020434891 | 3300005356 | Miscanthus Rhizosphere | WNHRADTNHRYTASRDVRDAMVAQGYVAEGSGPDVVTFCAPR* |
| Ga0070659_1012004982 | 3300005366 | Corn Rhizosphere | TTPVYRTWNQRADSNHRYTAVREIRDGMVARGYVAEGYGPDAVAMCAPR* |
| Ga0070705_1006461771 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NNRRDSNHRYTTKTAIRDQMVAKGGVAEGYGASAVALCGLP* |
| Ga0066682_108146782 | 3300005450 | Soil | PVYRVWNDRYDSNHRYTTSRTLRDQMLARGFLAEGYGADVVVMCAAQ* |
| Ga0070678_1011242211 | 3300005456 | Miscanthus Rhizosphere | PVYRVWNARADNNHRYMTDKSIRDDMVAAGGIAEGYGADMVIMCAVP* |
| Ga0070685_111291482 | 3300005466 | Switchgrass Rhizosphere | RVWNARADSNHRYTTSKSVRDQMIAKGYVAEGYGPDGVAMCAGGND* |
| Ga0068853_1004273613 | 3300005539 | Corn Rhizosphere | VPVYRVWNARTDSNHRYTTSIATRDQMVARGYIAEGYGPDNVTLCGLQ* |
| Ga0066697_102053681 | 3300005540 | Soil | RADTNHRYTTSLAIRAQMLAKGYIAEGYGPNAVSMCAAQAG* |
| Ga0066697_102063882 | 3300005540 | Soil | LIPLYRVWNQRTDSNHRYVTDRHVRDQMVAARGYVAEGYGPNAVTMCVTPFFDC* |
| Ga0066697_106793451 | 3300005540 | Soil | VYRVWNDRYDSNHRYTTSRTLRDQMLARGYLAEGYGADVVVMCAAQ* |
| Ga0070686_1003647581 | 3300005544 | Switchgrass Rhizosphere | GGVPIYRVFNQRKDVNHRYTTSTAIRDQMVAKGGVAEGYGANAVALCGLP* |
| Ga0070665_1022966142 | 3300005548 | Switchgrass Rhizosphere | APIYRVWNNRSDSNHRYVKDRALRDSMVAKGYVAEGYGPDGVIMCAAQ* |
| Ga0070704_1021089282 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | NVPVYRTWNGRADSNHRYMTSMPMRDQMIAKGHIAEGYGPNNVTLCALQ* |
| Ga0066707_103908993 | 3300005556 | Soil | DSNHRYTTSLTIRSQMLAKGYLAEGYGPVPVSMCAAW* |
| Ga0068857_1025353421 | 3300005577 | Corn Rhizosphere | HRYTTSLAIRNQMVAKGGIAEGYGPNAVVLCGLP* |
| Ga0068854_1017583232 | 3300005578 | Corn Rhizosphere | SNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP* |
| Ga0070702_1017800711 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VWNNRADSNHRYTTSIADRDAMVAKGYVKEGYGPQSVTLCALP* |
| Ga0068852_1004630063 | 3300005616 | Corn Rhizosphere | IWNKRTDSNHRYTTKSAIRDQMVAKGGIAEGYGPNAVALCGLP* |
| Ga0068859_1026001222 | 3300005617 | Switchgrass Rhizosphere | NRRRDSNHRYTTSATIRDQMVQKGGIAEGYGPNAVALCALQ* |
| Ga0066903_1065667092 | 3300005764 | Tropical Forest Soil | NRADTNHRYTTSLAIRSQMLQKGYIAEGYGLTGVAMCAAQLPAAVQ* |
| Ga0066903_1070986652 | 3300005764 | Tropical Forest Soil | IYRVWNNRADSNHRYTPSRTIRDQMVAKGYIAEGYGPDNVTLCGLP* |
| Ga0068851_105988072 | 3300005834 | Corn Rhizosphere | SSGVAIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPNSVTLCAVP* |
| Ga0068863_1004654822 | 3300005841 | Switchgrass Rhizosphere | NHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP* |
