| Basic Information | |
|---|---|
| Family ID | F058119 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 135 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VRPHAVAALEEVFGLELEELPAEDGAGLWAQPIHAGLAS |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 135 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.04 % |
| % of genes from short scaffolds (< 2000 bps) | 94.07 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.111 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.148 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.444 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.963 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 135 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 35.56 |
| PF16881 | LIAS_N | 8.15 |
| PF06736 | TMEM175 | 4.44 |
| PF04055 | Radical_SAM | 4.44 |
| PF00440 | TetR_N | 3.70 |
| PF07690 | MFS_1 | 2.96 |
| PF00903 | Glyoxalase | 2.96 |
| PF13487 | HD_5 | 2.22 |
| PF01402 | RHH_1 | 1.48 |
| PF03446 | NAD_binding_2 | 0.74 |
| PF01850 | PIN | 0.74 |
| PF03352 | Adenine_glyco | 0.74 |
| PF13462 | Thioredoxin_4 | 0.74 |
| PF14833 | NAD_binding_11 | 0.74 |
| PF07045 | DUF1330 | 0.74 |
| PF10415 | FumaraseC_C | 0.74 |
| PF13539 | Peptidase_M15_4 | 0.74 |
| PF01966 | HD | 0.74 |
| COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 4.44 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.74 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.85 % |
| Unclassified | root | N/A | 28.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01BVWTZ | Not Available | 710 | Open in IMG/M |
| 2199352024|deeps__Contig_188427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300000550|F24TB_10925547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300000955|JGI1027J12803_108850988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 690 | Open in IMG/M |
| 3300000956|JGI10216J12902_117556521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1125 | Open in IMG/M |
| 3300004479|Ga0062595_102141008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300005174|Ga0066680_10923369 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005187|Ga0066675_11101104 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005330|Ga0070690_100466595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 939 | Open in IMG/M |
| 3300005332|Ga0066388_103746778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300005332|Ga0066388_106423556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300005406|Ga0070703_10523672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 537 | Open in IMG/M |
| 3300005434|Ga0070709_11749837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
| 3300005455|Ga0070663_100786406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300005530|Ga0070679_101936322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
| 3300005538|Ga0070731_10613342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300005559|Ga0066700_10217647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1325 | Open in IMG/M |
| 3300005563|Ga0068855_102201614 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 553 | Open in IMG/M |
| 3300005566|Ga0066693_10377328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300005598|Ga0066706_11016680 | Not Available | 638 | Open in IMG/M |
| 3300005764|Ga0066903_101172821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300005884|Ga0075291_1037061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 629 | Open in IMG/M |
