NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058126

Metagenome / Metatranscriptome Family F058126

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058126
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 124 residues
Representative Sequence MTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Number of Associated Samples 113
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 19.40 %
% of genes near scaffold ends (potentially truncated) 47.41 %
% of genes from short scaffolds (< 2000 bps) 82.22 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.259 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.556 % of family members)
Environment Ontology (ENVO) Unclassified
(51.111 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(43.704 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.64%    β-sheet: 15.03%    Coil/Unstructured: 50.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.4.5.34: SCF ubiquitin ligase complex WHB domaind1ldja11ldj0.55777
a.4.5.0: automated matchesd6dk4a_6dk40.54672
a.4.5.0: automated matchesd5h20a_5h200.54622
a.4.5.0: automated matchesd4g9ya_4g9y0.54577
a.4.5.0: automated matchesd6fuua_6fuu0.54327


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF01192RNA_pol_Rpb6 20.00
PF05988DUF899 4.44
PF13671AAA_33 2.22
PF12867DinB_2 2.22
PF12146Hydrolase_4 1.48
PF03692CxxCxxCC 1.48
PF13474SnoaL_3 1.48
PF00271Helicase_C 1.48
PF12697Abhydrolase_6 1.48
PF00343Phosphorylase 0.74
PF03358FMN_red 0.74
PF01979Amidohydro_1 0.74
PF02517Rce1-like 0.74
PF12681Glyoxalase_2 0.74
PF14346DUF4398 0.74
PF09837DUF2064 0.74
PF00561Abhydrolase_1 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG1758DNA-directed RNA polymerase, subunit K/omegaTranscription [K] 20.00
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 4.44
COG0058Glucan phosphorylaseCarbohydrate transport and metabolism [G] 0.74
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.74
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.26 %
UnclassifiedrootN/A0.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886012|MBSR1b_contig_9675836All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3273Open in IMG/M
2228664022|INPgaii200_c0923936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium657Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101913793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium5780Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101914600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium987Open in IMG/M
3300000443|F12B_10612166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium952Open in IMG/M
3300000559|F14TC_100320038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1194Open in IMG/M
3300002244|JGI24742J22300_10110000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium538Open in IMG/M
3300003659|JGI25404J52841_10066741All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300003659|JGI25404J52841_10127608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium smegmatis537Open in IMG/M
3300004114|Ga0062593_100021932All Organisms → cellular organisms → Bacteria3402Open in IMG/M
3300004156|Ga0062589_100151400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1591Open in IMG/M
3300004801|Ga0058860_10590499All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium526Open in IMG/M
3300005093|Ga0062594_100125130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1613Open in IMG/M
3300005290|Ga0065712_10162561All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300005293|Ga0065715_10197636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1379Open in IMG/M
3300005332|Ga0066388_100093261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3443Open in IMG/M
3300005332|Ga0066388_100346487All Organisms → cellular organisms → Bacteria2132Open in IMG/M
3300005764|Ga0066903_100002775All Organisms → cellular organisms → Bacteria13908Open in IMG/M
3300005764|Ga0066903_102540107All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium992Open in IMG/M
3300005983|Ga0081540_1012717All Organisms → cellular organisms → Bacteria5518Open in IMG/M
3300006574|Ga0074056_10656821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium502Open in IMG/M
3300006575|Ga0074053_11990776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium540Open in IMG/M
