| Basic Information | |
|---|---|
| Family ID | F058137 |
| Family Type | Metagenome |
| Number of Sequences | 135 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKKIRSVRVSEQLWRKAQAKARAEGKTVSEVIVDFLKEFVK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 61.48 % |
| % of genes near scaffold ends (potentially truncated) | 33.33 % |
| % of genes from short scaffolds (< 2000 bps) | 73.33 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (58.519 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.259 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.03% β-sheet: 0.00% Coil/Unstructured: 57.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF09250 | Prim-Pol | 51.85 |
| PF01370 | Epimerase | 5.19 |
| PF02467 | Whib | 2.96 |
| PF13481 | AAA_25 | 2.22 |
| PF01755 | Glyco_transf_25 | 1.48 |
| PF00145 | DNA_methylase | 1.48 |
| PF12705 | PDDEXK_1 | 1.48 |
| PF05257 | CHAP | 0.74 |
| PF02945 | Endonuclease_7 | 0.74 |
| PF05135 | Phage_connect_1 | 0.74 |
| PF00589 | Phage_integrase | 0.74 |
| PF04860 | Phage_portal | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.48 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 1.48 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.63 % |
| Unclassified | root | N/A | 30.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002212|metazooDRAFT_1359992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300002408|B570J29032_109460062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
| 3300002476|metazooDRAFT_10818343 | Not Available | 628 | Open in IMG/M |
| 3300002835|B570J40625_100090162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3874 | Open in IMG/M |
| 3300004240|Ga0007787_10002464 | All Organisms → cellular organisms → Bacteria | 6698 | Open in IMG/M |
| 3300005517|Ga0070374_10652196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300005525|Ga0068877_10002409 | All Organisms → cellular organisms → Bacteria | 15106 | Open in IMG/M |
| 3300005581|Ga0049081_10111298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300005581|Ga0049081_10172842 | Not Available | 783 | Open in IMG/M |
| 3300005805|Ga0079957_1016913 | Not Available | 5223 | Open in IMG/M |
| 3300006484|Ga0070744_10092540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
| 3300006637|Ga0075461_10000208 | All Organisms → cellular organisms → Bacteria | 15829 | Open in IMG/M |
| 3300006637|Ga0075461_10041286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1507 | Open in IMG/M |
| 3300006641|Ga0075471_10605478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300006802|Ga0070749_10160616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1302 | Open in IMG/M |
| 3300006802|Ga0070749_10280210 | Not Available | 939 | Open in IMG/M |
| 3300006805|Ga0075464_10000924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13094 | Open in IMG/M |
| 3300006805|Ga0075464_10090454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1748 | Open in IMG/M |
| 3300006805|Ga0075464_10314323 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300006805|Ga0075464_10539387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 715 | Open in IMG/M |
| 3300006805|Ga0075464_10599686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300006917|Ga0075472_10174121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
| 3300006917|Ga0075472_10328311 | Not Available | 755 | Open in IMG/M |
| 3300006920|Ga0070748_1131469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 938 | Open in IMG/M |
| 3300007216|Ga0103961_1353656 | Not Available | 1260 | Open in IMG/M |
| 3300007538|Ga0099851_1024086 | All Organisms → cellular organisms → Bacteria | 2457 | Open in IMG/M |
| 3300007538|Ga0099851_1055143 | Not Available | 1557 | Open in IMG/M |
| 3300007734|Ga0104986_1719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25775 | Open in IMG/M |
| 3300007973|Ga0105746_1291257 | Not Available | 565 | Open in IMG/M |
| 3300008055|Ga0108970_11286181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2188 | Open in IMG/M |
| 3300008107|Ga0114340_1077036 | Not Available | 1387 | Open in IMG/M |