| 3300005904|Ga0075280_10008293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1648 | Open in IMG/M |
| 3300006603|Ga0074064_11684228 | Not Available | 519 | Open in IMG/M |
| 3300006796|Ga0066665_11625173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300006854|Ga0075425_100714187 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300006893|Ga0073928_11117125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300006918|Ga0079216_10347455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 904 | Open in IMG/M |
| 3300006918|Ga0079216_10577150 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300007004|Ga0079218_13480484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300009012|Ga0066710_103620085 | Not Available | 582 | Open in IMG/M |
| 3300009012|Ga0066710_103972674 | Not Available | 553 | Open in IMG/M |
| 3300009012|Ga0066710_104375196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300009029|Ga0066793_10610726 | Not Available | 621 | Open in IMG/M |
| 3300009090|Ga0099827_11018849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
| 3300009147|Ga0114129_11802808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
| 3300009147|Ga0114129_12390873 | Not Available | 633 | Open in IMG/M |
| 3300009147|Ga0114129_12725328 | Not Available | 589 | Open in IMG/M |
| 3300009176|Ga0105242_11784966 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009551|Ga0105238_12555681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
| 3300009551|Ga0105238_12633348 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009553|Ga0105249_10494481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 1267 | Open in IMG/M |
| 3300009553|Ga0105249_11260271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
| 3300009840|Ga0126313_11176040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 632 | Open in IMG/M |
| 3300010152|Ga0126318_10327659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300010333|Ga0134080_10310899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
| 3300010373|Ga0134128_10544624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
| 3300010375|Ga0105239_11639233 | Not Available | 744 | Open in IMG/M |
| 3300010396|Ga0134126_10913502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300010399|Ga0134127_10323461 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300011269|Ga0137392_11060583 | Not Available | 665 | Open in IMG/M |
| 3300011994|Ga0120157_1109748 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300011996|Ga0120156_1051600 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012008|Ga0120174_1128442 | Not Available | 608 | Open in IMG/M |
| 3300012198|Ga0137364_10387665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300012208|Ga0137376_10765873 | Not Available | 831 | Open in IMG/M |
| 3300012211|Ga0137377_10843063 | Not Available | 849 | Open in IMG/M |
| 3300012356|Ga0137371_11443689 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012358|Ga0137368_10594234 | Not Available | 704 | Open in IMG/M |
| 3300012469|Ga0150984_109906178 | Not Available | 595 | Open in IMG/M |
| 3300012527|Ga0136633_1285591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300012896|Ga0157303_10229974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300012896|Ga0157303_10262655 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012915|Ga0157302_10453907 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012924|Ga0137413_11019132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300012930|Ga0137407_11318331 | Not Available | 686 | Open in IMG/M |