3300006579|Ga0074054_11857634All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300009011|Ga0105251_10243793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium810Open in IMG/M
3300009168|Ga0105104_10000198All Organisms → cellular organisms → Bacteria45265Open in IMG/M
3300009792|Ga0126374_10103424All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1622Open in IMG/M
3300010046|Ga0126384_10575714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium982Open in IMG/M
3300010046|Ga0126384_11654576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium604Open in IMG/M
3300010046|Ga0126384_12112612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium541Open in IMG/M
3300010047|Ga0126382_11859638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium568Open in IMG/M
3300010048|Ga0126373_11522861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium734Open in IMG/M
3300010048|Ga0126373_12988334All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium527Open in IMG/M
3300010358|Ga0126370_10582860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium962Open in IMG/M
3300010360|Ga0126372_12075984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium616Open in IMG/M
3300010361|Ga0126378_10798202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1053Open in IMG/M
3300010361|Ga0126378_13204881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium520Open in IMG/M
3300010362|Ga0126377_10786314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1009Open in IMG/M
3300010366|Ga0126379_10187118All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300010366|Ga0126379_12629915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium601Open in IMG/M
3300010376|Ga0126381_102137805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium806Open in IMG/M
3300010398|Ga0126383_10473517All Organisms → cellular organisms → Bacteria → Proteobacteria1306Open in IMG/M
3300010398|Ga0126383_11431691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium781Open in IMG/M
3300010399|Ga0134127_10065940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3056Open in IMG/M
3300011107|Ga0151490_1230574All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium933Open in IMG/M
3300013297|Ga0157378_10006307All Organisms → cellular organisms → Bacteria10391Open in IMG/M
3300014497|Ga0182008_10390279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium746Open in IMG/M
3300014969|Ga0157376_10080679All Organisms → cellular organisms → Bacteria2791Open in IMG/M
3300015371|Ga0132258_10593689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2779Open in IMG/M
3300016270|Ga0182036_10709391All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium814Open in IMG/M
3300016294|Ga0182041_11139865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium709Open in IMG/M
3300016319|Ga0182033_11337831All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium644Open in IMG/M
3300016341|Ga0182035_11515578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium604Open in IMG/M
3300016357|Ga0182032_12029837All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium505Open in IMG/M
3300016371|Ga0182034_10583075All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium942Open in IMG/M
3300016422|Ga0182039_10569187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium987Open in IMG/M
3300016445|Ga0182038_10271150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1375Open in IMG/M
3300017966|Ga0187776_10886309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium647Open in IMG/M
3300021445|Ga0182009_10022367All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2415Open in IMG/M
3300021560|Ga0126371_11407718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium828Open in IMG/M
3300025912|Ga0207707_10212740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1684Open in IMG/M
3300025928|Ga0207700_11134590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium699Open in IMG/M
3300027743|Ga0209593_10000448All Organisms → cellular organisms → Bacteria19719Open in IMG/M
3300027874|Ga0209465_10045834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2086Open in IMG/M
3300031543|Ga0318516_10202445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1146Open in IMG/M
3300031543|Ga0318516_10260878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1002Open in IMG/M