| Ga0068860_1009602993 | 3300005843 | Switchgrass Rhizosphere | VYRVWNQRRDSNHRYTTSVAIRDQMVAKGGVAEGYGANAVALCGLP* |
| Ga0068862_1024178072 | 3300005844 | Switchgrass Rhizosphere | REDSNHRYTTSIAIRDQMVAKGGVAEGYGPNSVALCGLS* |
| Ga0097621_1018068182 | 3300006237 | Miscanthus Rhizosphere | NQRKDANHRYATSIAIRDEMVSRGGVAEGYGPTSVALCALP* |
| Ga0068871_1012694742 | 3300006358 | Miscanthus Rhizosphere | RADANHRYTTSLAVRDQMVAKGYVPEGSGPDAVVFCAPL* |
| Ga0068871_1017355022 | 3300006358 | Miscanthus Rhizosphere | SGGVPIYRIFNQRKDANHRYTTSVVIRDQMVARGGVAEGYGPNAVALCGLP* |
| Ga0066665_112448751 | 3300006796 | Soil | NRADTNHRYTTSPTIRSQMIAKGYIPEGYGPNAVAMCAAL* |
| Ga0079220_112014372 | 3300006806 | Agricultural Soil | VYRVWNARPDSNHRYTTQAAIRDQMVARGGIAEGYGPDAVSMCVPQ* |
| Ga0075424_1003217513 | 3300006904 | Populus Rhizosphere | SGHRYMTSRAVRDQMVAEGYIAEGYGNDQVAFCAPQ* |
| Ga0074063_123330571 | 3300006953 | Soil | PVYRVWNNRADSNHRYTTSIAIRDQMVAKGGIAEGYGPNNVIMCAAP* |
| Ga0074063_137844631 | 3300006953 | Soil | DSNHRYTTSVATRDAMVAMGYVKEGYGPNFVIMCAVP* |
| Ga0079219_115114631 | 3300006954 | Agricultural Soil | RADANHRYTTSTVIRDQMVARGYIAEGYGPNNVTLCGLP* |
| Ga0099829_109280462 | 3300009038 | Vadose Zone Soil | NRADTNHRYTTSLTIRSQMLAKGYVAEGYGPNPVSMCAAW* |
| Ga0111539_135180411 | 3300009094 | Populus Rhizosphere | NAAPVYRIWNQRSDSNHRYTIDPSIRDRMVREGGVAEGYGPNAVALCGLP* |
| Ga0105245_121675812 | 3300009098 | Miscanthus Rhizosphere | YRVWNRRADANHRYTTSTAIRDQMVQRGGVAEGFGPNPVALCALP* |
| Ga0075418_113807931 | 3300009100 | Populus Rhizosphere | ASGGLPIYRVWNNRTDSNHRYTTSIADRDAMVAKGYIKEGYGVNAVTLCAVP* |
| Ga0075418_115673991 | 3300009100 | Populus Rhizosphere | DNNHRYTTDKGIRDQMIVAGGIAEGYGPDAVIMCAAP* |
| Ga0105243_116881381 | 3300009148 | Miscanthus Rhizosphere | VPIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP* |
| Ga0105248_122796672 | 3300009177 | Switchgrass Rhizosphere | DSNHRYTTSKGIRDQMIVQGHVAEGYGPDGVALCALQ* |
| Ga0105248_129485982 | 3300009177 | Switchgrass Rhizosphere | DSNHRYTTSIAIRDAMVQKGGVAEGYGPNAVALCALP* |
| Ga0116188_13245072 | 3300009658 | Anaerobic Digestor Sludge | YRVLNGRRDANHRYVASRALRDSMVAAGWIAEGYGPAQVAMCSPARSAP* |
| Ga0116166_11621431 | 3300009711 | Anaerobic Digestor Sludge | NHRYTTSTTVRAQMEAAGWIREGYGPNATIMCAVGAP* |
| Ga0116154_101837591 | 3300009776 | Anaerobic Digestor Sludge | PDTNHRYTSDRAVRDAMVALGYVAEGSGPDIVTFCAPR* |
| Ga0131092_104703743 | 3300009870 | Activated Sludge | HRYTTDIAVRDAMVAKGYVAEGSGPNAVTFCSPQ* |
| Ga0126314_112310052 | 3300010042 | Serpentine Soil | SNHRYTTSTAVRDQMVARGGVAEGYGPNAVALCGLP* |