| 3300012944|Ga0137410_11719564 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012955|Ga0164298_10824782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300012971|Ga0126369_13137899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300012986|Ga0164304_10654407 | Not Available | 792 | Open in IMG/M |
| 3300012987|Ga0164307_11632607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300013306|Ga0163162_11542244 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300013501|Ga0120154_1013727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2198 | Open in IMG/M |
| 3300013763|Ga0120179_1022097 | Not Available | 1561 | Open in IMG/M |
| 3300013768|Ga0120155_1045058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1334 | Open in IMG/M |
| 3300014272|Ga0075327_1148358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300014497|Ga0182008_10258674 | Not Available | 900 | Open in IMG/M |
| 3300015373|Ga0132257_101989275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
| 3300015373|Ga0132257_102223302 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300015374|Ga0132255_100890408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1330 | Open in IMG/M |
| 3300017659|Ga0134083_10307002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300018061|Ga0184619_10293925 | Not Available | 745 | Open in IMG/M |
| 3300018063|Ga0184637_10261275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1054 | Open in IMG/M |
| 3300018073|Ga0184624_10042117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1816 | Open in IMG/M |
| 3300018081|Ga0184625_10294243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300018468|Ga0066662_12367488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
| 3300020081|Ga0206354_10206234 | Not Available | 536 | Open in IMG/M |
| 3300025327|Ga0209751_10278351 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300025864|Ga0209429_10096889 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300025891|Ga0209585_10405187 | Not Available | 558 | Open in IMG/M |
| 3300025906|Ga0207699_11026487 | Not Available | 610 | Open in IMG/M |
| 3300025910|Ga0207684_10389588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1198 | Open in IMG/M |
| 3300025917|Ga0207660_11262832 | Not Available | 600 | Open in IMG/M |
| 3300025921|Ga0207652_10997593 | Not Available | 736 | Open in IMG/M |
| 3300025921|Ga0207652_11756103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300025929|Ga0207664_10014982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5615 | Open in IMG/M |
| 3300025944|Ga0207661_10258796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
| 3300025945|Ga0207679_11910434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
| 3300026036|Ga0208650_1024920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300026075|Ga0207708_10352751 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300026078|Ga0207702_11959009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300026095|Ga0207676_11989821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300026542|Ga0209805_1361345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
| 3300026552|Ga0209577_10059080 | All Organisms → cellular organisms → Bacteria | 3211 | Open in IMG/M |