3300031543|Ga0318516_10277804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium968Open in IMG/M
3300031547|Ga0310887_10312673All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium899Open in IMG/M
3300031564|Ga0318573_10490460All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium661Open in IMG/M
3300031572|Ga0318515_10573792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium600Open in IMG/M
3300031640|Ga0318555_10048139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2154Open in IMG/M
3300031640|Ga0318555_10105241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1490Open in IMG/M
3300031679|Ga0318561_10577965All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium619Open in IMG/M
3300031719|Ga0306917_11083007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium624Open in IMG/M
3300031723|Ga0318493_10070635All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1702Open in IMG/M
3300031724|Ga0318500_10228976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium897Open in IMG/M
3300031740|Ga0307468_102024295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium552Open in IMG/M
3300031744|Ga0306918_10738363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium770Open in IMG/M
3300031747|Ga0318502_10202638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1148Open in IMG/M
3300031748|Ga0318492_10163660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1127Open in IMG/M
3300031748|Ga0318492_10579399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium598Open in IMG/M
3300031751|Ga0318494_10740476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium576Open in IMG/M
3300031763|Ga0318537_10341844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium553Open in IMG/M
3300031768|Ga0318509_10785232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium527Open in IMG/M
3300031768|Ga0318509_10833628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium510Open in IMG/M
3300031769|Ga0318526_10458941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium520Open in IMG/M
3300031770|Ga0318521_10471101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium753Open in IMG/M
3300031771|Ga0318546_10088099All Organisms → cellular organisms → Bacteria → Proteobacteria2016Open in IMG/M
3300031777|Ga0318543_10122625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1129Open in IMG/M
3300031793|Ga0318548_10533409All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium573Open in IMG/M
3300031796|Ga0318576_10496132All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium576Open in IMG/M
3300031798|Ga0318523_10258506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium870Open in IMG/M
3300031799|Ga0318565_10094082All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1434Open in IMG/M
3300031799|Ga0318565_10390642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium675Open in IMG/M
3300031805|Ga0318497_10512037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium672Open in IMG/M
3300031821|Ga0318567_10540304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium662Open in IMG/M
3300031835|Ga0318517_10280743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium752Open in IMG/M
3300031846|Ga0318512_10732481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium508Open in IMG/M
3300031890|Ga0306925_11749027All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium598Open in IMG/M
3300031893|Ga0318536_10210587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium989Open in IMG/M
3300031912|Ga0306921_10996598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium945Open in IMG/M
3300031941|Ga0310912_10767043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium746Open in IMG/M
3300031946|Ga0310910_10345578All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1175Open in IMG/M
3300031947|Ga0310909_10162761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1840Open in IMG/M
3300031954|Ga0306926_10468967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1550Open in IMG/M
3300031954|Ga0306926_10728760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1200Open in IMG/M
3300032001|Ga0306922_10772599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1006Open in IMG/M
3300032001|Ga0306922_11222840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium764Open in IMG/M