| 3300008107|Ga0114340_1158970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300008113|Ga0114346_1083270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
| 3300008114|Ga0114347_1060623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
| 3300008266|Ga0114363_1006866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5656 | Open in IMG/M |
| 3300008266|Ga0114363_1012289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7035 | Open in IMG/M |
| 3300008266|Ga0114363_1031019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3427 | Open in IMG/M |
| 3300008266|Ga0114363_1090881 | Not Available | 1116 | Open in IMG/M |
| 3300008266|Ga0114363_1118783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300008266|Ga0114363_1125422 | Not Available | 886 | Open in IMG/M |
| 3300008266|Ga0114363_1191460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300008450|Ga0114880_1067028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1467 | Open in IMG/M |
| 3300008450|Ga0114880_1100414 | All Organisms → Viruses → Predicted Viral | 1119 | Open in IMG/M |
| 3300008450|Ga0114880_1132385 | Not Available | 921 | Open in IMG/M |
| 3300009155|Ga0114968_10001932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15951 | Open in IMG/M |
| 3300009158|Ga0114977_10415971 | Not Available | 747 | Open in IMG/M |
| 3300009158|Ga0114977_10437945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300010354|Ga0129333_10025566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5596 | Open in IMG/M |
| 3300010370|Ga0129336_10202057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
| 3300011984|Ga0119931_1036447 | Not Available | 589 | Open in IMG/M |
| 3300012012|Ga0153799_1073947 | Not Available | 614 | Open in IMG/M |
| 3300012017|Ga0153801_1010014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300013004|Ga0164293_10003125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14121 | Open in IMG/M |
| 3300013004|Ga0164293_10861562 | Not Available | 571 | Open in IMG/M |
| 3300013004|Ga0164293_11032845 | Not Available | 511 | Open in IMG/M |
| 3300013087|Ga0163212_1047680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1448 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10115495 | Not Available | 1851 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10353042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10434684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10354690 | Not Available | 927 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10839525 | Not Available | 535 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10272868 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300013372|Ga0177922_10121596 | Not Available | 767 | Open in IMG/M |
| 3300013372|Ga0177922_11211369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10494271 | Not Available | 686 | Open in IMG/M |
| 3300017722|Ga0181347_1198237 | Not Available | 529 | Open in IMG/M |
| 3300017736|Ga0181365_1126862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300017766|Ga0181343_1071697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
| 3300017778|Ga0181349_1000286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21402 | Open in IMG/M |
| 3300017784|Ga0181348_1145364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300017785|Ga0181355_1279898 | Not Available | 632 | Open in IMG/M |
| 3300018815|Ga0187845_1288760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300018868|Ga0187844_10030970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2638 | Open in IMG/M |
| 3300019784|Ga0181359_1000086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17986 | Open in IMG/M |
| 3300019784|Ga0181359_1090083 | Not Available | 1138 | Open in IMG/M |
| 3300020083|Ga0194111_10483246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300020084|Ga0194110_10746294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
| 3300020159|Ga0211734_11355141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300020161|Ga0211726_10490141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300020183|Ga0194115_10172929 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300020190|Ga0194118_10313149 | Not Available | 833 | Open in IMG/M |