| Ga0105239_118135461 | 3300010375 | Corn Rhizosphere | RADTNHRYTTSLSLRDTMVAQGYVSEGYGPYGVAFCVPTF* |
| Ga0126383_112420762 | 3300010398 | Tropical Forest Soil | MTLFTTSSAIRAQMEAMGWVAEGYGPGQVIMCAAQ* |
| Ga0134127_115276461 | 3300010399 | Terrestrial Soil | RRPDTNHRYTTSAAVRDQMVAAGGVAEGYGPNAVAMCAPR* |
| Ga0136623_104097302 | 3300012045 | Polar Desert Sand | VWNNRADSNHRYTTDRTIREAMVAKGGVAEGYGVVGVSMCAIP* |
| Ga0136634_102804981 | 3300012046 | Polar Desert Sand | ADSNHRYTTDPAIRDMMVAQGGIAEGYGPDRVIMCAPQ* |
| Ga0137384_114405483 | 3300012357 | Vadose Zone Soil | VWNDRADSNHRYTTDRATRDAMVAMGYIAEGYGPTQVSMCAAQAG* |
| Ga0138256_102422551 | 3300012533 | Active Sludge | RAWNRRPDTNHRYTSERSVRDAMVALGYLAEGSGPDVVTFCAPR* |
| Ga0157282_101895381 | 3300012904 | Soil | NHRYTTSLAVRDQMVNKGYVPEGSGPDAVVFCAPL* |
| Ga0157310_102183633 | 3300012916 | Soil | SNHRYTTSIADRDAMVAKGYVKEGYGPNSVTLCALP* |
| Ga0157374_129079781 | 3300013296 | Miscanthus Rhizosphere | VPVYRVFNQRTDANHRYTTSIAIRDQMVAKGGIAEGYGPNAITLCGLP* |
| Ga0163162_114631661 | 3300013306 | Switchgrass Rhizosphere | DANHRYTTSIAIRDEMVARGGVAEGYGPNAVVLCGLP* |
| Ga0163162_119350061 | 3300013306 | Switchgrass Rhizosphere | SNHRYTSKIAIRDQMVARGGIAEGYGPNAVVLCGLP* |
| Ga0163162_128917102 | 3300013306 | Switchgrass Rhizosphere | DSNHRYTTKTSIRDQMVAKGGVAEGYGANAVALCALP* |
| Ga0163162_128955281 | 3300013306 | Switchgrass Rhizosphere | PAGDVPVYRVWNQRYDSNHRYTTSTAIRDQMVQKGGVAEGYGPTAVALCALP* |
| Ga0163162_129059331 | 3300013306 | Switchgrass Rhizosphere | VPIYRIFNQRADVNHRYTTSTAIRDQMVAKGGVAEGYGPNAVTLCGLP* |
| Ga0157372_132477991 | 3300013307 | Corn Rhizosphere | ADTNHRYTTSLSLRDTMVAQGYVSEGYGPYGVAFCVPTF* |
| Ga0163163_105915894 | 3300014325 | Switchgrass Rhizosphere | DANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA* |
| Ga0182008_102983302 | 3300014497 | Rhizosphere | TDANHRYTTSIAIRDQMVARGGIGEGYGPNAVALCGLP* |
| Ga0182008_103786511 | 3300014497 | Rhizosphere | TCAPGQIAVYRVWNARRDSDHRYTTQVAIRDAMVARGGIAEGYGPDAVAMCAPQ* |
| Ga0157376_102736774 | 3300014969 | Miscanthus Rhizosphere | VPIYRVFNQRKDANHRYTTSTAIRDQMVAKGGVAEGYGPNAVALCGLH* |
| Ga0157376_130930371 | 3300014969 | Miscanthus Rhizosphere | IWNQRSDSNHRYTIDPSIRDRMVREGGAAEGYGPNAVALCGLP* |
| Ga0173483_106124311 | 3300015077 | Soil | PIYRVWNNRADSNHRYTTTIADRDAMVAKGYIKEGYGPNAVTLCALP* |
| Ga0173478_105939402 | 3300015201 | Soil | VWNQRRDSNHRYTTSVAIRYQMVAKGGVAEGYGPNAV |
| Ga0132258_113037033 | 3300015371 | Arabidopsis Rhizosphere | ARVDSNHRYTTSPAIRDLMRAQGYVAEGSGSGVVAMCVGGGLGNE* |
| Ga0182032_107961781 | 3300016357 | Soil | RPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS |
| Ga0182034_100520921 | 3300016371 | Soil | PDGNHRYTTDPAIRDQMVAAGGIAEGYGPNAVIMCAPQ |
| Ga0136617_113554021 | 3300017789 | Polar Desert Sand | VWNNRADSNHRYTTDPAIRDAMVALGGIAEGYGPDRVIMCAPQ |
| Ga0163161_119850731 | 3300017792 | Switchgrass Rhizosphere | QRKDANHRYTTSIAIRDQMVARGGVAEGYGPNAVVLCGLP |
| Ga0190270_112357411 | 3300018469 | Soil | NHRYVTSRALRDQMLYRGYIAEGYGTDEVIMCAGG |
| Ga0190274_127085721 | 3300018476 | Soil | NTTPIYRVWNKRVDSNHRYLANRALRDVMVARGYVAEGYGPDAVVMCGP |
| Ga0190271_108406893 | 3300018481 | Soil | VYRTWNRRADTNHRYTSNIGVRDQMVALGHVAEGSGPNVVTFCAPL |
| Ga0190271_112633972 | 3300018481 | Soil | PQNMVPVYRLWNNRSDSNHRYTNHRSTRDEMVAKGYVVEGYGVDPVIMCGAP |
| Ga0190271_138240702 | 3300018481 | Soil | YVPVYRVWNNRGDSNHRYMTDKALRDSMVAAGGIAEGYGPDQVILCAAP |
| Ga0173479_101770812 | 3300019362 | Soil | VWNRRLADTNHRYTASRAIRDAMVAQGYVAEGSGPDVVTFCAPR |
| Ga0209310_12117811 | 3300025715 | Anaerobic Digestor Sludge | PDTNHRYTSDRAVRDAMVALGYVAEGSGPDIVTFCAPR |
| Ga0207654_101055812 | 3300025911 | Corn Rhizosphere | VFDNRADANHRYTTSRAIRDQMVALGYIAEGYGNDAVIMCAAA |
| Ga0207662_112574762 | 3300025918 | Switchgrass Rhizosphere | RRDSNHRYTTSVAIRDQMVAKGGVAEGYGANAVALCGLP |
| Ga0207646_104442071 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DTNHRYTTSLAIRSQMIAKGYIPEGYGPNSVGMCAAL |
| Ga0207659_102022471 | 3300025926 | Miscanthus Rhizosphere | SGVAIYRVWNNRADSNHRYTTSIADRDAMVAKGYIKEGYGPNSVTLCAVP |
| Ga0207644_115636582 | 3300025931 | Switchgrass Rhizosphere | DTNHRYTTSAAVRDQMVAAGGVAEGYGPNAVAMCAPR |
| Ga0207686_100327204 | 3300025934 | Miscanthus Rhizosphere | PDTNHRYTTSAAVRDEMVAAGGVAEGYGPNAVAMCAPR |
| Ga0207711_117019661 | 3300025941 | Switchgrass Rhizosphere | RIWNQRRDSNHRYTTSIAIRDAMVQKGGVAEGYGPNAVALCALP |
| Ga0207651_103799472 | 3300025960 | Switchgrass Rhizosphere | NRADSNHRYTTSIADRDAMVAKGYIKEGYGPQSVTLCALP |
| Ga0207668_108751492 | 3300025972 | Switchgrass Rhizosphere | TNHRYTTSQEIRDRMVVRGYVAEGYGPSPVAWCVAP |
| Ga0207639_112518572 | 3300026041 | Corn Rhizosphere | RDSNHRYTTKIAIRDQMVAKGGVAEGYGPNAVALCGLP |
| Ga0207708_117731302 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RADTNHRYTSSRTVRDTMVAQGYVAEGSGPDIVTFCAPR |
| Ga0207708_119016021 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | RLDSNHRYTTSIATRNQMIAKGHVAEGYGPNAVALCGLS |
| Ga0207641_100887252 | 3300026088 | Switchgrass Rhizosphere | VWNQRADSNHRYVTTLGLRDQMVAKGYVAEGYGPNAVTLCASQ |
| Ga0207683_108597952 | 3300026121 | Miscanthus Rhizosphere | NHRPDTGHRYTIDPAVRDQMVALGYVPEGAGPQAVAMCAPA |
| Ga0209375_13174742 | 3300026329 | Soil | VYRVWNDRYDSNHRYTTSRTLRDQMLARGFLAEGYGADVVVMCAAQ |