3300032003|Ga0310897_10447870All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium619Open in IMG/M
3300032008|Ga0318562_10103571All Organisms → cellular organisms → Bacteria → Proteobacteria1617Open in IMG/M
3300032009|Ga0318563_10433190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium711Open in IMG/M
3300032035|Ga0310911_10387576All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium808Open in IMG/M
3300032043|Ga0318556_10310795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium824Open in IMG/M
3300032054|Ga0318570_10381453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium643Open in IMG/M
3300032055|Ga0318575_10444652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium658Open in IMG/M
3300032060|Ga0318505_10448472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium610Open in IMG/M
3300032064|Ga0318510_10362349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium613Open in IMG/M
3300032065|Ga0318513_10345047All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium725Open in IMG/M
3300032067|Ga0318524_10106188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1395Open in IMG/M
3300032068|Ga0318553_10444149All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium679Open in IMG/M
3300032076|Ga0306924_10216192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2201Open in IMG/M
3300032089|Ga0318525_10429421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium677Open in IMG/M
3300032090|Ga0318518_10486712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium632Open in IMG/M
3300032261|Ga0306920_100242267All Organisms → cellular organisms → Bacteria2691Open in IMG/M
3300032261|Ga0306920_100539527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1729Open in IMG/M
3300032261|Ga0306920_100857869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1330Open in IMG/M
3300032261|Ga0306920_101863656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium847Open in IMG/M
3300032421|Ga0310812_10104559All Organisms → cellular organisms → Bacteria → Proteobacteria1167Open in IMG/M
3300032770|Ga0335085_10057888All Organisms → cellular organisms → Bacteria5194Open in IMG/M
3300032782|Ga0335082_10009967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria10309Open in IMG/M
3300032782|Ga0335082_10933212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium731Open in IMG/M
3300032829|Ga0335070_10000220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales65387Open in IMG/M
3300032893|Ga0335069_10128037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium3172Open in IMG/M
3300033289|Ga0310914_10231474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1657Open in IMG/M
3300034090|Ga0326723_0422285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium607Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.70%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere2.22%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.22%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.74%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.74%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.74%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000443Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemlyEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MBSR1b_0044.000016902162886012Miscanthus RhizosphereMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS
INPgaii200_092393622228664022SoilMTRSSFPLIYQGMLCSRHRCTDRLVDTHECVECVGPARLREMEERCEREELERRVHRVLHEMSDGGKTTLQLVHTTGLSTTQLRPLLEQLASSGMVRFGEERLGHHSRWLWSLLSPPEVQRRSSCR
INPhiseqgaiiFebDRAFT_10191379333300000364SoilMTRSSFPLIYQGMLCSRHRCTDRLVDTHECVECVGPARLREMEERCEREELERRVHRVLHEMSDGGKTTLQLVHTTGLSTTQLRPLLEQLASSGMVRFGEERLGHHSRWLWSLLSPPEVQRRSSCR*
INPhiseqgaiiFebDRAFT_10191460033300000364SoilMTRSTFPLIYRGLLCPRHRCADRLVDTHECVECVGPVRMRQMEERSEREELERRVHRVLHEMSDGGKTTLQLVHTTGLTTTQLRPLLEQLASSGMVRFGEERFGHHSRWLWSLPPVPETQRRSSCR*
F12B_1061216633300000443SoilMMMRSTGPLIYHGRICRRHRCADRLVETHECLECVGPERLRQMEERSERQGLERRVHRVLHEMSDGGKTAVELVHSTGLSMTQLRPVLEQLVSSGRVTFGQERLGHHSRWLWSLLPSGSPRRSSCR*
F14TC_10032003823300000559SoilMLMRSTAPLVYHGRICRRHGCADRLVETHECLECVGPERLRQMEERSERQGLERRVHRVLHEMSDGGKTAVELVHSTGLSMTQLRPVLEQLVSSGRVTFGQERLGHHSRWLWSLLPSGSPRRSSCR*
JGI24742J22300_1011000023300002244Corn, Switchgrass And Miscanthus RhizosphereMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQN
JGI25404J52841_1006674133300003659Tabebuia Heterophylla RhizosphereMTRSSFPLIYQGLACRRHGSADRLVETRECVACVGSERLEQMERTSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGRVRFAEERL
JGI25404J52841_1012760813300003659Tabebuia Heterophylla RhizosphereMEMTRTSFPLIYQGLVCRRHRCADRLVETRECVECVGTERLEQMERASERRALERRIHRVLHEMSDGGKTVVELVHTTGLSASQLRPLLEQLASSGKIRFGEERLGHHSRWLWSSC*
Ga0062593_10002193223300004114SoilMDSPPPRGLAISIRSTAPLIYLGTTCRRHRCAERLVETRECLECVGPERLRRMEEISERQARARQMHRVLHEMSDGGKTALELVHTTGLAMPQLRALLEELASSGRAVLGQEQFRQNGRWLWSRIS*
Ga0062589_10015140013300004156SoilRAAPGTGAGRRLCERAGPVRLKHRPRMDSPPPRGLAISIRSTAPLIYLGTTCRRHRCAERLVETRECLECVGPERLRRMEEISERQARARQMHRVLHEMSDGGKTALELVHTTGLAMPQLRALLEELASSGRAVLGQEQFRQNGRWLWSRIS*
Ga0058860_1059049913300004801Host-AssociatedHELAAPRWLAMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0062594_10012513033300005093SoilMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0065712_1016256113300005290Miscanthus RhizosphereMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLR
Ga0065715_1019763623300005293Miscanthus RhizosphereMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0066388_10009326153300005332Tropical Forest SoilMTHASFPLIYQGLICRRHRSADRLVETRECVECVGPERLRQMENRSQRQAHERRIHRVLHEMSDGGKTVLELAHTTGLSAAQLRPLLDELASSGRVGFAEERLGHHSRWLWSLRRAGSKGRASCP*
Ga0066388_10034648723300005332Tropical Forest SoilMTHSSFPLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQAQERRIHRVLHEMSDGGKTTLELLHTTGLSSTQLRPLLEQLASSGRVRFAEERLGHHSRWLWSLHRAESKRRSSCL*
Ga0066903_10000277523300005764Tropical Forest SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRRIHRVLHEMSDGGKTTLELVHTTGLSAPQLRPLLDQLASSGKVRFAEERLGHHSRWLWSLCRAQGNGRSSCL*
Ga0066903_10254010713300005764Tropical Forest SoilEVGDLSGWRQVTMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRQIHRVLHEMSDGGKTTLELIRTTGLSATQLRPLLDQLASSGRVRFAEERFGHHSRWLWSVCRTRGNGRSSCL*
Ga0081540_101271763300005983Tabebuia Heterophylla RhizosphereMTRSSFPLIYQGLACRRHGSADRLVETRECVACVGSERLEQMERTSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGRVRFAEERLGHHRRWLWSLRRAESKRRSSCL*
Ga0074056_1065682123300006574SoilMLTRSTAPLIYHGTICQRHRCPDRLVDTHECLECVGPARLRRMQESSEREATERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGKVAFRQERLGLHGRWLWSLIPPERQRRSSCR*
Ga0074053_1199077613300006575SoilPRTKSPPPRGLAMLTRSTAPLIYHGTICERHRCPDRLVDTHECLECVGPARLRRMQERSEREATERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGKVAFRQERLGLHGRWLWSLIPPERQRRSSCR*
Ga0074054_1185763413300006579SoilPLIYHGTICERHRCPDRLVDTHECLECVGPARLRRMQERSEREATERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGKVAFRQERLGLHGRWLWSLIPPERQRRSSCR*
Ga0105251_1024379323300009011Switchgrass RhizosphereMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHATGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0105104_10000198373300009168Freshwater SedimentMLMQTTAPLIYHGRICRRHRCADRLVETHECLECVGPARLRQMEERSEREAQERRVHRVLHEMSDGGKTAIQLVHTTGLSMTQLRPLLEELVSSGKVAFGQERLGHHGRWLWSLVPPERQRRASCR*
Ga0126374_1010342413300009792Tropical Forest SoilGWRPVTMTQSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLRQMENRSQRQAHERRIHRVLHEMSDGGKTVLELAHTTGLSAAQLRPLLDELASSGRVGFAEERLGHHSRWLWSLRRAESKGRSSCL*
Ga0126384_1057571413300010046Tropical Forest SoilMTHSSFLLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKRSERHAQERRIHRVLHEMSDGGKTTLELLHTTGLSATQLRPLLEQLASSGRVSFAEERLGHHRRWLWSLRRVETKRRSSCL*
Ga0126384_1165457613300010046Tropical Forest SoilMTHASFPLIYQGQVCRRHRSADRLVATRECVECVGSERLEQMEKTSQRQAQERRIHRVLHEMSDGGKTTLELLHTTGLSAAQLRPLLEQLALSGRVGFAEERLGHHRRWLW
Ga0126384_1211261213300010046Tropical Forest SoilVSDLSASAGRPRDPAAAERLATLTRSSFPLIYHGAFCRRHRSKDRLVETHECVECVGPERLREMEERSERQALERRVHRVLHEMCDGGKTILELVHTTGLSATQLRPLLERLASSGLVTFREERFGHQSHWRWSLPPIE
Ga0126382_1185963813300010047Tropical Forest SoilMTHASFPLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKTSQRQAEERRIHRVLHEMSDGGKTTIELVHTTGLSATQLRPLLEQLASSGKVRFGEERLGHHRRWLWSLRPAESKRGSSCL*
Ga0126373_1152286113300010048Tropical Forest SoilMTHSSSPLIYQGSVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRQIHRVLHEMSDGGKTTLELVHTTGLSATQLRPLLDQLASSGRVRFAEERFGHHSRWLWSVCRTRGNGRSSCL*
Ga0126373_1298833413300010048Tropical Forest SoilMTHSSSPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRSAESKRRSSCL*
Ga0126370_1058286013300010358Tropical Forest SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRQIHRVLHEMSDGGKTTLELIRTTGLSATQLRPLLDQLASSGRVRFAEERFGHHSRWLWSVCRTRGNGRSSCL*