| 3300020190|Ga0194118_10551713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300020193|Ga0194131_10082952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1838 | Open in IMG/M |
| 3300020570|Ga0208465_1021052 | Not Available | 859 | Open in IMG/M |
| 3300020578|Ga0194129_10403586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300020578|Ga0194129_10510473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300021091|Ga0194133_10423580 | Not Available | 727 | Open in IMG/M |
| 3300021092|Ga0194122_10420558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300021962|Ga0222713_10031979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4229 | Open in IMG/M |
| 3300021962|Ga0222713_10375292 | Not Available | 882 | Open in IMG/M |
| 3300021963|Ga0222712_10049095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3167 | Open in IMG/M |
| 3300021963|Ga0222712_10250705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1132 | Open in IMG/M |
| 3300022190|Ga0181354_1099380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
| 3300022198|Ga0196905_1008793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3405 | Open in IMG/M |
| 3300022200|Ga0196901_1061640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
| 3300022407|Ga0181351_1048870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1770 | Open in IMG/M |
| 3300022752|Ga0214917_10001938 | All Organisms → cellular organisms → Bacteria | 25941 | Open in IMG/M |
| 3300023174|Ga0214921_10002940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26896 | Open in IMG/M |
| 3300025445|Ga0208424_1000399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5285 | Open in IMG/M |
| 3300025630|Ga0208004_1000462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15820 | Open in IMG/M |
| 3300025655|Ga0208795_1069356 | Not Available | 997 | Open in IMG/M |
| 3300025655|Ga0208795_1084895 | Not Available | 871 | Open in IMG/M |
| 3300025896|Ga0208916_10000979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12565 | Open in IMG/M |
| 3300025896|Ga0208916_10010312 | Not Available | 3637 | Open in IMG/M |
| 3300027130|Ga0255089_1046996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300027659|Ga0208975_1064886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
| 3300027759|Ga0209296_1059039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
| 3300027764|Ga0209134_10314632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027785|Ga0209246_10236202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300027963|Ga0209400_1031453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2947 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1022307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4473 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1191599 | Not Available | 844 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1293810 | Not Available | 545 | Open in IMG/M |
| 3300031758|Ga0315907_10002694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21993 | Open in IMG/M |
| 3300031787|Ga0315900_10070417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3558 | Open in IMG/M |
| 3300031857|Ga0315909_10042706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4269 | Open in IMG/M |
| 3300031857|Ga0315909_10250445 | Not Available | 1360 | Open in IMG/M |
| 3300031857|Ga0315909_10548758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300031951|Ga0315904_10900352 | Not Available | 714 | Open in IMG/M |
| 3300031963|Ga0315901_10132254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2255 | Open in IMG/M |
| 3300032093|Ga0315902_10375979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300033482|Ga0316627_100607915 | Not Available | 997 | Open in IMG/M |
| 3300033993|Ga0334994_0168489 | All Organisms → Viruses → Predicted Viral | 1214 | Open in IMG/M |
| 3300033996|Ga0334979_0000761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24291 | Open in IMG/M |