| 3300028563|Ga0265319_1256615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300028592|Ga0247822_10949584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300028768|Ga0307280_10334381 | Not Available | 557 | Open in IMG/M |
| 3300028799|Ga0307284_10322188 | Not Available | 623 | Open in IMG/M |
| 3300028828|Ga0307312_11049558 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300028880|Ga0307300_10343187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
| 3300028884|Ga0307308_10613018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300029984|Ga0311332_11525912 | Not Available | 542 | Open in IMG/M |
| 3300031249|Ga0265339_10461190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300031251|Ga0265327_10045428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2334 | Open in IMG/M |
| 3300031548|Ga0307408_100211052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1578 | Open in IMG/M |
| 3300031552|Ga0315542_1042096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1913 | Open in IMG/M |
| 3300031564|Ga0318573_10657154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
| 3300031903|Ga0307407_11482974 | Not Available | 536 | Open in IMG/M |
| 3300031938|Ga0308175_100090413 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300031938|Ga0308175_102002546 | Not Available | 649 | Open in IMG/M |
| 3300031996|Ga0308176_10147138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2152 | Open in IMG/M |
| 3300031996|Ga0308176_12027804 | Not Available | 615 | Open in IMG/M |
| 3300032013|Ga0310906_11033388 | Not Available | 592 | Open in IMG/M |
| 3300032044|Ga0318558_10109078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1303 | Open in IMG/M |
| 3300032075|Ga0310890_11526337 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300032164|Ga0315283_10838254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 983 | Open in IMG/M |
| 3300032180|Ga0307471_104095326 | Not Available | 515 | Open in IMG/M |
| 3300032516|Ga0315273_11640503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300032892|Ga0335081_12308865 | Not Available | 562 | Open in IMG/M |
| 3300033407|Ga0214472_11869295 | Not Available | 503 | Open in IMG/M |
| 3300033551|Ga0247830_10506628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 950 | Open in IMG/M |
| 3300033551|Ga0247830_11114837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300034164|Ga0364940_0052359 | Not Available | 1101 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.67% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.70% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.22% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.22% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.22% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.48% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.74% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.74% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.74% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.74% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.74% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.74% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.74% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.74% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026036 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031552 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-20 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_04642670 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | EVTVDDVRPHAVEALEAVFGLELEELPAEDGVGLWAQPVHGELAQKA |