Ga0126372_1207598413300010360Tropical Forest SoilMTHSSFPLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRRAESKRRSSCL*
Ga0126378_1079820213300010361Tropical Forest SoilMMTRATGPLIYHGRICRRHRCADRLVETHECLECVGPERLRQMEERSERQARERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLAFSGRIAFGPERLGTHSRWLWSLLPHESPRRASCR*
Ga0126378_1320488113300010361Tropical Forest SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLHRVESKRRS
Ga0126377_1078631423300010362Tropical Forest SoilMTHSIFPLIYRGLVCRRHRTTDRLVETRERVECVGSERLDQMEKRSERQALERRIHRVLHEMSDGGKTTLELTHTTGLSATQLRPLLELLASSGRVKFAEERLGRHSRWLWSLRLNEGRGG*
Ga0126379_1018711833300010366Tropical Forest SoilAVVETRADRPCAEVCDLSRWRPVTMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRRIHRVLHEMSDGGKTTLELVHTTGLSAPQLRPLLDQLASSGKVRFAEERLGHHSRWLWSLCRAQGNGRSSCL*
Ga0126379_1262991513300010366Tropical Forest SoilMTHSSFLLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKTSERQALERRIHRVLHEMSDGGKTTLELLHTTGLSATQLRPLLEQLASSGRVSFAEERLGHHRRWLWSLRRVETKRRSSCL*
Ga0126381_10213780513300010376Tropical Forest SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRRAESKRRSSCL*
Ga0126383_1047351733300010398Tropical Forest SoilMTHSSFPLIYQGVVCRRHRSADRLVETRECIECVGPERLEQMEKRSEGEALQRRIHRVLHEMSDGGKTTLELVHTTGLSAPQLRPLLDQLASSGKVRFAEERLGHHSRWLWSLHRARGKDRSSC*
Ga0126383_1143169113300010398Tropical Forest SoilMTHSSFLLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKRSERHAQERRIHRVLHEMSDGGKTTLELLHTTGLSATQLRPLLEQLASSGRVSFAEERLGHHRRWL
Ga0134127_1006594053300010399Terrestrial SoilMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHSTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0151490_123057423300011107SoilMLTRSTAPLIYHGTICERHRCPDRLVDTHECLECVGPARLRRMQERSEREATERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGKVAFRQERLGLHGRWLWSLIPPERQRRSSCR*
Ga0157378_1000630773300013297Miscanthus RhizosphereMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRVLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0182008_1039027913300014497RhizosphereLAMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS*
Ga0157376_1008067943300014969Miscanthus RhizosphereMLTRSTAPLIYHGRICRRHRCADRLVETHECLECVGPARLRRMQESSDRQELERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLDQLASSGKVAFGQEQLGHHGRWLWSLIPPERQRRSS*
Ga0132258_1059368923300015371Arabidopsis RhizosphereMLMRSTAPLIYHGQVCLRHRCADRLVDTHECLECVGPVRLRQMEERSERQALERQMHRVLHEMSDGAKTALQLVHTTGLSMTQLRTVLEQLAASGRVAPGQERLGQHSRRLWSLVPFDRQRSSPCR*
Ga0182036_1070939113300016270SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0182041_1113986513300016294SoilMMTRSTGLLIYQGRICRRHRCADRLVETHECLECVGPQRLRQMEERFEREACERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLASSGRIVFGPERLGTHSRWLWSLLPLEPPRRPSCR
Ga0182033_1133783113300016319SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWS
Ga0182035_1151557823300016341SoilMMSRSTGPLIYHGRICRRHRCADRLVETHECLECVGPERLRQMEERSERQARERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0182032_1202983713300016357SoilWRPVKMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0182034_1058307523300016371SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0182039_1056918723300016422SoilMMSRSTGPLIYHGRICRRHRCADRLVETHECLECVGPQRLRQMEERFEREACERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0182038_1027115013300016445SoilKGHLTCAQVSEVSGWRAVTMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0187776_1088630923300017966Tropical PeatlandMTRSTTSPLIYDGAYCPRHRSKDRLVETHECVGCVGTERLREMEERSERQALERRVHRLLHEMSDGGKTTLELVHTTGLSATQLRPLLEKLASSGVVTFREERFGHRRHWRWSLPPLENKRR
Ga0182009_1002236723300021445SoilMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQEPLRQNGRWLWSRVS
Ga0126371_1140771813300021560Tropical Forest SoilMTHSSFLLIYQGQVCRRHRSADRLVETRECVECVGSERLEQMEKRSERHAQERRIHRVLHEMSDGGKTTLELLHTTGLSATQLRPLLEQLASSGRVSFAEERLGHHRR
Ga0207707_1021274023300025912Corn RhizosphereMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS
Ga0207700_1113459023300025928Corn, Switchgrass And Miscanthus RhizosphereMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNG
Ga0209593_10000448213300027743Freshwater SedimentMLMQTTAPLIYHGRICRRHRCADRLVETHECLECVGPARLRQMEERSEREAQERRVHRVLHEMSDGGKTAIQLVHTTGLSMTQLRPLLEELVSSGKVAFGQERLGHHGRWLWSLVPPERQRRASCR
Ga0209465_1004583423300027874Tropical Forest SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGPERLEQMEKRSEREALQRRIHRVLHEMSDGGKTTLELVHTTGLSAPQLRPLLDQLASSGKVRFAEERLGHHSRWLWSLCRAQGNGRSSCL