| 3300033996|Ga0334979_0091823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1902 | Open in IMG/M |
| 3300033996|Ga0334979_0134963 | Not Available | 1506 | Open in IMG/M |
| 3300033996|Ga0334979_0614715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
| 3300034062|Ga0334995_0065431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2887 | Open in IMG/M |
| 3300034062|Ga0334995_0622125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300034073|Ga0310130_0089906 | Not Available | 919 | Open in IMG/M |
| 3300034073|Ga0310130_0269639 | Not Available | 538 | Open in IMG/M |
| 3300034106|Ga0335036_0018089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5696 | Open in IMG/M |
| 3300034112|Ga0335066_0381420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300034272|Ga0335049_0784877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300034283|Ga0335007_0624409 | Not Available | 618 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 20.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.04% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.11% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.37% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.70% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.48% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.48% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.48% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.74% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.74% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.74% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.74% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.74% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.74% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027130 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_13599922 | 3300002212 | Lake | MKKIRSVRVSDQLWARAKAKAQSEGKTISEVIVDYLKEFVK* |
| B570J29032_1094600625 | 3300002408 | Freshwater | MIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| metazooDRAFT_108183431 | 3300002476 | Lake | MKKIRSVRVSDKLWAQAKAKARSEGKTVSEVIVDYLKEFVK* |
| B570J40625_1000901629 | 3300002835 | Freshwater | MCGVVMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0007787_100024643 | 3300004240 | Freshwater Lake | MKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFIK* |
| Ga0070374_106521961 | 3300005517 | Freshwater Lake | VVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0068877_1000240918 | 3300005525 | Freshwater Lake | MKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK* |
| Ga0049081_101112983 | 3300005581 | Freshwater Lentic | MKKIRSIRVSEQLWRRAQAKARAEGKSLSEAINDFLKEYVK* |
| Ga0049081_101728422 | 3300005581 | Freshwater Lentic | MKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFVK* |
| Ga0079957_10169136 | 3300005805 | Lake | MKKIRSVRVSDQLWARAKAKARAEGKTVSEVIVDFLKEFVK* |
| Ga0070744_100925403 | 3300006484 | Estuarine | MTPKPARSVRVSQKLWQQAKAKAKSEGKTVSEIIIDSLKEYVK* |
| Ga0075461_1000020812 | 3300006637 | Aqueous | VKKIRSVRVSDQLWARAKAKARSEGKTISEVIVDFLKEFVK* |
| Ga0075461_100412862 | 3300006637 | Aqueous | MKKIRSVRVSEQLWRRAQAKAKAEGKTVSEVIVDFLKEFVK* |
| Ga0075471_106054781 | 3300006641 | Aqueous | VRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK* |
| Ga0070749_101606162 | 3300006802 | Aqueous | MKKIRSIRVSEQLWRKAMAKAKSEGTTVSEVIVDFLKEFVK* |
| Ga0070749_102802103 | 3300006802 | Aqueous | MKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFL |
| Ga0075464_1000092423 | 3300006805 | Aqueous | MKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK* |
| Ga0075464_100904544 | 3300006805 | Aqueous | MKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFVK* |
| Ga0075464_103143232 | 3300006805 | Aqueous | MKKIRSVRVSDQLWRRAQAKARSEGKTVSEAINDFLKEFIK* |
| Ga0075464_105393871 | 3300006805 | Aqueous | VKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0075464_105996863 | 3300006805 | Aqueous | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0075472_101741215 | 3300006917 | Aqueous | MKKIRSVRVSEQLWRTAQAKGKGEGKTVSEVIVDFLKEFV |
| Ga0075472_103283111 | 3300006917 | Aqueous | MKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEF |
| Ga0070748_11314691 | 3300006920 | Aqueous | MKKIRSVRVSEQLWRKAQAKARAEGKTVSEVIVDFLKEFVK* |
| Ga0103961_13536564 | 3300007216 | Freshwater Lake | MKKIRSIRVSDQLWAKAKAKARSEGKTVSEVVVDFLKEFVK |
| Ga0099851_10240864 | 3300007538 | Aqueous | MKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK* |
| Ga0099851_10551433 | 3300007538 | Aqueous | VIGKKKRSVRVSDQVWFKAKAKAALEGTTVSEVIVDFLKGYIK* |
| Ga0104986_171927 | 3300007734 | Freshwater | MVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKGYIK* |
| Ga0105746_12912573 | 3300007973 | Estuary Water | MKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK* |
| Ga0108970_112861812 | 3300008055 | Estuary | MKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFIK* |
| Ga0114340_10770361 | 3300008107 | Freshwater, Plankton | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKG |
| Ga0114340_11589703 | 3300008107 | Freshwater, Plankton | GKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0114346_10832704 | 3300008113 | Freshwater, Plankton | MCGVVMVGKKIRSVRVSDQVWAKAKEKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0114347_10606231 | 3300008114 | Freshwater, Plankton | VRLSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK* |
| Ga0114363_10068665 | 3300008266 | Freshwater, Plankton | MKKIRSVRVSDQLWRKAQARARAEGKSLSEAINDFLKEYVK* |
| Ga0114363_101228913 | 3300008266 | Freshwater, Plankton | MKKIRSIRVSEQLWRRAMVKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0114363_10310195 | 3300008266 | Freshwater, Plankton | MTGKKARSVRVSDQVWAKAKAKAKEEGTTVSELIVDFLKAYIK* |
| Ga0114363_10908813 | 3300008266 | Freshwater, Plankton | MKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFV |
| Ga0114363_11187831 | 3300008266 | Freshwater, Plankton | KKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK* |
| Ga0114363_11254224 | 3300008266 | Freshwater, Plankton | MYGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0114363_11914603 | 3300008266 | Freshwater, Plankton | KIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0114880_10670284 | 3300008450 | Freshwater Lake | MKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0114880_11004145 | 3300008450 | Freshwater Lake | MKKIRSVRVSDQLWRKARAKARAEGKSLSEAINDFLKE |
| Ga0114880_11323851 | 3300008450 | Freshwater Lake | MKKIRSIRISEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0114968_1000193212 | 3300009155 | Freshwater Lake | MVGKKIRSVRVSEQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK* |
| Ga0114977_104159711 | 3300009158 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKAKAKSEGKSVSEVIVDFLKGYIK* |
| Ga0114977_104379452 | 3300009158 | Freshwater Lake | MVGKKVRSVRVSDQLWARAMAKARSEGKSVSEVIVDFLKGYIK* |
| Ga0129333_1002556612 | 3300010354 | Freshwater To Marine Saline Gradient | VQVQQEGEEMKKIRSIRVSDQLWAKAKAKARAEGKTLSEVVVDFLKEFVK* |
| Ga0129336_102020571 | 3300010370 | Freshwater To Marine Saline Gradient | MNKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK* |
| Ga0119931_10364472 | 3300011984 | Drinking Water Treatment Plant | MKKIRSIRVSEQLWRRAMAKAKSEGKTVSEVIVDFLKEFVK* |
| Ga0153799_10739472 | 3300012012 | Freshwater | MKKIRSIRVSEQLWRKAQAKARAEGKTVSEAINDFLKEYVK* |
| Ga0153801_10100141 | 3300012017 | Freshwater | VMKLKKIRSVRVSDQLWRKAQAKARSEGKTVSEAINDFLKEFVK* |
| Ga0164293_1000312513 | 3300013004 | Freshwater | MVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKEYIK* |
| Ga0164293_108615622 | 3300013004 | Freshwater | MKKIRSVRVSDQLWRKAQAKAKSEGKTVSEAINDFLKEFIK* |
| Ga0164293_110328452 | 3300013004 | Freshwater | MKKIRSIRVSEQLWRRAQAKARAEGKTVSEAINDFLKEYVK* |
| Ga0163212_10476801 | 3300013087 | Freshwater | LKAKVMSLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK* |
| (restricted) Ga0172367_101154956 | 3300013126 | Freshwater | VQVQQEGEEMKKIRSIRVSDQLWAKAQAKARAEGKSLSEAINDFLKQYVK* |
| (restricted) Ga0172367_103530423 | 3300013126 | Freshwater | MKKIRSIRVSEQLWRKAQAKARAEGKSLSEAINDFLKGYVK* |
| (restricted) Ga0172367_104346843 | 3300013126 | Freshwater | SVQVQQEGEEMKKIRSIRVSDQLWAKAQAKARAEGKSLSEAINDFLKQYVK* |
| (restricted) Ga0172373_103546901 | 3300013131 | Freshwater | MTGKKARSVRVSDQVWAKAKAKAKAEGMTVSEVIVDF |