| deeps_03563390 | 2199352024 | Soil | EDAMFTTIAHELERQVTVDEVRPHAVAALEDVFGLELEELPAEDGAGLWGQPIHAQLATP |
| F24TB_109255472 | 3300000550 | Soil | ELGRAVTVDEVRPQAAAALAEVFGLELSELPTEDGAGLWEQPIHAALSAK* |
| JGI1027J12803_1088509883 | 3300000955 | Soil | APAAAIADVFDLELEELPADEGMGLWAQPIHAQLAAR* |
| JGI10216J12902_1175565211 | 3300000956 | Soil | DVTVDEVRPHAAAAIADVFGLELEELPAEDGIGLWAQPVHGELSARA* |
| Ga0062595_1021410081 | 3300004479 | Soil | IARELDRPVTVDEVRPHAVAALAEVFGLELEQLPAEDGAGLWGQPVHAALAG* |
| Ga0066680_109233691 | 3300005174 | Soil | AVTVDEVRPHAVAAIGEVFGLELEELPAEDGAGLWAQPLHRELAGR* |
| Ga0066675_111011042 | 3300005187 | Soil | SVDDVRPAAAEALAEVFDLELVELPSDEGPGLWAQPTHARLAGP* |
| Ga0070690_1004665951 | 3300005330 | Switchgrass Rhizosphere | RRHAATALSEVFDLELSELPAEDGAGLWAQPVHATLSAR* |
| Ga0066388_1037467783 | 3300005332 | Tropical Forest Soil | ERPVTVDEVRPHAVAALEGVFGLELEDLPTEDSAGLWSQPFHEQLATS* |
| Ga0066388_1064235561 | 3300005332 | Tropical Forest Soil | VAVDEVRPHAVAALQEVFGLELEELPAEDGAGLWRQPLHAQLAPSR* |
| Ga0070703_105236722 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PIAVDEVRPHAAAALGEVFALELSELPAEDGAGLWDQPVHAALSTR* |
| Ga0070709_117498371 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ARELDRPVTVDEVRPHAVAALEDVLGLELEELPAEDGVGLWAQPIHARLAG* |
| Ga0070663_1007864061 | 3300005455 | Corn Rhizosphere | TVDEVRPHAVAPLEEVFGLELETLPAEDGAGLWAQPIHAGLAG* |
| Ga0070679_1019363222 | 3300005530 | Corn Rhizosphere | GRPVGVDEVRPAASAALAEVFGLELSELPAEGGAGLWDQPVHAQLASK* |
| Ga0070731_106133421 | 3300005538 | Surface Soil | DDVRPHAVAALQDTFGLELEELPAEDGAGLWPQRIHASLT* |
| Ga0066700_102176474 | 3300005559 | Soil | AAATALEEVFDLSFDELPAEGGAGLWAQPVHVKLGA* |
| Ga0068855_1022016141 | 3300005563 | Corn Rhizosphere | MFTTVARETGRDVTVDDVRPHAVAAISEVFGLELEELPSEDGIGLWSQPVHAQLAARG* |
| Ga0066693_103773281 | 3300005566 | Soil | AALADVFGLELEELPAEDGAGLWPQPLHAHLAAKA* |
| Ga0066706_110166801 | 3300005598 | Soil | ALEDVFGLELEELPADDGPGLWPQPLHAQLAAKS* |
| Ga0066903_1011728211 | 3300005764 | Tropical Forest Soil | SRPVTVDEVRPHAVAALEDVFGLELEELPAEDGAGLWSQPLHEQLAAKA* |
| Ga0075291_10370612 | 3300005884 | Rice Paddy Soil | AALAEVFDLTLEELPTEDGAGLWAQPVHERLAAAT* |
| Ga0075280_100082931 | 3300005904 | Rice Paddy Soil | VAVDEVRPHAVAALAEVFGLELEELPAEDGIGLWAQPRHAELASR* |
| Ga0081538_101341022 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MELGRPLTVDDVRPAAGAALEEVFVELEEIPATDGPGLWKQPIHAQLAR* |
| Ga0074064_116842281 | 3300006603 | Soil | SVDEVRPAARNAFAEVFDLELDELPGGEAGLWPQPRHTALAS* |
| Ga0066665_116251732 | 3300006796 | Soil | VDVEEVRPAAEAAVADVFELEFEALPADDGVGLWRQPIHAQLSAR* |
| Ga0075425_1007141871 | 3300006854 | Populus Rhizosphere | ALADVFGLELEPLPAEDGHGLWQQPVHAQLAAKP* |
| Ga0073928_111171252 | 3300006893 | Iron-Sulfur Acid Spring | GRPVTVDEVRPHAVAALEDVFGLELEELPAEDGAGLWAQPIHAGLAG* |
| Ga0079216_103474552 | 3300006918 | Agricultural Soil | EVRGPALEALAEVFELELEELPAEGLRGLWPQPVHVQLVQR* |
| Ga0079216_105771503 | 3300006918 | Agricultural Soil | VRTPALEALAEVFGLELEELPADGSHGLWPQPVHAPLAAR* |
| Ga0079218_134804842 | 3300007004 | Agricultural Soil | ALAEVFELELEALPADGVSGLWPQPLHEKLAATR* |
| Ga0066710_1036200852 | 3300009012 | Grasslands Soil | VEEVRGPAAEALAEVFGLEFEELQAVEDLDLWSQPVHG |
| Ga0066710_1039726742 | 3300009012 | Grasslands Soil | AFTTVAREAGRTVAVDEVRPHAVTALEEVFGLELDELPAEEGTGLWAQPVHGELASR |