Ga0318516_1020244523300031543SoilMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318516_1026087823300031543SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318516_1027780423300031543SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0310887_1031267313300031547SoilMLMRSTAPLIYHGQVCLRHRCADRLVDTHECLECVGPVRLRQMEERSERQALERQMHRVLHEMSDGAKTALQLVHTTGLSMTQLRTVLEQLAASGRVAPGQDRLGQHSRRLWSLVPFDR
Ga0318573_1049046013300031564SoilTRPRKGHLTCAQVSEVSGWRPVTMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318515_1057379213300031572SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHH
Ga0318555_1004813923300031640SoilMMTRSTGLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0318555_1010524123300031640SoilSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0318561_1057796523300031679SoilMTHSSFPLIYQGVVCRRHRSADRLVETRECVECVGPERLEEMEKQSEGEALRRRIHRVLHEMSDGGKTTLELVHTTGLTAPQLRPLLDQLASSGRIRFVEERLGHHSRWLWSLCGTRGNGGSSCL
Ga0306917_1108300713300031719SoilGAPDLVRECPRCQVWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0318493_1007063533300031723SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318500_1022897623300031724SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0307468_10202429513300031740Hardwood Forest SoilGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRMHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQERLRQNGRWLWSRVS
Ga0306918_1073836323300031744SoilTGHPSSKGAPDLVRECPRCQVWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318502_1020263823300031747SoilMMTRSTGLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRSSCR
Ga0318492_1016366013300031748SoilHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318492_1057939913300031748SoilLSGWRQVTMTHSSFPLIYQGVVCRRHRSADRLVETRECVECVGPERLEEMEKQSEGEALRRRIHRVLHEMSDGGKTTLELVHTTGLTAPQLRPLLDQLASSGRIRFVEERLGHHSRWLWSLCGTRGNGGSSCL
Ga0318494_1074047613300031751SoilMTRSTGPLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0318537_1034184423300031763SoilMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHH
Ga0318509_1078523213300031768SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318509_1083362813300031768SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHSTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0318526_1045894113300031769SoilRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318521_1047110113300031770SoilPKRPQASGAGARRRRALDVSGSRCGSNRSTRPRKGHLTCAQVSEVSGWRPVTMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318546_1008809913300031771SoilLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318543_1012262513300031777SoilVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0318548_1053340923300031793SoilLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIVFGPERLGTHSRWLWSLLPPESPRRSSCR
Ga0318576_1049613213300031796SoilGLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRSSCR
Ga0318523_1025850613300031798SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0318565_1009408213300031799SoilSGSRCGSNRSTRPRKGHLTCAQVSEVSGWRPVTMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318565_1039064213300031799SoilMMSRSTGPLIYHGRICRRHRCADRLVETHECLECVGPQRLRQMEERFEREACERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLASSGRIVFGPERLGTHSRWLWSLLPPESPRRSSCR
Ga0318497_1051203713300031805SoilTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0318567_1054030413300031821SoilMMSRSTGPLIYHGRICRRHRCADRLVETHECLECVGPQRLRQMEERFEREACERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPL
Ga0318517_1028074313300031835SoilVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318512_1073248113300031846SoilGLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0306925_1174902713300031890SoilMMTRSTGLLIYQGRICRRHRCTDRLVETHECLECVGPERLRQMEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0318536_1021058723300031893SoilVTMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0306921_1099659813300031912SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHSTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0310912_1076704313300031941SoilMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRVEGKPRSSCL
Ga0310910_1034557813300031946SoilDLVRERPRCQVWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0310909_1016276113300031947SoilSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0306926_1046896713300031954SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0306926_1072876013300031954SoilMMTRSTGLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIVFGPERLGTHSRWLWSLLPPESPRRSSCR
Ga0306922_1077259913300032001SoilMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLG
Ga0306922_1122284013300032001SoilMLTRSTAPLIYHGRICQRHRCADRLVETRECLECVGPVRLRQMEERSERQALERRVHRVLHEMSDGAKTALQLVHTTGLSMTQLRPLLEQLTASGKVAFGQERLGRDNRRLWSLVPPERQRRPPCR
Ga0310897_1044787013300032003SoilMLMRSTAPLIYHGQVCLRHRCADRLVDTHECLECVGPVRLRQMEERSERQALERQMHRVLHEMSDGAKTALQLVHTTGLSMTQLRTVLEQLAASGRVAPGQDRLGQNSRRLWSLVPFDRQRSSPCR
Ga0318562_1010357113300032008SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKSSERQELERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318563_1043319013300032009SoilYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0310911_1038757623300032035SoilMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHR
Ga0318556_1031079513300032043SoilVTMTHSSFPLIYQGVVCRRHRSADRLVETRECVECVGPERLEEMEKQSEGEALRRRIHRVLHEMSDGGKTTLELVHTTGLTAPQLRPLLDQLASSGRIRFVEERLGHHSRWLWSLCGTRGNGGSSCL
Ga0318570_1038145323300032054SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0318575_1044465213300032055SoilMTHSSFPLIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0318505_1044847213300032060SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0318510_1036234913300032064SoilLPGWRPVKMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318513_1034504713300032065SoilPSSKGAPDLVRECPRCQVWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0318524_1010618813300032067SoilQGVVCRRHRSADRLVETRECVECVGPERLEEMEKQSEGEALRRRIHRVLHEMSDGGKTTLELVHTTGLTAPQLRPLLDQLASSGRIRFVEERLGHHSRWLWSLCGTRGNGGSSCL
Ga0318553_1044414913300032068SoilARVSEVSGWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0310890_1181966613300032075SoilRLVDTHECLECVGPVRLRQMEERSERQALERQMHRVLHEMSDGAKTALQLVHTTGLSMTQLRTVLEQLAASGRVAPGQDRLGQHSRRLWSLVPFDRQRSSPCR
Ga0306924_1021619243300032076SoilMTQSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0318525_1042942113300032089SoilWRQVTMTHSSFPLIYQGVVCRRHRSADRLVETRECVECVGPERLEEMEKQSEGEALRRRIHRVLHEMSDGGKTTLELVHTTGLTAPQLRPLLDQLASSGRIRFVEERLGHHSRWLWSLCGTRGNGGSSCL
Ga0318518_1048671213300032090SoilLLIYQGRICRRHRCADRLVETHECLECVGPERLRQIEERSERQARERRAHRVLHEMSDGGKTALQLVHTTGLSMTQLRPLLEQLASSGRIAFGPERLGTYSRWLWSLLPLEPPRRPSCR
Ga0306920_10024226743300032261SoilMTHSSFPLIYQGLVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKTILELVHSTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLRPAESKRRSSCL
Ga0306920_10053952733300032261SoilGAPDLVRECPRCQVWRPVTMTHSSFPLIYQGRVCRRHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKIRYAEERLGHHRRWLWSLGHAESKRRSSCL
Ga0306920_10085786913300032261SoilCRRHRCADRLVETHECLECVGPQRLRQMEERFEREACERRAHRVLHEMSDGGKTALQLVHSTGLSMTQLRPLLEQLASSGRIVFGPERLGTHSRWLWSLLPPESPRRSSCR
Ga0306920_10186365633300032261SoilRSTAPLIYHGRICQRHRCADRLVETRECLECVGPVRLRQMEERSERQALERRVHRVLHEMSDGAKTALQLVHTTGLSMTQLRPLLEQLTASGKVAFGQERLGRDNRRLWSLVPPERQRRPPCR
Ga0310812_1010455913300032421SoilMPMRSTAPLIYLGTICRRHGCADRLVETHECLECVGPERLRRMEEISERQERARRIHRLLHEMSDGGKTAIELVHTTGLAMPQLRHLLEELVSSGRATFRQEPLRQNGRWLWSRVS
Ga0335085_1005788833300032770SoilMSVRSTAPLIYLGRICPRHRCADRLVETRECLECVGPRRLRRMQESSERQVRERQMHRVLHEMSDGGKTEVELVHTTGLSLLQLRPLLDELASSGRVVFGLEQLPRSGRWRWSLVPQGRHDGRPRC
Ga0335082_1000996743300032782SoilMLSRSTAPLIYHGRICRRHRCADRLVETHECLECVGPVRLRQMEERTAQQAVQRRVHRVLHEMSDGGKTELQLVHTTGLSMAQLRPLLEQLAAAGRIAYVQERLGHHSRWIWSLTPPRRRSSSPRP
Ga0335082_1093321213300032782SoilMTRSTFPLIYQGLSCVHHRCAERLVDTNECVECVGPVRLRQMEERSERQSMERRMHRVLHEMSDGGKTILQLVHTTGLSTTQLRPLLEQLAAAGLVRFGEERFGHHSRWLWSLLPAPAPSRGHEALRSTARPLGAGRVAPQAQ
Ga0335070_10000220103300032829SoilMTRSTFPLIYQGLSCVHHRCAERLVDTNECVECVGPVRLRQMEERSERQSMERRMHRVLHEMSDGGKTILQLVHTTGLSTTQLRPLLEQLAAAGLVRFGEERFGHHSRWLWSLLPAPAPSRGHEALRSTARPLGAGRVAPQAQRRSSCR
Ga0335069_1012803743300032893SoilMTRSTFPLIYHGAFCRRHHSKDRLVDTHECVECVGPQRLREMEARSERQTLERRVHRVLHEMSDGGKTTLELVHTTGLSAAQLRPLLDQLASSGVIAFREERFGHQSHWRWSLPAWESKRRSSCR
Ga0310914_1023147413300033289SoilIYQGRVCRHHRSADRLVETRECVECVGSERLEQMEKRSERQALERRIHRVLHEMSDGGKSLLELVHTTGLSATQLRPLLEQLASSGKVRFAEERLGHHRRWLWSLGRAESKRRSSCL
Ga0326723_0422285_1_3303300034090Peat SoilMTRSTFPLIYHGAFCRLHRSKDRLVETHECVECVGPERLREMEERSEREALERRVHRVLHEMCDGGKTTLELVHTTGLSATQLRPLLEKLASSGVVTFREERHGHQSHWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.