| (restricted) Ga0172373_108395251 | 3300013131 | Freshwater | MKKIRSVRVSDQLWRKAQAKAKAEGKSLSEAINDFLKGY |
| (restricted) Ga0172372_102728681 | 3300013132 | Freshwater | MTGKKARSVRVSDQVWAKAKAKAKAEGMTVSEVIVDFLKAYIK* |
| Ga0177922_101215964 | 3300013372 | Freshwater | MKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK* |
| Ga0177922_112113692 | 3300013372 | Freshwater | MKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFIK* |
| (restricted) Ga0172376_104942713 | 3300014720 | Freshwater | MKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKGYVK* |
| Ga0181347_11982371 | 3300017722 | Freshwater Lake | MKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKE |
| Ga0181365_11268621 | 3300017736 | Freshwater Lake | NRSVRIAEQLWRKAQAKAKAEGKTASEVIVDFLKEYIK |
| Ga0181343_10716972 | 3300017766 | Freshwater Lake | MVGKKIRSVRVSDQLWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0181349_10002862 | 3300017778 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKSKAKSEGKSVSEVIVDFLKGYIK |
| Ga0181348_11453641 | 3300017784 | Freshwater Lake | SKAKVMKLKKIRSVRVSDQLWRRAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0181355_12798982 | 3300017785 | Freshwater Lake | MKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFIK |
| Ga0187845_12887601 | 3300018815 | Freshwater | MCVVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSLSEVIVDFLKGYIK |
| Ga0187844_100309703 | 3300018868 | Freshwater | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSLSEVIVDFLKGYIK |
| Ga0181359_100008610 | 3300019784 | Freshwater Lake | MCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0181359_10900832 | 3300019784 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0194111_104832462 | 3300020083 | Freshwater Lake | MKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194110_107462943 | 3300020084 | Freshwater Lake | MKAKEMKMKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0211734_113551413 | 3300020159 | Freshwater | MVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKGYIK |
| Ga0211726_104901411 | 3300020161 | Freshwater | GWCIMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0194115_101729295 | 3300020183 | Freshwater Lake | MKKIRSIRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194118_103131491 | 3300020190 | Freshwater Lake | MNLLKAKVMKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194118_105517132 | 3300020190 | Freshwater Lake | VRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194131_100829525 | 3300020193 | Freshwater Lake | MNLMKAKVMKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0208465_10210522 | 3300020570 | Freshwater | MKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFIK |
| Ga0194129_104035861 | 3300020578 | Freshwater Lake | KIRSVRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194129_105104732 | 3300020578 | Freshwater Lake | LKKIRSVRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194133_104235802 | 3300021091 | Freshwater Lake | MKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0194122_104205583 | 3300021092 | Freshwater Lake | MNLMKAKVMSLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK |
| Ga0222713_100319792 | 3300021962 | Estuarine Water | MTPKPARSVRVSQKLWQQAKAKAKSEGKTVSEIIIDSLKEYVK |
| Ga0222713_103752925 | 3300021962 | Estuarine Water | MKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFV |
| Ga0222712_1004909510 | 3300021963 | Estuarine Water | MVGKKIRSVRVSDQLWRKAMAKAHSEGKSVSEVIVDFLKGYIK |
| Ga0222712_102507052 | 3300021963 | Estuarine Water | MKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK |
| Ga0181354_10993801 | 3300022190 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFL |
| Ga0196905_10087932 | 3300022198 | Aqueous | MKKIRSVRVSDQLWARAKARARSEGKTISEVIVDFLKEFVK |
| Ga0196901_10616401 | 3300022200 | Aqueous | MKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK |
| Ga0181351_10488708 | 3300022407 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLN |
| Ga0214917_1000193833 | 3300022752 | Freshwater | MKKIRSIRVSEQLWRRAMAKAKSEGKTVSEVIVDFLKEFVK |