| Ga0066710_1043751961 | 3300009012 | Grasslands Soil | RAVTVDEVRPHAVAALEDVFGLELEALPAEDGIGLWAQPVHSGLAS |
| Ga0066793_106107261 | 3300009029 | Prmafrost Soil | VRPHAVAALEAVFELELEPLPVEDGAGLWAQPVHASLSSR* |
| Ga0099827_110188492 | 3300009090 | Vadose Zone Soil | RPTAAAALAEVFDLELEELPAEDGPGLWAQPVHARLGAR* |
| Ga0114129_118028084 | 3300009147 | Populus Rhizosphere | AAIAEVFGLDLEELPADDGAGLWPQRIHASLAAR* |
| Ga0114129_123908732 | 3300009147 | Populus Rhizosphere | RPAAAAALEQVFGLELEALPADETAGLWAQPVHARLAGAK* |
| Ga0114129_127253281 | 3300009147 | Populus Rhizosphere | AVAAVEEVFGLELEELPAEEGIGLWPQPAHARLAR* |
| Ga0105242_117849662 | 3300009176 | Miscanthus Rhizosphere | AFTTLARELDRPIAVDEVRPHAAAALGEVFDLELSELPAEDGAGLWDQPVHAALSTR* |
| Ga0105238_125556812 | 3300009551 | Corn Rhizosphere | VAALEEVFGLELEELPADEGAGLWPQPRHAQLAH* |
| Ga0105238_126333482 | 3300009551 | Corn Rhizosphere | VDEVRPHAAAALGEVFGLELSELPAEDGAGLWDQPVHAALATR* |
| Ga0105249_104944811 | 3300009553 | Switchgrass Rhizosphere | AALGEVFDLELSELPAEDGAGLWDQPVHAALATR* |
| Ga0105249_112602713 | 3300009553 | Switchgrass Rhizosphere | AALEDVFGLELEELPAEDGTGLWAQPLHAQLAAKA* |
| Ga0126313_111760401 | 3300009840 | Serpentine Soil | RPHAASALTDVFELVLEELPAEGAAGLWPQPLHAKLAATR* |
| Ga0126318_103276593 | 3300010152 | Soil | SALERVFGLELEELPADDGAGLWPQPLHAQLATAR* |
| Ga0134065_103253832 | 3300010326 | Grasslands Soil | ALAEVFELTFEELPTDAGPGLWEQPIHGKLAASR* |
| Ga0134080_103108992 | 3300010333 | Grasslands Soil | ETGRAVTVDEVRPHAVAALEDVFGLELEALPAEDGIGLWAQPVHSGLA* |
| Ga0134128_105446241 | 3300010373 | Terrestrial Soil | HAAAAIAEVFGLELEELPAEDGIGLWAQPVHSQLSVS* |
| Ga0105239_116392333 | 3300010375 | Corn Rhizosphere | ARPHAVAALEGVFGLELEELPAEDGAGLWPQTVHAQLATGS* |
| Ga0134126_109135023 | 3300010396 | Terrestrial Soil | RPNAVAAIERVFGRELEELPAEDGAGLWPQPLHAQLAESR* |
| Ga0134127_103234611 | 3300010399 | Terrestrial Soil | AAALGEVFDLELSELPAEDGAGLWDQPVHAALSTR* |
| Ga0137392_110605831 | 3300011269 | Vadose Zone Soil | TAAAAIGDVFGLELEELPAEDGAGLWAQPLHAKLSS* |
| Ga0120157_11097482 | 3300011994 | Permafrost | VDEVRPAAAAALAEVFGLELEELPGDEQARLWAQTTHAKLATR* |
| Ga0120156_10516001 | 3300011996 | Permafrost | DEVAPHAVAALEDVFGLELEERPAEENQRLWPQPVHAQIAGTH* |
| Ga0120174_11284421 | 3300012008 | Permafrost | VDVDEVRPLATAALEEVFGLQLEELPAKVARGLWPEPVHGQTAGPY* |
| Ga0137364_103876651 | 3300012198 | Vadose Zone Soil | GAALEDVFGLELEELPADDGAGLWPQPLHAQLAAKA* |
| Ga0137376_107658732 | 3300012208 | Vadose Zone Soil | VDDVRPHAVAALEEVFGLELDELPADEGIGLWSQPVHTALASRP* |
| Ga0137377_108430631 | 3300012211 | Vadose Zone Soil | GRTVAVDEVRPHAVTALEEVFGLELDELPADEGTGLWAQPVHGELASR* |
| Ga0137371_114436891 | 3300012356 | Vadose Zone Soil | RPLAVDEVRTAAADALAEVYGLELEELPADSGPGLWAQPVHAKLAE* |
| Ga0137368_105942341 | 3300012358 | Vadose Zone Soil | MFTTIGRETGRSVTVEEVRPHAVSALQEVFDLELEELPAEDGIGLWAQPVHTELACR* |
| Ga0150984_1099061782 | 3300012469 | Avena Fatua Rhizosphere | VRPHAVAALQDVFDLELDELPADEGTGLWSQPVHAQLASR* |
| Ga0136633_12855912 | 3300012527 | Polar Desert Sand | LEDVSFTTIAHELGRPVSVADVRPAAADELAAVFGLELEELPAEDGAGLWRQPVHARLGG |
| Ga0157303_102299742 | 3300012896 | Soil | FTTVARELDRPVPVEEVRPHAVAAIEDVFGLELEELPAEDGAGIWPQPLHAQLAGSR* |
| Ga0157303_102626551 | 3300012896 | Soil | PIAVDEVRPHAAAALGEVLDLELSELPAEDGAGLWDQPVHAALSTR* |
| Ga0157302_104539072 | 3300012915 | Soil | AALGEVFDLELSELPAEDGAGLWAQPVHASLATR* |