| Ga0209966_10106981 | 3300027695 | Arabidopsis Thaliana Rhizosphere | RPDTNHRYTTDIGVRDGMVAKGYIAEGSGPDAVTFCAPL |
| Ga0209465_103379602 | 3300027874 | Tropical Forest Soil | PDGNHRYTTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS |
| Ga0268265_120791631 | 3300028380 | Switchgrass Rhizosphere | VFNQRKDANHRYTTSIAIRDQMVAKGGIAEGYGPDAVVLCGLP |
| Ga0247827_111801831 | 3300028889 | Soil | VWNKRADTNHRYTTSLAVRDQMVAKGYVPEGSGPDAVVFCAPL |
| Ga0311336_111263191 | 3300029990 | Fen | VYRVWNTRRDSNHRYMTDRSLRDLMVAKGYVAEGYGQDAVIMCAPM |
| Ga0311360_100393424 | 3300030339 | Bog | SVPIYRVWNRRVDSNHRYTTDRALRDAMVARGYVAEGYGPDTVGMCGPR |
| Ga0311335_111587192 | 3300030838 | Fen | ANGVPVYRAWNGGADSNHRYMTSLAIRAQMQGRGYIAEGYGPNQVTLCALP |
| Ga0318516_101446083 | 3300031543 | Soil | DTNHRYTTSLATKQQMQATGWVAEGYGPSQVIMCAPQ |
| Ga0310915_101754453 | 3300031573 | Soil | NTIPVYRVFNNRPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS |
| Ga0318496_108295152 | 3300031713 | Soil | RVFNNRPDGNHRYSTDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS |
| Ga0310813_118185161 | 3300031716 | Soil | DTNHRYTASRAIRDAMVAQGYVAEGSGPDVVTFCAPR |
| Ga0306917_113788492 | 3300031719 | Soil | STDPAIRDQMVARGGIAEGYGPNAVIMCAPATATS |
| Ga0311351_107652312 | 3300031722 | Fen | VPVYRVWNGLAAANHRYTTRRDIRDAMVAQGWIAEGTGPNAVTMCAPQ |
| Ga0318546_112738661 | 3300031771 | Soil | GWTPVYRVWNQRADSNHRYMTDRALRDAMVAQGYVAEGYGPDAVIMCAPP |
| Ga0310885_106494662 | 3300031943 | Soil | RVFNDRHDANHRYTTSVAIRDTMVALGWRREGYGPDATIMCATSP |
| Ga0308176_103673832 | 3300031996 | Soil | VFRVWNARADSNPRYTASRSVRDTMVAAGGVAEGFGPDAVAMCAPQ |
| Ga0318575_105131751 | 3300032055 | Soil | ADTNHRYTTSLATKQQMQATGWVAEGYGPSQVIMCAPQ |
| Ga0308173_101195363 | 3300032074 | Soil | RADANHRYTTSRAIRDQMVAMGYIAEGYGDDAVIMCAPA |
| Ga0315283_105593673 | 3300032164 | Sediment | RADTNHRYMTSAAVRANMVASGWVAEGYGPDQVIMCAPK |
| Ga0315270_110137243 | 3300032275 | Sediment | PVYRVWNQRADSNHRYTADRSVRDAMVVHNYLAEGYGPDNVIMCAPA |
| Ga0315287_122133631 | 3300032397 | Sediment | AGGAAPAPRSNHRYTTSTTIRDAMVAKGGIAEGYGPNAVIMCAPQ |
| Ga0335082_101848001 | 3300032782 | Soil | WNQRVDSNHRYTTSIAIRDQMVAKGGVAEGYGPNAVALCALP |
| Ga0335079_121587221 | 3300032783 | Soil | DSNHRYTVSLTIRQQMIDAGWVAEGYGPNAVIMCAPA |
| Ga0335070_112651831 | 3300032829 | Soil | DARADTNHRYTTSTVVRAQMEAQGWVAEGYGPAQVIMCAPQ |
| Ga0335083_109496581 | 3300032954 | Soil | YRVWNQRADSNHRYTTSLALRDQMVAQGWLAEGYGPNAVVLCGVM |
| Ga0316616_1025467482 | 3300033521 | Soil | PDANHRYTTDRGVRDLMVSLGGTAEGYGDDAVIMCAPPGTSTAP |
| ⦗Top⦘ |