| Ga0214921_1000294035 | 3300023174 | Freshwater | MCGVVMVGKKIRSVRVSDQVWAKAKSKAQSEGKSVSEVIVDFLKGYIK |
| Ga0208424_100039914 | 3300025445 | Aqueous | MKKIRSVRVSEQLWRRAQAKAKAEGKTVSEVIVDFLKEFVK |
| Ga0208004_100046223 | 3300025630 | Aqueous | VKKIRSVRVSDQLWARAKAKARSEGKTISEVIVDFLKEFVK |
| Ga0208795_10693561 | 3300025655 | Aqueous | MKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKE |
| Ga0208795_10848953 | 3300025655 | Aqueous | VIGKKKRSVRVSDQVWFKAKAKAALEGTTVSEVIVDFLKGYIK |
| Ga0208916_100009796 | 3300025896 | Aqueous | MKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0208916_100103124 | 3300025896 | Aqueous | MKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFVK |
| Ga0255089_10469961 | 3300027130 | Freshwater | MKKNRSVRIAEQLWRKAQAKAKAEGKTASEVIVDFLKEYIK |
| Ga0208975_10648864 | 3300027659 | Freshwater Lentic | NLLRAKVMKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0209296_10590394 | 3300027759 | Freshwater Lake | MVGKKIRSVRVSDQVWAKAKAKAKSEGKSVSEVIVDFLKGYIK |
| Ga0209134_103146322 | 3300027764 | Freshwater Lake | CIMKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK |
| Ga0209246_102362021 | 3300027785 | Freshwater Lake | LKKIRSVRVSDQLWRRAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0209400_10314532 | 3300027963 | Freshwater Lake | MCGVVMVGKKIRSVRVSEQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| (restricted) Ga0247834_10223071 | 3300027977 | Freshwater | MKKIRSVRVSNQLWRKAQAKARAEGKSLSEAINDFLKEYVK |
| (restricted) Ga0247839_11915994 | 3300028553 | Freshwater | MKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFL |
| (restricted) Ga0247831_12938102 | 3300028559 | Freshwater | MKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLK |
| Ga0315907_1000269418 | 3300031758 | Freshwater | MKKIRSIRVSEQLWRRAMVKAKSEGKTVSEVIVDFLKEFVK |
| Ga0315900_1007041711 | 3300031787 | Freshwater | MTGKKARSVRVSDQVWAKAKAKAKEEGTTVSELIVDFLKAYIK |
| Ga0315909_100427068 | 3300031857 | Freshwater | MKKIRSVRVSDQLWRKAQARARAEGKSLSEAINDFLKEYVK |
| Ga0315909_102504457 | 3300031857 | Freshwater | MCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFL |
| Ga0315909_105487581 | 3300031857 | Freshwater | KKGGCIMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK |
| Ga0315904_109003521 | 3300031951 | Freshwater | MKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK |
| Ga0315901_101322544 | 3300031963 | Freshwater | MKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK |
| Ga0315902_103759793 | 3300032093 | Freshwater | MKLKKIRSVRVSDQLWRKAQAKARSEGKTVSEAINDFLKEFIK |
| Ga0316627_1006079153 | 3300033482 | Soil | MQMQSKGKQMKKIRSVRVSDQLWAKAKAKAKSEGKTVSEVIVDFLKEFVK |
| Ga0334994_0168489_513_659 | 3300033993 | Freshwater | MCGVVMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0334979_0000761_14283_14414 | 3300033996 | Freshwater | MVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKEYIK |
| Ga0334979_0091823_1629_1754 | 3300033996 | Freshwater | MKKIRSIRVSEQLWRKAQAKAWSEGKTVSEAINDFLKEFIK |
| Ga0334979_0134963_7_138 | 3300033996 | Freshwater | MKLKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFIK |
| Ga0334979_0614715_439_570 | 3300033996 | Freshwater | MKLKKIRSIRVSEQLWRRAQAKARAEGKTVSEAINDFLKEYVK |
| Ga0334995_0065431_1542_1673 | 3300034062 | Freshwater | MIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0334995_0622125_244_372 | 3300034062 | Freshwater | MMKKIRSIRVSDQLWAKAKAKARSEGKTVSEVIVDYLKEFVK |
| Ga0310130_0089906_766_891 | 3300034073 | Fracking Water | VKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK |
| Ga0310130_0269639_2_106 | 3300034073 | Fracking Water | MKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDF |
| Ga0335036_0018089_3852_3998 | 3300034106 | Freshwater | MCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEDKSVSEVIVDFLKGYIK |
| Ga0335066_0381420_1_114 | 3300034112 | Freshwater | RSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0335049_0784877_74_220 | 3300034272 | Freshwater | MCGVVMVGKKIRSVRVSDQLWAKAKAKAQSEGKSVSEVIVDFLKGYIK |
| Ga0335007_0624409_491_616 | 3300034283 | Freshwater | MCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDF |
| ⦗Top⦘ |