| Ga0137413_110191321 | 3300012924 | Vadose Zone Soil | TTVAREAGRPITVDEVRPHAVKALEDVFGLELEELPADQGIGLWSQPVHTALAAR* |
| Ga0137407_113183311 | 3300012930 | Vadose Zone Soil | TVARETGRAVTVDEVRPLAAQGLAEAFDLELDELPAEDAEAFWPQPIHAKLAAKRA* |
| Ga0137410_117195642 | 3300012944 | Vadose Zone Soil | AAADALAEVFGLELEELPADAGAGLWEQPLHAKLAGQR* |
| Ga0164298_108247822 | 3300012955 | Soil | HAAAAIAEVFGLELEELPAEGGVGLWEQPVHAQLSVS* |
| Ga0126369_131378992 | 3300012971 | Tropical Forest Soil | EDAMFTTIASELSRPVTIDEVRPHAVAALEDVFRLELEELPADDGAGLWSQPLHAQLATKA* |
| Ga0164304_106544072 | 3300012986 | Soil | AVTVDDVRPYAVAALQEVFDLELEQLTTEAGAGLWSQPVHAQLASR* |
| Ga0164307_116326072 | 3300012987 | Soil | EDATFTTLARETGRPVTVDEMRPHAVAALEDVFGLELEPLPADDGAGLWAQPVHAGLSTR |
| Ga0163162_115422441 | 3300013306 | Switchgrass Rhizosphere | HAAAALAEVFDVELAELPAEDGAGLWAQPVHASLASR* |
| Ga0120154_10137271 | 3300013501 | Permafrost | DEVAPHAVAALEEVFGLELEERPAEENQRLWPQPVHAQIAGTH* |
| Ga0120179_10220971 | 3300013763 | Permafrost | AGRPVTVDEVRPFAVKALEDVFGLDLEELSADEGIGLWSQPVHSELAAR* |
| Ga0120155_10450581 | 3300013768 | Permafrost | VEEVRPLALKALADLFELEFEDLPADDGLGLWAQPVPARLART* |
| Ga0075327_11483583 | 3300014272 | Natural And Restored Wetlands | AIAAIADVFALELEELPAGDGVRLWPQPVHASLATR* |
| Ga0182008_102586741 | 3300014497 | Rhizosphere | VVRPYAVHAIEAVFGLELEELPAEDGIGLWAQPVHSELAQKA* |
| Ga0132257_1019892751 | 3300015373 | Arabidopsis Rhizosphere | PVGVDEVRPAASAALAEVFGLELSELPAEGGAGLWDQPVHAQLASK* |
| Ga0132257_1022233021 | 3300015373 | Arabidopsis Rhizosphere | EVKPHAAAALGEVFDLELSELPAEDGAGLWDQPVHAALSTR* |
| Ga0132255_1008904081 | 3300015374 | Arabidopsis Rhizosphere | ELGRPVDVDEVRPAASAALAEVFGLELSELPAEGAAGLWDQPVHAQLASK* |
| Ga0134083_103070022 | 3300017659 | Grasslands Soil | RPVTVDEVRPHAVAALEDVFGLQLEPLPADDGIGLWAQPVHSRLAS |
| Ga0184619_102939251 | 3300018061 | Groundwater Sediment | IAREAGRPVAVDEVRPHAVAAVEEVFGLELDELPADEGIGLWAQPVHGELASR |
| Ga0184637_102612751 | 3300018063 | Groundwater Sediment | ALEALAEVFELELEELPADGVHGLWPQPVHAHLAAR |
| Ga0184624_100421174 | 3300018073 | Groundwater Sediment | RLLGVDEVRPEAIRAIGEVFGLVLEELPADDGVGLWRQSIHAALAAR |
| Ga0184625_102942433 | 3300018081 | Groundwater Sediment | LERPLGVDEVRPEAIRAIGEVFGLVLEELPADDGAGLWRQSIHAALAAR |
| Ga0066662_123674881 | 3300018468 | Grasslands Soil | MRPLAAAALEEVFDLELEELPADDGHGLWAQPVHAKLAG |
| Ga0206354_102062342 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | TVDDVRPHAIAALETVFGLELEELPAEDGIGLWAQPVHGGLAQRA |
| Ga0209751_102783513 | 3300025327 | Soil | AAEALAEVFELELEELPAGEGAGLWAQPTHARLAARR |
| Ga0209429_100968894 | 3300025864 | Arctic Peat Soil | EEVRPLAAAALAEVFELELEELPAERDGSTGLWPQPIHEKLSS |
| Ga0209585_104051871 | 3300025891 | Arctic Peat Soil | EVRPYAVAALEEVFGLELEPLPAEDGAGLWAQPVHASLS |
| Ga0207699_110264871 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AEMRPHAVAALEDVFGLELEPLPADGGAGLWAQPVHAGLSTR |
| Ga0207684_103895883 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | APALEALAEVFGLELEELPADGVHGLWPQPVHAQLAAR |
| Ga0207660_112628321 | 3300025917 | Corn Rhizosphere | RPHAVAALEEVFGLELETLPAEDGAGLWAQPIHAGLAG |
| Ga0207652_109975931 | 3300025921 | Corn Rhizosphere | PVTVDDVRPHATAAISEVFGLELEELSAEDGIGLWSQPVHTQLAARA |
| Ga0207652_117561031 | 3300025921 | Corn Rhizosphere | RPHAVAAIEEVFGLQLEELPAEDGAGLWSQPVHAQLAARA |
| Ga0207664_100149826 | 3300025929 | Agricultural Soil | PHAVAALEGVFELDLEELPAEDGAGLWGQPIHAGLAG |
| Ga0207661_102587964 | 3300025944 | Corn Rhizosphere | VDEVRPCAVAALEEVFGLELETLPAEDGAGLWAQPIHAGLAG |
| Ga0207679_119104342 | 3300025945 | Corn Rhizosphere | TTIARELDRPVTVDEVRPCAVAALEEVFGLELETLPAEDGAGLWAQPIHAGLAG |
| Ga0208650_10249203 | 3300026036 | Rice Paddy Soil | VAVDEVRPHAVAALAEVFGLELEELPAEDGIGLWAQPRHAELASR |
| Ga0207708_103527511 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | ARELGRPVTVDEVRPAAAAALERVFGLELEEVPADEGAGLWGQPVHARLSERALT |
| Ga0207702_119590091 | 3300026078 | Corn Rhizosphere | VTVDDVRPHATAAISEVFGLELEELSAEDGIGLWSQPVHTQLAARA |
| Ga0207676_119898211 | 3300026095 | Switchgrass Rhizosphere | TADEVRGPAADALAEVFDLELEELPAEDGAGLWSQPLHAQLAKSK |
| Ga0209805_13613451 | 3300026542 | Soil | DEVRPHAAAALAEVFDLELEELPADDGVGLWPQRLHARLATTP |
| Ga0209577_100590805 | 3300026552 | Soil | DVRPHAVAAIEEVFGLELEALPAEGGPGLWAQPLHAQLATR |
| Ga0265319_12566151 | 3300028563 | Rhizosphere | LDDSTFTTITREAGRPVTVDEVRPHAVAAFEAVFDLELEPLPMEDGAGLWAQPVHASLST |
| Ga0247822_109495842 | 3300028592 | Soil | IEAIAEVYGLELEELPAEDGAGLWPQRIHTSLAAS |
| Ga0307280_103343812 | 3300028768 | Soil | PHAAAALADVFGLELEELPADKGAGLWAQPTHEKLAASR |
| Ga0307284_103221883 | 3300028799 | Soil | EVRPHAVAALADVFGLELEELPAEDGMGLWAQPVHAHLAQR |
| Ga0307312_110495581 | 3300028828 | Soil | AALEEVFALELEELPSEDGADLWPQPVHAHSAGAR |
| Ga0307300_103431872 | 3300028880 | Soil | DEVRPHAAAALAEVFDLELSELPAEDGAGLWDQPVHATLSAT |
| Ga0307308_106130181 | 3300028884 | Soil | YAVSALQEVFELELEELPAEDGIGLWEQPVHAELASR |
| Ga0311332_115259121 | 3300029984 | Fen | AAAALGEVFGLELEELPAEDGHGLWAQPVHAALSQRA |
| Ga0265339_104611901 | 3300031249 | Rhizosphere | AAAFADVFGLELEELPADAGTGLWAQPVHHELAAR |
| Ga0265327_100454285 | 3300031251 | Rhizosphere | RPHAVAAFEAVFELELEPLPMDDGAGLWAQPVHASLAAR |
| Ga0307408_1002110521 | 3300031548 | Rhizosphere | TVDEVRPQAAAALAEVFDLELSELPAEDGAGLWAQPVHATLSAT |
| Ga0315542_10420963 | 3300031552 | Salt Marsh Sediment | EVRPHAVAALENVFGLELETLPAEAGAGLWSQPLHARLAAKS |
| Ga0318573_106571542 | 3300031564 | Soil | RELGHPVTVDEVRPQAVAALEEVFGLELEELPAKDGAGLWAQPIHAQLA |
| Ga0307407_114829741 | 3300031903 | Rhizosphere | DEMRPHALDALAEVFELELEELPDEVRDGLWPQPVPAG |
| Ga0308175_1000904133 | 3300031938 | Soil | HAVAALGEVFDLELDELPADQGAGLWAQPVHTELASR |
| Ga0308175_1020025462 | 3300031938 | Soil | AAAIAEVFGLELEALPAEDGIGLWPQPVHERLSVR |
| Ga0308176_101471384 | 3300031996 | Soil | DRPVTVDEVRPHAVAALAEVFGLELEELPAEDGAGLWGQPIHAGLAG |
| Ga0308176_120278042 | 3300031996 | Soil | VRPHAVAALEEVFGLELEELPAEDGAGLWAQPIHAGLAS |
| Ga0310906_110333882 | 3300032013 | Soil | EVRSAAAAALERVFGLELEEVPSEEGAGLWGQPVHARLSERALT |
| Ga0318558_101090781 | 3300032044 | Soil | PVTVDEVRPQAVAALEEVFGLELEELPAKDGAGLWAQPIHAQLA |
| Ga0310890_115263371 | 3300032075 | Soil | AAAALGEVFDLELSELPAEDGAGLWDQPVHAALSTR |
| Ga0315283_108382541 | 3300032164 | Sediment | VDEVKPAALAALAEVFGLELDELPAADGPGLWAQPVHEKLATR |
| Ga0307471_1040953261 | 3300032180 | Hardwood Forest Soil | PALEALAEVFELELEELPADAGHGLWAQPVHAQLAVRG |
| Ga0315273_116405032 | 3300032516 | Sediment | IRALAEVFELDFEELPADDGAGLWPQSIHASLAAR |
| Ga0335081_123088652 | 3300032892 | Soil | VAALEGVFELELEELPAEDGAGLWPQPRHAELATR |
| Ga0214472_118692952 | 3300033407 | Soil | VDEVRPHAAAALELVFQITFEELPAAEGAGLWEQPLHAELAARR |
| Ga0247830_105066283 | 3300033551 | Soil | GPHAAAALAEVFDLELSELPAEDGAGLWAQPVHATLSTR |
| Ga0247830_111148371 | 3300033551 | Soil | EVRPAAAAALGDVFGLALEEVPSEDGAGLWAQPVHARLSA |
| Ga0364940_0052359_951_1085 | 3300034164 | Sediment | VHDVRPHAAAAVAEVFGLELEALPDDDGPALWAQPTHAKLAPSR |
| ⦗Top⦘ |